The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
250
|
structure length |
247
|
Chain Sequence |
MRILLTNDDGIHAEGLAVLERIARKLSDDVWVVAPETDQSGLAHSLTLLEPLRLRQIDARHFALRGTPTDCVIMGVRHVLPGAPDLVLSGVNSGANMADDVTYSGTVAGAMEGTLLGVRAIALSQEYEYRRIVPWETAEAHAPELIGRLMEAGWPEGVLLNLNFPNCAPEEVKGVRVTAQGKLSHDARLDERRDGRGFPYFWLHFGRGKAPVADDSDIAAIRSGCISMTPLHLDLTAHKVRAELGAA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and functional insights into the stationary-phase survival protein SurE, an important virulence factor of Brucella abortus
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Brucella abortus s19
|
| molecule keywords |
5'-nucleotidase SurE
|
| total genus |
65
|
| structure length |
247
|
| sequence length |
250
|
| chains with identical sequence |
C, D, G
|
| ec nomenclature |
ec
3.1.3.5: 5'-nucleotidase. |
| pdb deposition date | 2015-04-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01975 | SurE | Survival protein SurE |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Stationary-phase Survival Protein Sure Homolog; Chain: A, | Survival protein SurE-like phosphatase/nucleotidase |
#chains in the Genus database with same CATH superfamily 2E6E A; 4XEP A; 2E6H A; 1ILV A; 4XGB A; 4XJ7 A; 4GAD A; 1J9J A; 2E6C A; 2V4O A; 4XER A; 4ZG5 A; 2E6B A; 2V4N A; 1L5X A; 4RYT A; 3TY2 A; 1J9L A; 2E69 A; 2E6G A; 1J9K A; 4G9O A; 4RYU A; 4XGP A; 4XH8 A; 2WQK A; #chains in the Genus database with same CATH topology 2E6E A; 4XEP A; 2E6H A; 1ILV A; 4XGB A; 4XJ7 A; 4GAD A; 1J9J A; 2E6C A; 2V4O A; 4XER A; 4ZG5 A; 2E6B A; 2V4N A; 1L5X A; 4RYT A; 3TY2 A; 1J9L A; 2E69 A; 2E6G A; 1J9K A; 4G9O A; 4RYU A; 4XGP A; 4XH8 A; 2WQK A; #chains in the Genus database with same CATH homology 2E6E A; 4XEP A; 2E6H A; 1ILV A; 4XGB A; 4XJ7 A; 4GAD A; 1J9J A; 2E6C A; 2V4O A; 4XER A; 4ZG5 A; 2E6B A; 2V4N A; 1L5X A; 4RYT A; 3TY2 A; 1J9L A; 2E69 A; 2E6G A; 1J9K A; 4G9O A; 4RYU A; 4XGP A; 4XH8 A; 2WQK A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
