The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
5
|
sequence length |
51
|
structure length |
51
|
Chain Sequence |
YASLEEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Glycolysis
|
molecule keywords |
DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
|
publication title |
Three-dimensional solution structure of the E3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of Escherichia coli.
pubmed doi rcsb |
source organism |
Escherichia coli
|
total genus |
5
|
structure length |
51
|
sequence length |
51
|
ec nomenclature |
ec
2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase. |
pdb deposition date | 1992-02-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02817 | E3_binding | e3 binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Dihydrolipoamide Transferase | E3-binding domain |
#chains in the Genus database with same CATH superfamily 1W88 I; 1W4K A; 2PDD A; 1EBD C; 3DV0 I; 1ZY8 K; 2WXC A; 1W4E A; 1BAL A; 1W4J A; 1W4I A; 3RNM E; 1ZWV A; 1W4F A; 3DVA I; 2PDE A; 2F5Z K; 1W85 I; 4QOY E; 1W4G A; 1W4H A; 2BTG A; 2EQ9 C; 2F60 K; 2BTH A; 1W3D A; #chains in the Genus database with same CATH topology 1W88 I; 1W4K A; 2PDD A; 1EBD C; 3DV0 I; 1ZY8 K; 2WXC A; 1W4E A; 1BAL A; 1W4J A; 1W4I A; 3RNM E; 1ZWV A; 1W4F A; 3DVA I; 2PDE A; 2F5Z K; 1W85 I; 4QOY E; 1W4G A; 1W4H A; 2BTG A; 2EQ9 C; 2F60 K; 2BTH A; 1W3D A; #chains in the Genus database with same CATH homology 1W88 I; 1W4K A; 2PDD A; 1EBD C; 3DV0 I; 1ZY8 K; 2WXC A; 1W4E A; 1BAL A; 1W4J A; 1W4I A; 3RNM E; 1ZWV A; 1W4F A; 3DVA I; 2PDE A; 2F5Z K; 1W85 I; 4QOY E; 1W4G A; 1W4H A; 2BTG A; 2EQ9 C; 2F60 K; 2BTH A; 1W3D A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...