1BA4A

The solution structure of amyloid beta-peptide (1-40) in a water-micelle environment. is the membrane-spanning domain where we think it is? nmr, 10 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
40
structure length
40
Chain Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoprotein
molecule keywords AMYLOID BETA-PEPTIDE
publication title Solution structure of amyloid beta-peptide(1-40) in a water-micelle environment. Is the membrane-spanning domain where we think it is?
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1998-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.230.10 Few Secondary Structures Irregular Amyloid A4 Amyloidogenic glycoprotein, amyloid-beta peptide 1ba4A00
1BA4A 1Z0QA 1AMLA 1IYTA
chains in the Genus database with same CATH superfamily
1BA4A 1Z0QA 1AMLA 1IYTA
chains in the Genus database with same CATH topology
1BA4A 1Z0QA 1AMLA 1IYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BA4 A;  1Z0Q A;  1AML A;  1IYT A; 
#chains in the Genus database with same CATH topology
 1BA4 A;  1Z0Q A;  1AML A;  1IYT A; 
#chains in the Genus database with same CATH homology
 1BA4 A;  1Z0Q A;  1AML A;  1IYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...