1BALA

Three-dimensional solution structure of the e3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of (escherichia coli)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
51
structure length
51
Chain Sequence
YASLEEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycolysis
molecule keywords DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
publication title Three-dimensional solution structure of the E3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 5
structure length 51
sequence length 51
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02817 E3_binding e3 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.320.10 Few Secondary Structures Irregular Dihydrolipoamide Transferase E3-binding domain 1balA00
2F5ZK 3DVAI 1W4IA 1W4GA 1ZY8K 2EQ9C 3DV0I 4QOYE 1W85I 1W4FA 3RNME 2F60K 1W4KA 1ZWVA 2WXCA 2BTGA 1W3DA 1EBDC 2PDDA 2BTHA 2PDEA 1W4HA 1W4EA 1W4JA 1W88I 1BALA
chains in the Genus database with same CATH superfamily
2F5ZK 3DVAI 1W4IA 1W4GA 1ZY8K 2EQ9C 3DV0I 4QOYE 1W85I 1W4FA 3RNME 2F60K 1W4KA 1ZWVA 2WXCA 2BTGA 1W3DA 1EBDC 2PDDA 2BTHA 2PDEA 1W4HA 1W4EA 1W4JA 1W88I 1BALA
chains in the Genus database with same CATH topology
2F5ZK 3DVAI 1W4IA 1W4GA 1ZY8K 2EQ9C 3DV0I 4QOYE 1W85I 1W4FA 3RNME 2F60K 1W4KA 1ZWVA 2WXCA 2BTGA 1W3DA 1EBDC 2PDDA 2BTHA 2PDEA 1W4HA 1W4EA 1W4JA 1W88I 1BALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5Z K;  3DVA I;  1W4I A;  1W4G A;  1ZY8 K;  2EQ9 C;  3DV0 I;  4QOY E;  1W85 I;  1W4F A;  3RNM E;  2F60 K;  1W4K A;  1ZWV A;  2WXC A;  2BTG A;  1W3D A;  1EBD C;  2PDD A;  2BTH A;  2PDE A;  1W4H A;  1W4E A;  1W4J A;  1W88 I;  1BAL A; 
#chains in the Genus database with same CATH topology
 2F5Z K;  3DVA I;  1W4I A;  1W4G A;  1ZY8 K;  2EQ9 C;  3DV0 I;  4QOY E;  1W85 I;  1W4F A;  3RNM E;  2F60 K;  1W4K A;  1ZWV A;  2WXC A;  2BTG A;  1W3D A;  1EBD C;  2PDD A;  2BTH A;  2PDE A;  1W4H A;  1W4E A;  1W4J A;  1W88 I;  1BAL A; 
#chains in the Genus database with same CATH homology
 2F5Z K;  3DVA I;  1W4I A;  1W4G A;  1ZY8 K;  2EQ9 C;  3DV0 I;  4QOY E;  1W85 I;  1W4F A;  3RNM E;  2F60 K;  1W4K A;  1ZWV A;  2WXC A;  2BTG A;  1W3D A;  1EBD C;  2PDD A;  2BTH A;  2PDE A;  1W4H A;  1W4E A;  1W4J A;  1W88 I;  1BAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...