The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
121
|
structure length |
121
|
Chain Sequence |
WKMQATVTEIGKHAIDDSEKMIILFGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVGSFANSNLQSIAHSTLIFADAPTDEDDVIRNGVYLTPHQLPKITIGTTIDYLV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Enterococcus faecalis
|
| molecule keywords |
PTS system, IIA component
|
| total genus |
29
|
| structure length |
121
|
| sequence length |
121
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2005-12-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03829 | PTSIIA_gutA | PTS system glucitol/sorbitol-specific IIA component |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | M1 Pyruvate Kinase; Domain 3 | Phosphotransferase system, glucitol/sorbitol-specific IIA component |
#chains in the Genus database with same CATH superfamily 2F9H A; #chains in the Genus database with same CATH topology 4FXJ A; 3PP7 A; 3QV9 A; 2VGF A; 3SRD A; 3T07 A; 4B2D A; 3BJT A; 3G2G A; 1E0U A; 2VGG A; 1A49 A; 1O67 A; 1A5U A; 3T0T A; 4IP7 A; 1T5A A; 4IMA A; 3E0V A; 3QV7 A; 3E0W A; 3GG8 A; 3HQN A; 1AQF A; 3HQP A; 3HQO A; 2E28 A; 3QTG A; 4B2D D; 4DRS A; 4QG9 A; 2G50 A; 1E0T A; 1ORU A; 3EOE A; 1PKN A; 1F3X A; 3ME3 A; 4G1N A; 3IS4 A; 3H6O A; 3N25 A; 3SRK A; 4JPG A; 2F9H A; 4QG8 A; 3GQY A; 3KTX A; 4WJ8 A; 4QGC A; 1A3X A; 3GR4 A; 1O65 A; 3QV6 A; 1PKL A; 4YJ5 A; 3KHD A; 1PKM A; 1A3W A; 1PKY A; 3T05 A; 1F3W A; 2VGB A; 3SRH A; 1ZJH A; 2VGI A; 4FXF A; 3MA8 A; 3BJF A; 3SRF A; 3U2Z A; #chains in the Genus database with same CATH homology 2F9H A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
