4DIJA

The central valine concept provides an entry in a new class of non peptide inhibitors of the p53-mdm2 interaction
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
QIPASEQETLVRPKPELLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central valine concept provides an entry in a new class of non peptide inhibitors of the p53-MDM2 interaction.
pubmed doi rcsb
molecule keywords E3 ubiquitin-protein ligase Mdm2
molecule tags Ligase/ligase inhibitor
source organism Homo sapiens
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02201 SWIB SWIB/MDM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.245.10 Mainly Alpha Orthogonal Bundle MDM2 SWIB/MDM2 domain 4dijA00
4MDQA 2LZGA 2GV2A 1Z1MA 4EREA 4JVRA 4OBAA 5C5AA 4LWTA 3JZQA 4OGVA 3EQSA 5TRFA 4DIJA 4ERFA 4JWRA 3FDOA 4HG7A 4UD7A 3LBKA 4J7EA 1T4EA 3EQYA 4OGNA 4J7DA 2MWYA 5LN2A 1T4FM 4ZYCA 4OASA 5HMKA 3V3BA 2M86B 4WT2A 5HMHA 4IPFA 5HMIA 1RV1A 4ZYFA 4LWUA 2RUHA 4UE1A 3U15A 4UMNA 2N0WA 1TTVA 3VZVA 3DACA 2N06A 4OGTA 4JVEA 3JZKA 4ZFIA 5LAYA 3FEAA 4QO4A 4JV7A 4JV9A 5LAWA 2Z5TM 4OCCA 4JRGA 4JSCA 4QOCA 3LNZA 4J3EA 2N0UA 4RXZA 3G03A 3JZRA 3LBLA 3JZPA 5AFGA 1V32A 3TPXA 4ZYIA 3LNJA 2Z5SM 2VYRA 3TU1A 3JZOA 4HFZA 4LWVA 3IWYA 3VBGA 3JZSA 1YCRA 4J74A 1UHRA 4MDNA 3FE7A 3TJ2A 1YCQA 2MPSA 2N14A 4ODFA 4ZGKA 3LBJE 5LAZA 4ODEA 1V31A 3IUXA 4HBMA 4OQ3A 2AXIA 4N5TA 3W69A 5LAVA 3DABA
chains in the Genus database with same CATH superfamily
4MDQA 2LZGA 2GV2A 1Z1MA 4EREA 4JVRA 4OBAA 5C5AA 4LWTA 3JZQA 4OGVA 3EQSA 5TRFA 4DIJA 4ERFA 4JWRA 3FDOA 4HG7A 4UD7A 3LBKA 4J7EA 1T4EA 3EQYA 4OGNA 4J7DA 2MWYA 5LN2A 1T4FM 4ZYCA 4OASA 5HMKA 3V3BA 2M86B 4WT2A 5HMHA 4IPFA 5HMIA 1RV1A 4ZYFA 4LWUA 2RUHA 4UE1A 3U15A 4UMNA 2N0WA 1TTVA 3VZVA 3DACA 2N06A 4OGTA 4JVEA 3JZKA 4ZFIA 5LAYA 3FEAA 4QO4A 4JV7A 4JV9A 5LAWA 2Z5TM 4OCCA 4JRGA 4JSCA 4QOCA 3LNZA 4J3EA 2N0UA 4RXZA 3G03A 3JZRA 3LBLA 3JZPA 5AFGA 1V32A 3TPXA 4ZYIA 3LNJA 2Z5SM 2VYRA 3TU1A 3JZOA 4HFZA 4LWVA 3IWYA 3VBGA 3JZSA 1YCRA 4J74A 1UHRA 4MDNA 3FE7A 3TJ2A 1YCQA 2MPSA 2N14A 4ODFA 4ZGKA 3LBJE 5LAZA 4ODEA 1V31A 3IUXA 4HBMA 4OQ3A 2AXIA 4N5TA 3W69A 5LAVA 3DABA
chains in the Genus database with same CATH topology
4MDQA 2LZGA 2GV2A 1Z1MA 4EREA 4JVRA 4OBAA 5C5AA 4LWTA 3JZQA 4OGVA 3EQSA 5TRFA 4DIJA 4ERFA 4JWRA 3FDOA 4HG7A 4UD7A 3LBKA 4J7EA 1T4EA 3EQYA 4OGNA 4J7DA 2MWYA 5LN2A 1T4FM 4ZYCA 4OASA 5HMKA 3V3BA 2M86B 4WT2A 5HMHA 4IPFA 5HMIA 1RV1A 4ZYFA 4LWUA 2RUHA 4UE1A 3U15A 4UMNA 2N0WA 1TTVA 3VZVA 3DACA 2N06A 4OGTA 4JVEA 3JZKA 4ZFIA 5LAYA 3FEAA 4QO4A 4JV7A 4JV9A 5LAWA 2Z5TM 4OCCA 4JRGA 4JSCA 4QOCA 3LNZA 4J3EA 2N0UA 4RXZA 3G03A 3JZRA 3LBLA 3JZPA 5AFGA 1V32A 3TPXA 4ZYIA 3LNJA 2Z5SM 2VYRA 3TU1A 3JZOA 4HFZA 4LWVA 3IWYA 3VBGA 3JZSA 1YCRA 4J74A 1UHRA 4MDNA 3FE7A 3TJ2A 1YCQA 2MPSA 2N14A 4ODFA 4ZGKA 3LBJE 5LAZA 4ODEA 1V31A 3IUXA 4HBMA 4OQ3A 2AXIA 4N5TA 3W69A 5LAVA 3DABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDQ A;  2LZG A;  2GV2 A;  1Z1M A;  4ERE A;  4JVR A;  4OBA A;  5C5A A;  4LWT A;  3JZQ A;  4OGV A;  3EQS A;  5TRF A;  4DIJ A;  4ERF A;  4JWR A;  3FDO A;  4HG7 A;  4UD7 A;  3LBK A;  4J7E A;  1T4E A;  3EQY A;  4OGN A;  4J7D A;  2MWY A;  5LN2 A;  1T4F M;  4ZYC A;  4OAS A;  5HMK A;  3V3B A;  2M86 B;  4WT2 A;  5HMH A;  4IPF A;  5HMI A;  1RV1 A;  4ZYF A;  4LWU A;  2RUH A;  4UE1 A;  3U15 A;  4UMN A;  2N0W A;  1TTV A;  3VZV A;  3DAC A;  2N06 A;  4OGT A;  4JVE A;  3JZK A;  4ZFI A;  5LAY A;  3FEA A;  4QO4 A;  4JV7 A;  4JV9 A;  5LAW A;  2Z5T M;  4OCC A;  4JRG A;  4JSC A;  4QOC A;  3LNZ A;  4J3E A;  2N0U A;  4RXZ A;  3G03 A;  3JZR A;  3LBL A;  3JZP A;  5AFG A;  1V32 A;  3TPX A;  4ZYI A;  3LNJ A;  2Z5S M;  2VYR A;  3TU1 A;  3JZO A;  4HFZ A;  4LWV A;  3IWY A;  3VBG A;  3JZS A;  1YCR A;  4J74 A;  1UHR A;  4MDN A;  3FE7 A;  3TJ2 A;  1YCQ A;  2MPS A;  2N14 A;  4ODF A;  4ZGK A;  3LBJ E;  5LAZ A;  4ODE A;  1V31 A;  3IUX A;  4HBM A;  4OQ3 A;  2AXI A;  4N5T A;  3W69 A;  5LAV A;  3DAB A; 
#chains in the Genus database with same CATH topology
 4MDQ A;  2LZG A;  2GV2 A;  1Z1M A;  4ERE A;  4JVR A;  4OBA A;  5C5A A;  4LWT A;  3JZQ A;  4OGV A;  3EQS A;  5TRF A;  4DIJ A;  4ERF A;  4JWR A;  3FDO A;  4HG7 A;  4UD7 A;  3LBK A;  4J7E A;  1T4E A;  3EQY A;  4OGN A;  4J7D A;  2MWY A;  5LN2 A;  1T4F M;  4ZYC A;  4OAS A;  5HMK A;  3V3B A;  2M86 B;  4WT2 A;  5HMH A;  4IPF A;  5HMI A;  1RV1 A;  4ZYF A;  4LWU A;  2RUH A;  4UE1 A;  3U15 A;  4UMN A;  2N0W A;  1TTV A;  3VZV A;  3DAC A;  2N06 A;  4OGT A;  4JVE A;  3JZK A;  4ZFI A;  5LAY A;  3FEA A;  4QO4 A;  4JV7 A;  4JV9 A;  5LAW A;  2Z5T M;  4OCC A;  4JRG A;  4JSC A;  4QOC A;  3LNZ A;  4J3E A;  2N0U A;  4RXZ A;  3G03 A;  3JZR A;  3LBL A;  3JZP A;  5AFG A;  1V32 A;  3TPX A;  4ZYI A;  3LNJ A;  2Z5S M;  2VYR A;  3TU1 A;  3JZO A;  4HFZ A;  4LWV A;  3IWY A;  3VBG A;  3JZS A;  1YCR A;  4J74 A;  1UHR A;  4MDN A;  3FE7 A;  3TJ2 A;  1YCQ A;  2MPS A;  2N14 A;  4ODF A;  4ZGK A;  3LBJ E;  5LAZ A;  4ODE A;  1V31 A;  3IUX A;  4HBM A;  4OQ3 A;  2AXI A;  4N5T A;  3W69 A;  5LAV A;  3DAB A; 
#chains in the Genus database with same CATH homology
 4MDQ A;  2LZG A;  2GV2 A;  1Z1M A;  4ERE A;  4JVR A;  4OBA A;  5C5A A;  4LWT A;  3JZQ A;  4OGV A;  3EQS A;  5TRF A;  4DIJ A;  4ERF A;  4JWR A;  3FDO A;  4HG7 A;  4UD7 A;  3LBK A;  4J7E A;  1T4E A;  3EQY A;  4OGN A;  4J7D A;  2MWY A;  5LN2 A;  1T4F M;  4ZYC A;  4OAS A;  5HMK A;  3V3B A;  2M86 B;  4WT2 A;  5HMH A;  4IPF A;  5HMI A;  1RV1 A;  4ZYF A;  4LWU A;  2RUH A;  4UE1 A;  3U15 A;  4UMN A;  2N0W A;  1TTV A;  3VZV A;  3DAC A;  2N06 A;  4OGT A;  4JVE A;  3JZK A;  4ZFI A;  5LAY A;  3FEA A;  4QO4 A;  4JV7 A;  4JV9 A;  5LAW A;  2Z5T M;  4OCC A;  4JRG A;  4JSC A;  4QOC A;  3LNZ A;  4J3E A;  2N0U A;  4RXZ A;  3G03 A;  3JZR A;  3LBL A;  3JZP A;  5AFG A;  1V32 A;  3TPX A;  4ZYI A;  3LNJ A;  2Z5S M;  2VYR A;  3TU1 A;  3JZO A;  4HFZ A;  4LWV A;  3IWY A;  3VBG A;  3JZS A;  1YCR A;  4J74 A;  1UHR A;  4MDN A;  3FE7 A;  3TJ2 A;  1YCQ A;  2MPS A;  2N14 A;  4ODF A;  4ZGK A;  3LBJ E;  5LAZ A;  4ODE A;  1V31 A;  3IUX A;  4HBM A;  4OQ3 A;  2AXI A;  4N5T A;  3W69 A;  5LAV A;  3DAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...