The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
24
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
DRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Protein binding
|
molecule keywords |
Dynein light chain 2
|
publication title |
Directed evolution reveals the binding motif preference of the LC8/DYNLL hub protein and predicts large numbers of novel binders in the human proteome.
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
24
|
structure length |
87
|
sequence length |
87
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-10-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01221 | Dynein_light | Dynein light chain type 1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Protein Inhibitor Of Neuronal Nitric Oxide Synthase | Protein Inhibitor Of Neuronal Nitric Oxide Synthase; |
#chains in the Genus database with same CATH superfamily 3ZKE A; 1RHW A; 1F3C A; 3DVP A; 2P2T A; 5E0M A; 4QH7 A; 4HT6 A; 1CMI A; 4QH8 A; 3ZKF A; 1F96 A; 3RJS A; 2XQQ A; 1PWJ A; 1F95 A; 1PWK A; 3DVH A; 5E0L A; 3DVT A; 3E2B A; 4D07 A; 1RE6 A; 3FM7 E; 3BRL A; 3P8M A; 3BRI A; 3GLW A; 4DS1 A; 2PG1 A; #chains in the Genus database with same CATH topology 3ZKE A; 1RHW A; 1F3C A; 3DVP A; 2P2T A; 5E0M A; 4QH7 A; 4HT6 A; 1CMI A; 4QH8 A; 3ZKF A; 1F96 A; 3RJS A; 2XQQ A; 1PWJ A; 1F95 A; 1PWK A; 3DVH A; 5E0L A; 3DVT A; 3E2B A; 4D07 A; 1RE6 A; 3FM7 E; 3BRL A; 3P8M A; 3BRI A; 3GLW A; 4DS1 A; 2PG1 A; #chains in the Genus database with same CATH homology 3ZKE A; 1RHW A; 1F3C A; 3DVP A; 2P2T A; 5E0M A; 4QH7 A; 4HT6 A; 1CMI A; 4QH8 A; 3ZKF A; 1F96 A; 3RJS A; 2XQQ A; 1PWJ A; 1F95 A; 1PWK A; 3DVH A; 5E0L A; 3DVT A; 3E2B A; 4D07 A; 1RE6 A; 3FM7 E; 3BRL A; 3P8M A; 3BRI A; 3GLW A; 4DS1 A; 2PG1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...