The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
159
|
structure length |
159
|
Chain Sequence |
LYFQGMEERSQLFLEQYLSSVSREVSEKYTSFSADYFCADEYNANVCADLILRGEKRASCSLEYWYSQKGELMPQVGHLQVVTNWDGKPICIIEITSVSKCQYNQVSEDFAASEGEGDKSLAWWQEAHRNFFSRECHELGIEFREDMLLVLEHFKVVYH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
High resolution crystal structure of ASCH domain from Lactobacillus crispatus JV V101
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Vibrio cholerae tma 21
|
molecule keywords |
ASCH domain
|
total genus |
50
|
structure length |
159
|
sequence length |
159
|
ec nomenclature | |
pdb deposition date | 2011-06-02 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Sulfate adenylyltransferase | Sulfate adenylyltransferase |
#chains in the Genus database with same CATH superfamily 1J70 A; 1I2D A; 1R6X A; 1JED A; 4DNX A; 1G8H A; 1G8G A; 1X6V A; 1JEE A; 1XJQ A; 1JHD A; 1V47 A; 3S9X A; 2GKS A; 1G8F A; 1M8P A; 4MAF A; 2QJF A; 3CR8 A; 1JEC A; 1XNJ A; 1T62 A; #chains in the Genus database with same CATH topology 1J70 A; 1I2D A; 1R6X A; 1JED A; 4DNX A; 1G8H A; 1G8G A; 1X6V A; 1JEE A; 1XJQ A; 1JHD A; 1V47 A; 3S9X A; 2GKS A; 1G8F A; 1M8P A; 4MAF A; 2QJF A; 3CR8 A; 1JEC A; 1XNJ A; 1T62 A; #chains in the Genus database with same CATH homology 1J70 A; 1I2D A; 1R6X A; 1JED A; 4DNX A; 1G8H A; 1G8G A; 1X6V A; 1JEE A; 1XJQ A; 1JHD A; 1V47 A; 3S9X A; 2GKS A; 1G8F A; 1M8P A; 4MAF A; 2QJF A; 3CR8 A; 1JEC A; 1XNJ A; 1T62 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...