8BQSAD

Cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
441
structure length
441
Chain Sequence
SYGNLKDQDRIFTNLYRDGDPFVKGALKRGDWHQTKEILSNGPEWIIDEIKKSGLRGRGGAGFLSGLKYSFMPKVNPDGRPSYLVINSDESEPGTCKDREILRNDPHKLVEGALVVGFSMRARAAYIYIRGEFWVEANILQQAIDEAYAKGFIGKNACGSGYDFDVYIHRGAGAYICGEETGLIESIEGKAGQPRVKPPFPANAGLYGCPTTVTNVETVAVCPTIMRRGASWFASFGRPNNAGTKLYCISGHVNNPCTVEEEMSIPLRELLEKHCGGVRGGWDNLLAVIPGGSSVPMMPKNVCDDVLMDFDALKAVGSGLGTAAVIVMDKSTDPIDAILRLSKFYKHESCGQCTPCREGTGWIVDVMERLLVGNADYAEIDMLQQVTQQIEMHTICALGDAAAWPVQGLIKNFREEIEDRIDSYHAKHPQLKKSRKSNPQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of mitochondrial membrane bending by I-II-III2-IV2 supercomplex
rcsb
molecule tags Electron transport
molecule keywords Lipid-A-disaccharide synthase
total genus 117
structure length 441
sequence length 441
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2022-11-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...