1AMLA

The alzheimer`s disease amyloid a4 peptide (residues 1-40)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
40
structure length
40
Chain Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of amyloid A4-(1-40)-peptide of Alzheimer's disease.
pubmed doi rcsb
molecule keywords AMYLOID A4
molecule tags Serine protease inhibitor
source organism Homo sapiens
total genus 4
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1995-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.230.10 Few Secondary Structures Irregular Amyloid A4 Amyloidogenic glycoprotein, amyloid-beta peptide 1amlA00
1BA4A 1AMLA 1IYTA 1Z0QA
chains in the Genus database with same CATH superfamily
1BA4A 1AMLA 1IYTA 1Z0QA
chains in the Genus database with same CATH topology
1BA4A 1AMLA 1IYTA 1Z0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BA4 A;  1AML A;  1IYT A;  1Z0Q A; 
#chains in the Genus database with same CATH topology
 1BA4 A;  1AML A;  1IYT A;  1Z0Q A; 
#chains in the Genus database with same CATH homology
 1BA4 A;  1AML A;  1IYT A;  1Z0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...