The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
169
|
structure length |
169
|
Chain Sequence |
HMASDDRATGPALTPLVVAAAATSAKVEVDSPPAPVTHGAAMPTLSSATAQPLPVASAPVLSAPLGSHEWQQTFSQQVMLFTRQGQQSAQLRLHPEELGQVHISLKLDDNQAQLQMVSPHSHVRAALEAALPMLRTQLAESGIQLGQSSISSESFAGQQQSSSQQQSSR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Protein transport
|
molecule keywords |
Flagellar hook-length control protein
|
publication title |
The NMR structure of FliK, the trigger for the switch of substrate specificity in the flagellar type III secretion apparatus
pubmed doi rcsb |
source organism |
Salmonella typhimurium
|
total genus |
23
|
structure length |
169
|
sequence length |
169
|
ec nomenclature | |
pdb deposition date | 2011-01-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02120 | Flg_hook | Flagellar hook-length control protein FliK |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | Transcription Regulator spoIIAA |
#chains in the Genus database with same CATH superfamily 2RRL A; #chains in the Genus database with same CATH topology 3V97 A; 1N6D A; 3IF5 A; 3LKL A; 4QTP A; 3GVK A; 1V0E A; 3D03 A; 3IH9 A; 1WXW A; 3LLO A; 2OAS A; 3OIZ A; 3T6O A; 4AE2 A; 1H4Z A; 3VSE A; 1TID B; 3ZXN A; 1K32 A; 3GMF A; 1FC6 A; 1FC7 A; 1AUZ A; 4DGH A; 1BPL A; 3DJA A; 5EUS A; 3IH8 A; 2RRL A; 3JU4 A; 1T6R A; 3MGL A; 5EUZ A; 2CWW A; 2DXN A; 1THN B; 3GK7 A; 1TH8 B; 2DXL A; 4XS5 A; 3K50 A; 3GVJ A; 3EH7 A; 3NY7 A; 4L1C A; 1N6E A; 3AGE A; 3C0K A; 4JC0 A; 4HIZ A; 2ZOA A; 3GVL A; 3LDF A; 3IHA A; 3MOG A; 1HF2 A; 3D3U A; 3OIR A; 1SBO A; 4GHN A; 1H4Y A; 5EUU A; 1N6F A; 4DGF A; 1V0F A; 3ZTB A; 3DOR A; 4L8K A; 5EUX A; 3QDQ A; 3DUP A; 2KA5 A; 1WXX A; 2KLN A; 1TIL B; 1BUZ A; 4HYL A; 1FC9 A; 1FCF A; 5EZB A; 3GHF A; 1H4X A; 3IHB A; 2B78 A; 5EUW A; 3AGD A; 3F43 A; 4AEJ A; 3V8V A; 2VY9 A; 4DMG A; 2ZO9 B; 1VC1 A; 2AS0 A; 1J7X A; #chains in the Genus database with same CATH homology 1N6D A; 3D03 A; 4AE2 A; 4JC0 A; 2DXN A; 1K32 A; 2ZOA A; 3MOG A; 1FC9 A; 1FCF A; 3GMF A; 1FC6 A; 1N6E A; 2DXL A; 3GHF A; 4GHN A; 2RRL A; 3K50 A; 1FC7 A; 1N6F A; 4AEJ A; 1BPL A; 4L1C A; 3DJA A; 3DOR A; 4L8K A; 2ZO9 B; 3DUP A; 1J7X A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...