1T62A

Crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
166
structure length
153
Chain Sequence
MLKNVEVFWQNFLDKHELDMLMPDVWMFGDGSSEMGNRLGQLVVSGRKTATCSSLDIYKMEEEQLPKAGQYDIILDGQSQPLAIIRTTKVEIMPMNKVSESFAQAEGLDYWYEEHARFFKEELAPYQLQFYPDMLLVCQSFEVVDLYTHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of conserved hypothetical protein [gi:29377587] from Enterococcus faecalis v583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 30
structure length 153
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.400.10 Alpha Beta Roll Sulfate adenylyltransferase Sulfate adenylyltransferase 1t62A00
1JECA 3S9XA 4MAFA 1T62A 1X6VA 1J70A 2GKSA 3CR8A 1I2DA 1JEEA 1G8HA 1R6XA 1V47A 4DNXA 1G8FA 1XJQA 1JHDA 1XNJA 2QJFA 1G8GA 1JEDA 1M8PA
chains in the Genus database with same CATH superfamily
1JECA 3S9XA 4MAFA 1T62A 1X6VA 1J70A 2GKSA 3CR8A 1I2DA 1JEEA 1G8HA 1R6XA 1V47A 4DNXA 1G8FA 1XJQA 1JHDA 1XNJA 2QJFA 1G8GA 1JEDA 1M8PA
chains in the Genus database with same CATH topology
1JECA 3S9XA 4MAFA 1T62A 1X6VA 1J70A 2GKSA 3CR8A 1I2DA 1JEEA 1G8HA 1R6XA 1V47A 4DNXA 1G8FA 1XJQA 1JHDA 1XNJA 2QJFA 1G8GA 1JEDA 1M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JEC A;  3S9X A;  4MAF A;  1T62 A;  1X6V A;  1J70 A;  2GKS A;  3CR8 A;  1I2D A;  1JEE A;  1G8H A;  1R6X A;  1V47 A;  4DNX A;  1G8F A;  1XJQ A;  1JHD A;  1XNJ A;  2QJF A;  1G8G A;  1JED A;  1M8P A; 
#chains in the Genus database with same CATH topology
 1JEC A;  3S9X A;  4MAF A;  1T62 A;  1X6V A;  1J70 A;  2GKS A;  3CR8 A;  1I2D A;  1JEE A;  1G8H A;  1R6X A;  1V47 A;  4DNX A;  1G8F A;  1XJQ A;  1JHD A;  1XNJ A;  2QJF A;  1G8G A;  1JED A;  1M8P A; 
#chains in the Genus database with same CATH homology
 1JEC A;  3S9X A;  4MAF A;  1T62 A;  1X6V A;  1J70 A;  2GKS A;  3CR8 A;  1I2D A;  1JEE A;  1G8H A;  1R6X A;  1V47 A;  4DNX A;  1G8F A;  1XJQ A;  1JHD A;  1XNJ A;  2QJF A;  1G8G A;  1JED A;  1M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...