6YW5OO

The structure of the small subunit of the mitoribosome from neurospora crassa
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
276
Chain Sequence
ISQKEKKRKMKQDPYGWAQAQQRKAVNVKRQAELQAQRDAAWGDPVKGITTPFVESFDSAGQASVSPPKVEEPKPLPTSPHLRNYLLNKDEFDSAIQYAEHILKPIKAEDRLTADPEKEDEEAREHAARHAKAVAALERIAKLEHGGAKDRKHANIRRCIETFGRHITDQSLERPTPPLARGVEPKPQPVRAGPDTGSSEVQIAILTSKIRALSKALEGHGGNRDKNNKRSLRRLCHKRQRLLRYMERKERGSGRWHHMLETLGLTPATWKGQITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
pubmed doi rcsb
molecule tags Translation
molecule keywords uS2m
total genus 91
structure length 276
sequence length 283
ec nomenclature
pdb deposition date 2020-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
OO PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...