The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
86
|
sequence length |
229
|
structure length |
226
|
Chain Sequence |
MTNIEILENMLKLQQKLNDETNGLNWENGYTKEGKLISWRRCIYMECAELIDSFTWKHWKNISSLTNWENVRIEIVDIWHFILSLLLEEYNNKDFKAIATEVNAVSVFQDFCKEEEYPNEGDIYGILNDIELIIHKCSGFGFNLGELLSTYFTLAIKCGLNLEILYKTYIGKNVLNIFRQNNGYKDGSYKKTWNGKEDNEVLAQILEQELDFDTIYKKLEECYKKA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Crystal Structure of a Complex of Campylobacter Jejuni Dutpase with Substrate Analogue Sheds Light on the Mechanism and Suggests the "Basic Module" for Dimeric D(C/U)Tpases
pubmed doi rcsb |
| molecule keywords |
DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDE HYDROLASE
|
| molecule tags |
Hydrolase
|
| source organism |
Campylobacter jejuni
|
| total genus |
86
|
| structure length |
226
|
| sequence length |
229
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.6.1.23: dUTP diphosphatase. |
| pdb deposition date | 2004-07-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08761 | dUTPase_2 | dUTPase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | all-alpha NTP pyrophosphatase fold | Type II deoxyuridine triphosphatase |
#chains in the Genus database with same CATH superfamily 4DKB A; 4DLC A; 1W2Y A; 4DL8 A; 4DK4 A; 2CIC A; #chains in the Genus database with same CATH topology 4DKB A; 4DLC A; 1W2Y A; 4DL8 A; 4DK4 A; 2CIC A; #chains in the Genus database with same CATH homology 4DKB A; 4DLC A; 1W2Y A; 4DK2 A; 2CJE A; 2YAY A; 1OGK A; 4DL8 A; 2YB0 A; 4DK4 A; 1OGL A; 2YAZ A; 2CIC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...