The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
250
|
structure length |
247
|
Chain Sequence |
MRILLTNDDGIHAEGLAVLERIARKLSDDVWVVAPETDQSGLAHSLTLLEPLRLRQIDARHFALRGTPTDCVIMGVRHVLPGAPDLVLSGVNSGANMADDVTYSGTVAGAMEGTLLGVRAIALSQEYEYRRIVPWETAEAHAPELIGRLMEAGWPEGVLLNLNFPNCAPEEVKGVRVTAQGKLSHDARLDERRDGRGFPYFWLHFGRGKAPVADDSDIAAIRSGCISMTPLHLDLTAHKVRAELGAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
5'-nucleotidase SurE
|
publication title |
Structural and functional insights into the stationary-phase survival protein SurE, an important virulence factor of Brucella abortus
pubmed doi rcsb |
source organism |
Brucella abortus s19
|
total genus |
65
|
structure length |
247
|
sequence length |
250
|
chains with identical sequence |
C, D, G
|
ec nomenclature |
ec
3.1.3.5: 5'-nucleotidase. |
pdb deposition date | 2015-04-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01975 | SurE | Survival protein SurE |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Stationary-phase Survival Protein Sure Homolog; Chain: A, | Survival protein SurE-like phosphatase/nucleotidase |
#chains in the Genus database with same CATH superfamily 1L5X A; 2V4O A; 2E6G A; 2V4N A; 4XER A; 4XGB A; 4RYT A; 2WQK A; 2E6H A; 4RYU A; 4XH8 A; 4ZG5 A; 1J9K A; 3TY2 A; 2E69 A; 2E6B A; 4XJ7 A; 1ILV A; 4G9O A; 2E6C A; 4GAD A; 2E6E A; 1J9L A; 1J9J A; 4XGP A; 4XEP A; #chains in the Genus database with same CATH topology 1L5X A; 2V4O A; 2E6G A; 2V4N A; 4XER A; 4XGB A; 4RYT A; 2WQK A; 2E6H A; 4RYU A; 4XH8 A; 4ZG5 A; 1J9K A; 3TY2 A; 2E69 A; 2E6B A; 4XJ7 A; 1ILV A; 4G9O A; 2E6C A; 4GAD A; 2E6E A; 1J9L A; 1J9J A; 4XGP A; 4XEP A; #chains in the Genus database with same CATH homology 1L5X A; 2V4O A; 2E6G A; 2V4N A; 4XER A; 4XGB A; 4RYT A; 2WQK A; 2E6H A; 4RYU A; 4XH8 A; 4ZG5 A; 1J9K A; 3TY2 A; 2E69 A; 2E6B A; 4XJ7 A; 1ILV A; 4G9O A; 2E6C A; 4GAD A; 2E6E A; 1J9L A; 1J9J A; 4XGP A; 4XEP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...