The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
57
|
structure length |
57
|
Chain Sequence |
KGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transferase regulator
|
molecule keywords |
cAMP-dependent protein kinase type I-beta regulatory subunit
|
publication title |
Crystal Structure of human cAMP-dependent protein kinase type I-beta regulatory subunit (fragment 11-73), Northeast Structural Genomics Consortium (NESG) Target HR8613A
rcsb |
source organism |
Homo sapiens
|
total genus |
21
|
structure length |
57
|
sequence length |
57
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2012-05-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02197 | RIIa | Regulatory subunit of type II PKA R-subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | cAMP-dependent Protein Kinase, Chain A | cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domain |
#chains in the Genus database with same CATH superfamily 4ZP3 A; 4RIQ A; 2EZW A; 3IM4 A; 4RTA A; 3G36 A; 1L6E A; 4F9K A; 1R2A A; 2KYG A; 5HVZ A; 2IZY A; 2H9R A; 3IM3 A; 4RT4 A; 2DRN A; #chains in the Genus database with same CATH topology 3RRS A; 2KYG A; 3QG0 A; 2CQT A; 2H9R A; 2DRN A; 3PMI A; 3S4C A; 4RIQ A; 4RTA A; 2RQY A; 3G36 A; 1L6E A; 2K9Q A; 1R2A A; 3UFE A; 4RT4 A; 3ACS A; 4ZP3 A; 3QFY A; 2KNG A; 3GWH A; 2CBG A; 3ACT A; 3QFZ A; 2IZY A; 2CQS A; 2I15 A; 3QDE A; 3RSY A; 2CB9 A; 2OUT A; 3S4B A; 2EZW A; 3IM4 A; 3AFJ A; 3S4A A; 4F9K A; 3S4D A; 5HVZ A; 3IM3 A; #chains in the Genus database with same CATH homology 4ZP3 A; 4RIQ A; 2EZW A; 3IM4 A; 4RTA A; 3G36 A; 1L6E A; 4F9K A; 1R2A A; 2KYG A; 5HVZ A; 2IZY A; 2H9R A; 3IM3 A; 4RT4 A; 2DRN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...