The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
104
|
structure length |
104
|
Chain Sequence |
ANVVVSNPRPIFTESRSFKAVANGKIYIGQIDTDPVNPANQIPVYIENEDGSHVQITQPLIINAAGKIVYNGQLVKIVTVQGHSMAIYDANGSQVDYIANVLKY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Phage P22 tailspike protein: crystal structure of the head-binding domain at 2.3 A, fully refined structure of the endorhamnosidase at 1.56 A resolution, and the molecular basis of O-antigen recognition and cleavage.
pubmed doi rcsb |
| molecule keywords |
TAILSPIKE PROTEIN
|
| molecule tags |
Viral protein
|
| source organism |
Enterobacteria phage p22
|
| total genus |
14
|
| structure length |
104
|
| sequence length |
104
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature | |
| pdb deposition date | 1997-10-17 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Tailspike Protein; Chain | Phage P22 tailspike-like, N-terminal domain |
#chains in the Genus database with same CATH superfamily 2VNL A; 2XC1 A; 1LKT A; 2VKY B; #chains in the Genus database with same CATH topology 2VNL A; 2XC1 A; 1LKT A; 2VKY B; #chains in the Genus database with same CATH homology 2VNL A; 2XC1 A; 1LKT A; 2VKY B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
