The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
89
|
structure length |
89
|
Chain Sequence |
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Inhibitor/oxidoreductase
|
| molecule keywords |
DYNEIN LIGHT CHAIN 8
|
| publication title |
Structural basis of diverse sequence-dependent target recognition by the 8 kDa dynein light chain.
pubmed doi rcsb |
| source organism |
Rattus norvegicus
|
| total genus |
19
|
| structure length |
89
|
| sequence length |
89
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2000-07-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01221 | Dynein_light | Dynein light chain type 1 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Protein Inhibitor Of Neuronal Nitric Oxide Synthase | Protein Inhibitor Of Neuronal Nitric Oxide Synthase; |
#chains in the Genus database with same CATH superfamily 1CMI A; 3DVT A; 4D07 A; 4QH7 A; 1PWK A; 1F95 A; 3P8M A; 3RJS A; 1PWJ A; 3ZKF A; 3DVP A; 2P2T A; 1F96 A; 3E2B A; 4HT6 A; 3DVH A; 5E0M A; 3GLW A; 4QH8 A; 4DS1 A; 3BRL A; 1F3C A; 3BRI A; 1RE6 A; 3ZKE A; 2PG1 A; 1RHW A; 5E0L A; 3FM7 E; 2XQQ A; #chains in the Genus database with same CATH topology 1CMI A; 3DVT A; 4D07 A; 4QH7 A; 1PWK A; 1F95 A; 3P8M A; 3RJS A; 1PWJ A; 3ZKF A; 3DVP A; 2P2T A; 1F96 A; 3E2B A; 4HT6 A; 3DVH A; 5E0M A; 3GLW A; 4QH8 A; 4DS1 A; 3BRL A; 1F3C A; 3BRI A; 1RE6 A; 3ZKE A; 2PG1 A; 1RHW A; 5E0L A; 3FM7 E; 2XQQ A; #chains in the Genus database with same CATH homology 1CMI A; 3DVT A; 4D07 A; 4QH7 A; 1PWK A; 1F95 A; 3P8M A; 3RJS A; 1PWJ A; 3ZKF A; 3DVP A; 2P2T A; 1F96 A; 3E2B A; 4HT6 A; 3DVH A; 5E0M A; 3GLW A; 4QH8 A; 4DS1 A; 3BRL A; 1F3C A; 3BRI A; 1RE6 A; 3ZKE A; 2PG1 A; 1RHW A; 5E0L A; 3FM7 E; 2XQQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
