The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
143
|
structure length |
132
|
Chain Sequence |
SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSANIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Motor protein
|
| molecule keywords |
Prestin
|
| publication title |
Structure of the cytosolic portion of the motor protein prestin and functional role of the STAS domain in SLC26/SulP anion transporters.
pubmed doi rcsb |
| source organism |
Rattus norvegicus
|
| total genus |
44
|
| structure length |
132
|
| sequence length |
143
|
| ec nomenclature | |
| pdb deposition date | 2010-01-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01740 | STAS | STAS domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | STAS domain |
#chains in the Genus database with same CATH superfamily 1AUZ A; 2KLN A; 3ZTB A; 5EUZ A; 1T6R A; 4DGF A; 4DGH A; 1BUZ A; 3LLO A; 3LKL A; 5EZB A; 3AGD A; 3AGE A; 1SBO A; 3T6O A; 1TID B; 3F43 A; 1H4X A; 3ZXN A; 3OIZ A; 3IH9 A; 1TH8 B; 1VC1 A; 1TIL B; 3IHA A; 4HYL A; 3NY7 A; 1THN B; 4QTP A; 5EUU A; 3IHB A; 3IF5 A; 3OIR A; 2KA5 A; 3IH8 A; 2VY9 A; 5EUW A; 5EUS A; 1H4Y A; 1H4Z A; 4XS5 A; 5EUX A; 3MGL A; #chains in the Genus database with same CATH topology 4DGF A; 3LLO A; 4JC0 A; 3LKL A; 5EZB A; 1FCF A; 3GHF A; 3OIZ A; 1K32 A; 4L8K A; 4HYL A; 2B78 A; 3D3U A; 5EUW A; 3LDF A; 4L1C A; 1H4Y A; 1FC9 A; 3VSE A; 2ZOA A; 4XS5 A; 3GVK A; 3EH7 A; 2CWW A; 1J7X A; 1BUZ A; 3AGD A; 1SBO A; 1N6D A; 1H4X A; 1FC6 A; 3DOR A; 1HF2 A; 3V97 A; 2AS0 A; 1WXW A; 3IHB A; 3IF5 A; 2VY9 A; 3K50 A; 5EUS A; 3GMF A; 5EUX A; 3T6O A; 3C0K A; 2KLN A; 2OAS A; 5EUZ A; 1T6R A; 4DMG A; 3DUP A; 3GVL A; 4AEJ A; 1V0E A; 1WXX A; 1TID B; 3ZXN A; 3V8V A; 1FC7 A; 1TH8 B; 1VC1 A; 2ZO9 B; 1TIL B; 3NY7 A; 2DXN A; 4QTP A; 3OIR A; 2KA5 A; 3IH8 A; 1N6E A; 3GK7 A; 2RRL A; 1H4Z A; 3MGL A; 1AUZ A; 3ZTB A; 4DGH A; 4GHN A; 3AGE A; 3F43 A; 1BPL A; 3IH9 A; 4HIZ A; 3GVJ A; 2DXL A; 3DJA A; 3MOG A; 3IHA A; 3D03 A; 1V0F A; 1THN B; 4AE2 A; 5EUU A; 3JU4 A; 3QDQ A; 1N6F A; #chains in the Genus database with same CATH homology 1AUZ A; 2KLN A; 3ZTB A; 5EUZ A; 1T6R A; 4DGF A; 4DGH A; 1BUZ A; 3LLO A; 3LKL A; 5EZB A; 3AGD A; 3AGE A; 1SBO A; 3T6O A; 1TID B; 3F43 A; 1H4X A; 3ZXN A; 3OIZ A; 3IH9 A; 1TH8 B; 1VC1 A; 1TIL B; 3IHA A; 4HYL A; 3NY7 A; 1THN B; 4QTP A; 5EUU A; 3IHB A; 3IF5 A; 3OIR A; 2KA5 A; 3IH8 A; 2VY9 A; 5EUW A; 5EUS A; 1H4Y A; 1H4Z A; 4XS5 A; 5EUX A; 3MGL A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
