The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
169
|
sequence length |
476
|
structure length |
447
|
Chain Sequence |
SPTLSESHKSARNVLENIGIKIYNQEIKKKNPYEQQLKGTLDGNSCNLDHLFGRKPCYGREQNRFDENAEAYCNSDKIRGNENNANGAACAPPRRRHICDQNLEFLDNKNTNTAHDLLGNVLVTAKYEGNYIVNDHPDKNSNGNKAGICTSLARSFADIGDIVRGRDMFLPNKDDKVQKGLQVVFKKIYKSLTPEARKHYAHGDGSGNYAKLREDWWTINREQIWKALTCSAPYYADYFRKGSDGTLHFSSHGKCGHNEGAPPTYLDYVPQFLRWFEEWSEEFCRIKKIKIDKVKKECRDEQNKKYCSGDGHDCTQTNLAHNQIFVDLDCPRCQDQCIKYNEWIVKKLEEFYKQNLKYSMEIQKWKKTKNNYYDKEFYENLDKKSYSTIDKFLNLLNNGKHCHDNKDEKNKIDFNKPIKTFSISEYCKTCPLYGVTCTNRGICIHNS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Membrane protein
|
molecule keywords |
ERYTHROCYTE MEMBRANE PROTEIN 1
|
publication title |
Structure of a Plasmodium Falciparum Pfemp1 Rosetting Domain Reveals a Role for the N-Terminal Segment in Heparin-Mediated Rosette Inhibition.
pubmed doi rcsb |
source organism |
Plasmodium falciparum palo alto/uganda
|
total genus |
169
|
structure length |
447
|
sequence length |
476
|
ec nomenclature | |
pdb deposition date | 2010-10-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05424 | Duffy_binding | Duffy binding domain |
A | PF15447 | NTS | N-terminal segments of PfEMP1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | 5 helical Cullin repeat like | 5 helical Cullin repeat like |
#chains in the Genus database with same CATH superfamily 3CPZ A; 3BQI A; 4NUU A; 4YFS A; 3BQL A; 3RRC A; 4NUV A; 2WAU A; 2Y8D A; 5F3J A; 3CML A; 2XU0 A; 3BQK A; #chains in the Genus database with same CATH topology 1LDK B; 1U6G A; 3BQI A; 4JGH D; 4APF B; 2Y8D A; 3CML A; 4EOZ B; 4NUU A; 4YFS A; 2PFV A; 3RRC A; 4NUV A; 4AP2 B; 3DPL C; 3BQL A; 2WZK A; 2WAU A; 2B1E A; 5F3J A; 1LDJ A; 4HXI B; 4WQO D; 3BQK A; 1LDK A; 3CPZ A; 4N9F 3; 4F52 A; 3DQV C; 4A64 A; 4P5O A; 2XU0 A; 3RTR A; #chains in the Genus database with same CATH homology 3CPZ A; 3BQI A; 2Y8D A; 4NUU A; 4YFS A; 3BQL A; 2PFV A; 3RRC A; 4NUV A; 2WAU A; 2B1E A; 5F3J A; 3CML A; 2XU0 A; 3BQK A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...