1E0UA

Structure r271l mutant of e. coli pyruvate kinase
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
470
structure length
461
Chain Sequence
MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRUVATE KINASE
publication title The Allosteric Regulation of Pyruvate Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 166
structure length 461
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.33.10 Mainly Beta Beta Barrel M1 Pyruvate Kinase; Domain 3 PK beta-barrel domain-like 1e0uA03
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1e0uA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 1e0uA01
3T07A 4IMAA 3N25A 2R82A 2G50A 1ZJHA 2HWGA 1PKMA 4JPGA 4HYWA 1F61A 3M0JA 4FXJA 3OYZA 4LSBA 3G2GA 4KCTA 4B5VA 3EOLA 4QGCA 3SRDA 1O66A 1S2WA 3BJFA 4DRSA 1Z6KA 2E28A 3R4IA 1M1BA 1M3UA 2DIKA 1DQUA 1UJQA 2DUAA 3BJTA 1GGOA 1A49A 1E0UA 3SRKA 3LYEA 1OQFA 4TV6A 4WJ8A 1F8MA 3E5BA 1S2TA 4G1NA 2QIWA 3I4EA 1KBLA 2VGGA 1ZLPA 1F3WA 4YJ5A 3FA4A 4KCVA 4L9ZA 4B2DD 3EOEA 4B5TA 1PKYA 2VGIA 3HQNA 3E0WA 3MA8A 1VP8A 3QLLA 3QTGA 1PKLA 2WQDA 3KHDA 2VGFA 4B5XA 1VBHA 1XG3A 4KCUA 4KRZA 4IP7A 2VWTA 3M0KA 3QV8A 1DIKA 1A3WA 3P0XA 1U5HA 3EZ4A 2BG5A 3IS4A 1F8IA 1AQFA 1U5VA 2V5JA 1IGWA 3SRFA 4IQEA 3GQYA 2L5HA 4TV5A 3OYXA 3ME3A 3U2ZA 4KCWA 3QQWA 2V5KA 3HQPA 4B5WA 1IZCA 1PYMA 4L9YA 2VWSA 3GG8A 1O68A 3QV7A 4HYVA 4QG6A 1A5UA 1O5QA 4RPPA 2HROA 3PUGA 2XDFA 2X0SA 3OQ8A 3GR4A 5TAOA 3T05A 3PP7A 1XG4A 4MF4A 1PKNA 2OLSA 4MG4A 4L80A 4L7ZA 3QV9A 2KX9A 1S2VA 2ZE3A 4B2DA 4B5UA 3QV6A 1SGJA 5JVLA 4YNGA 2XZ7A 3H6OA 3T0TA 3LG3A 3QZ6A 1OY0A 1S2UA 1T57A 3SRHA 1T5AA 1MUMA 4ROQA 3E0VA 3HQOA 3VAVA 3EOOA 4QG8A 1VBGA 4IQDA 2XZ9A 4FXFA 2HRWA 1DXEA 1F3XA 1KC7A 2HJPA 3B8IA 1DXFA 1JDEA 4QG9A 2VGBA 3FA3A 1E0TA 4B5SA 1A3XA 3KTXA 4KS0A
chains in the Genus database with same CATH superfamily
5D32A 5LIKX 2R82A 3C8NA 3FYOA 4QQ3A 3UERA 3LMZA 2IKIA 2QW5A 3FXGA 1UKPA 5CSYA 4QEHA 3NCOA 3H2CA 4AIUA 3EGJA 5C6MA 4M6UA 3L4ZA 5REQB 3UY8A 1H7NA 3FA4A 3NVDA 1Z44A 1AH3A 3EOEA 4CVWA 4QDMA 3M5ZA 1BWKA 4PTNA 3RCMA 4PUDA 1ZCOA 1CLKA 2C91A 3G5EA 3UZZA 4FO4A 4O4WA 3EMQA 3I3EA 2FHCA 5FSEC 2VWSA 1X7FA 4HMEA 3Q2DA 3KUMA 2ISSA 4I6KA 3LNMA 1FQ0A 1Q7MA 4F3HA 1BXNA 3E5PA 5ABFB 2BHUA 3JW7A 3MZNA 1JCTA 4MNLA 1G94A 1Q6LA 4OOUA 3GZAA 5DLCA 4JIPA 3TU9A 1XF0A 2YB4A 1ZBWA 2QMJA 3BOLA 3GXPA 3LTPA 3STCA 3MKCA 3WL0A 4MWAA 3PVFA 1EQPA 1UASA 3VC6A 4YCPA 4BHYA 4IX0A 7A3HA 3IV8A 1QOXA 1QW7A 1TX0A 2OSXA 2FDSA 4MWAC 1W0MA 2NSOA 2OQYA 1P4CA 2C13A 1DIDA 1B3ZA 3PZQA 4LY8A 1BKHA 3LCHA 1A3XA 1HJWA 2X8RA 3WK2A 2AL2A 1EIXA 1JPHA 1V3MA 1EFZA 4KWUA 1IEWA 3MP3A 1B30A 1F3TA 1OVDA 3W1UA 4QAIA 5M17A 4LOCA 5AECA 3DGBA 3ABZA 1G0CA 2V5DA 4PYSA 2NZLA 2ZRUA 1XH2A 5H8PA 3L4XA 4F40A 2ZKMX 1E4LA 4BKNA 3EOUA 3GTFA 4W86A 5F4WA 3K1DA 4IGHA 3BZJA 3E0WA 2EEXA 3QHNA 3GM8A 4LF1A 2X40A 3WMLA 4GBDA 4LF2A 1PZ2A 3WJXA 2SFPA 2J7DA 1THFD 4B90A 2PZNA 5LNSA 2FVMA 4CVUA 3FNDA 1E9ZB 2QGYA 1QOQA 2CKSA 4TOQA 5H8UA 3ZVIA 3WD3A 2FH8A 1YIXA 1EC8A 4HU4A 3WO8A 1V02E 2OMAA 1J79A 5HWJA 3CWOX 4UTHA 1QRQA 2YGYA 4QRNA 3DI0A 1HL9A 4UBPC 4TVUA 2YIHA 2GK1B 6A3HA 4Z42C 4TIMA 3KOZA 3RF9A 2WMHA 2PP0A 5KZDA 2G97A 4R7JA 4XSMA 4DO5A 4FK9A 4CU8A 1I2QA 1E1EA 2CU0A 1BPLB 5E1QA 1KO0A 5LA2A 1J12A 3F5LA 1R47A 4LALA 1BKSA 2YDRA 3SQSA 2NT0A 1HKIA 4LUSA 5GVJA 4JIHA 1V03A 2I56A 4LRSA 1QI2A 1U2YA 1JQXA 3TOYA 5CGMA 1KC7A 2Y7GA 1DXFA 4XD6A 5BWFA 3PJUA 1L2QA 4P7NA 2FZ8A 3TQKA 3WLJA 1XKJA 4C6OA 1NDZA 3WDRA 3VX1A 3HG4A 2HLDG 2EPLX 4FEZA 3HQ1A 1CXHA 3W7QA 1ZALA 3PG8A 1WDDA 4OBTA 2HBXA 2OG9A 2VGGA 4Z1MG 3W7CA 1OFRA 2D23A 3EDKA 3L7RA 4ZL1A 4X9YA 3M07A 1IXNA 3BSGA 1UD3A 2CXGA 2C6QA 2P50A 1CBGA 3UQNA 1XFBA 4IMGA 1XDMA 1A3WA 4INFA 3DG7A 2WC7A 3ARSA 3EX2A 4L6OA 2GJRA 1YBQA 2QEZA 4JCMA 3EBVA 4DBEA 4IPNB 1EC9A 4RPPA 2QCHA 2VRKA 1H3GA 1UWUA 3RITA 4DO4A 1ESWA 4LS2A 4NQ1A 3VIHA 1VFMA 1XH0A 3E9AA 4AZGA 1H60A 3H2EA 5AN7A 1TVLA 1WO2A 2UY3A 3O6AA 1HKJA 4FHAA 3GS6A 3SN4A 4NZ4A 3C8FA 5H1WA 1ISZA 2Y8KA 3LGDA 2NW0A 3R25A 3GAYA 4LYKA 1HJSA 1DP0A 3ANUA 5FL1A 3CZJA 4MJMA 2ZA2A 1EDTA 4XTIA 3UR2A 1RVGA 2WNZA 1TV4A 1CB7B 4R9OA 1T41A 2ZA3A 3W83A 3QJAA 1QW9A 4AZIA 5BZAA 4V1YA 2PDJA 2WMIB 2A3AA 4WJEA 3VIPA 1XBXA 2H3DA 3RRXA 4L1WA 3OA3A 4H9UA 3P80A 1D8CA 3GZ3A 5A2BA 4PMQA 1VEMA 1NAL1 4R27A 1LORA 3ARQA 1WZLA 3HQNA 2JF7A 1FCBA 3SGZA 4UB9A 1X97A 4DYEA 4WVXA 2Z25A 1UUMA 3QV8A 4I9AA 3VNIA 3LU2A 1U5HA 3C2EA 3H22A 4QE4A 3N11A 2F38A 4K8EA 2L5HA 2PSNA 5DMNA 3T4CA 3W6LA 2ZZ3A 2XGZA 2YL9A 1CDGA 1CI1A 1UH3A 2JEPA 1QATA 4GI8A 2IUZA 4R7OA 3K8KA 1E4NA 4QEEA 5LGZA 1YKWA 5FSDC 1PTDA 2WPBA 3S5ZA 1UZ1A 4I90A 4NSBA 3TYBA 5JVLA 3BSMA 4YNGA 2UBPC 2J7GA 2J75A 4XKMA 3APTA 1K7XA 3EKLA 4XB3A 2BFGA 1OG6A 4U5KA 1XC4A 4IFOA 3D0CA 3LA4A 3KHJA 2HRWA 1NTHA 2E8ZA 4M81A 4PFHA 3OEHG 5EU9A 2WBGA 4IQJA 4UQCA 3NUKA 2AMGA 3FYPA 4UWMA 5GNZA 4NZFA 3KBNA 3GHUA 3NO3A 2E5BA 3KDOA 4TQTA 3LENA 3DCPA 1KFBA 1EC7A 1PIFA 4EK7A 1VB9A 3BJTA 1ZP4A 1A5NC 3LBOA 4FSAA 5LNUA 3W02A 1TTJA 2PDKA 4Z2JA 4ZTYA 3B8TA 3SCUA 1ZB5A 4O8RA 4YYCA 3BV4A 5B80A 3K2GA 4DYJA 4XVDA 2BHYA 2DY3A 3SO7A 1T7LA 3DIPA 1UWAA 4IG2A 4D1JA 4O18A 3T40A 4HZ6A 4B5WA 3CMGA 1DOSA 3B9EA 1TTQA 2EPNA 4FXRA 3VXGA 1FTXA 1AZ1A 1F07A 3S47A 3L5MA 2NLYA 1B3YA 1AZ2A 3LHVA 1L9WA 1G7UA 2BVDA 3WQGA 2DZAA 1BLIA 3LBCA 3LZ5A 1NOFA 4M82A 5FL0A 1O65A 4GNJA 2EG6A 3LN3A 4REQB 1FWBC 3CH9A 1TG7A 1TUFA 1JGIA 4HKPA 3WD4A 4C7FA 4WY0A 4A21A 3FV9A 1V7AA 1CLXA 4GE8A 1X96A 4QROA 5D37A 3KW3A 1DWFM 4DIAA 4O15A 1CXLA 6TAAA 5LGXA 3MO4A 3VGHA 5BXSA 1GVSA 4O14A 3W23A 3IUDA 3WL1A 2PDBA 3W76A 4HPNA 2FHFA 3PANA 4RDWA 2CK3G 5I3FA 3PNZA 3GBDA 2NX9A 1Y0EA 5CKSA 3ZMRA 2IXUA 3PSVA 4H6RA 3OZOA 2WBKA 4C60A 1AFSA 1R3QA 1ISWA 4PB3A 2R14A 1LL7A 2C79A 1WE5A 1EXPA 4NI3A 3T7VA 2QCEA 4IP7A 4DX3A 4JX4A 5HULA 3C2YA 1GUVA 3CYVA 4WHBA 4ZTXA 3XISA 3EDDA 3GAKA 2HMCA 3MUIA 4QAWA 4MB4A 1DEDA 3UZYA 5DN1A 3B8WA 4N4QA 3TV8A 4AFYA 5LYRA 3BG3A 1V6YA 3AROA 4NYUA 3O07A 2REQA 3TMLA 2NUYA 2Y7EA 1D3HA 4RV3A 3NSXA 1MUMA 3AUJA 3MZ2A 2TRSA 3G6MA 3VAVA 3AHYA 2YCLB 3EMZA 2QV5A 5EFDA 3EKGA 3E0FA 1V6TA 1WBJA 1ZNNA 4DJFD 3DYPA 1W5QA 4DZHA 3NZ1A 2NXGA 2D73A 4HIBA 4KS0A 1RR2A 4MPQA 3W6MA 2VC7A 1TWIA 3L0NA 1AQHA 1CLVA 3LQLA 3UNTA 3BOFA 2QCDA 1F61A 2RAGA 3MY9A 1EA9C 5K4XA 1MI3A 3CEUA 1JYXA 1B3WA 4C6MA 1N8IA 4UFJA 3R8RA 3WQ5A 4J3XA 3NO1A 2V2HA 1EJTC 4JTTA 1FUYA 3H7VA 3V7PA 1SFLA 2GGJA 1V02A 1XL9A 2EBNA 4HA0A 3MHFA 4XSLA 2I9EA 2J79A 1GHSA 1U83A 5A1AA 5HA7A 4C91A 2EHHA 1UOZA 1E3ZA 4G1KA 1SJBA 2YXOA 1VFHA 3G3DA 4PC8A 3EEGA 3GDMA 3GG8A 2W6RA 4EP8C 3RM9A 3VNKA 4AEEA 4DY1A 4ZO6A 5AZ0A 2E09A 4LBSA 1XSJA 4MKVA 4QQUA 1QAPA 4RDZA 3RDKA 3VIKA 2ZWYA 1PZ3A 4B2DA 3FY1A 1Q4NX 3I7RA 3MMUA 3MANA 1ORUA 1B5TA 4J4KA 1XKYA 1E4IA 1OY0A 3MUCA 1GQIA 5ABHA 4O0KA 3FXYA 2VC9A 1IWBA 1TR1A 3W84A 4AG0A 4S3CA 3SIMA 2GJXB 2NV1A 4IQDA 2A21A 4AWTA 2ACQA 4DAIA 2OYLA 4GJJA 1M41A 4X60A 4BY3A 3T8QA 2DVUA 5I3IA 1U33A 1W2VA 1M6JA 3LK6A 2YZ5A 5BU6A 4B5VA 4JYDA 3C61A 1Z6KA 1PEZA 1M1BA 3MMDA 3CS2A 1BVWA 5A94A 4AVFA 3LYEA 1CPUA 2O92A 2HVMA 1M03A 2FTPA 4AYSA 3AS1A 3LUTA 3PZNA 4Z2HA 1VP8A 1XPGA 3C6CA 5I2UA 1HKKA 1R46A 4WKAA 2V67A 1OX5A 1EX5A 3RCNA 3WD2A 2A7PA 5M03A 4M3PA 1IEVA 4LUJA 1XH1A 3AXHA 4LAZA 1HL2A 4CEUC 3AALA 5M5DA 3GR7A 1W17A 1XUUA 1K3UA 4PCSA 1F76A 5HNNA 1A47A 2GOKA 3WH5A 4WZHA 4AUBA 4CLMA 1OIMA 4H1ZA 4D72A 2W4XA 4HVXA 1ODZA 2DFAA 1MNZA 3QV6A 2F9HA 1JZ3A 4IP4A 2VKZG 3MC5A 1GK8A 1J6OA 3GWQA 1C93A 3BMVA 3UG4A 2PGFA 2FJUB 4CN6A 3BC9A 3KL0A 1TV8A 4PTXA 1QK0A 3T0DA 3UJSA 3IJDA 1LOQA 4NU7A 1HP5A 4TUFA 5I6SA 3DI1A 3FA3A 4IPPA 1ELSA 3C4UA 3T07A 2KAUC 3GNOA 1LLWA 4DF2A 3U48A 1RZMA 2HSAA 3BV7A 3GXDA 3PWGA 4A05A 3LRMA 1R9ZA 4GXPA 4ATLA 5ECUA 3ABOA 4ATDA 1A49A 2ZRZA 1RJPA 1NQKA 3Q45A 4CNPA 4UTMA 1Q6GA 3R0KA 4MDPA 5ABEA 2INEA 2E77A 3V4BA 4Y8FA 3EA3A 2YSWA 2VGIA 1I2RA 4PUEA 1LUCB 2YA1A 4S38A 2NVAA 3M6YA 2E3ZA 1KTCA 3CK5A 3ITYA 3U7VA 1WKEA 1XGDA 1JZ8A 3DHDA 1IGWA 3IK2A 4ICMA 3FHAA 1VHCA 4RKAA 1UMYA 3O3RA 1GPWA 4HT3A 1BXCA 3U4AA 3LCGA 2ACUA 5GJMA 4A35A 2G4FA 1U1UA 7PTDA 4MB5A 1E6SM 4U2YA 1NWSA 4JIIX 3L65A 1SM9A 2YCJA 3K13A 1MW3A 3GR4A 3PZOA 5B7YA 1W9PA 4C6IA 1NELA 2X1RA 3WLLA 4PB4A 3WH7A 1BHGA 1UD8A 4D6JA 3MBDA 1C7SA 1OFDA 4BZYA 3LERA 3PSWA 2ZC8A 1KXTA 4NNAA 3E6EA 3PTDA 1HT6A 1RBAA 2JJ2G 1OK6A 3IVUA 2TYSA 2QAPA 2X0YA 3E0IA 3NZGA 2CZVA 3ZQ9A 3P84A 1E1CB 3RM4A 3N29A 4PMOA 2OWXA 2CLLA 2I57A 3DFSA 4QTGA 3QY7A 1KTNA 1REQB 5F1VA 3SSJA 4H8UA 5ENLA 1H7XA 3ELFA 1DBTA 1AJ2A 3I7QA 4WSJA 1TX2A 3BDKA 3WLKX 3AHVA 2H9AB 3VIJA 4JTFA 3BJSA 3I6TA 1FCVA 3R58A 1DJHA 1S38A 3BXWA 4UQDA 4IIDA 2QDHA 4QLLA 3W1QA 2PF8A 2VUNA 4PBFA 3LCLA 4A2RA 3M0KA 3T08A 1CTNA 1M7JA 5F1UA 3F2BA 3WDIA 4TV5A 1TYGA 3R10A 5FJUA 2EO7A 2Y7FA 4IJRA 4U3AA 1J4EA 2PWEA 3PUGA 3BWWA 1IXOA 1V79A 2YFOA 4Q8PA 2NQZA 3HV8A 2ZUUA 2XH2A 1BSIA 4PMZA 4J3TA 1B4EA 1TZ9A 1YYAA 3TN4A 3BGGA 2Y63A 5CPQA 3P0WA 5FJPA 5K9DA 1EZ2A 2R9RA 2ODOA 3G1XA 1UR2A 5A6JA 3RCYA 2WW5A 5D05A 3CUJA 4OUEA 2GJPA 2OPJA 4DBDA 3ZXWA 1LDCA 3GNPA 3LXBA 1AQ0A 3WLIA 3OYZA 3PZGA 1VCFA 2GUYA 3GSMA 1XR2A 5HMDA 3JZUA 1UP3A 2ZZ4A 5G1MA 3W38A 4A8NA 3CPUA 3WLPA 4WJ8A 3TK7A 4Z0SA 1PHQA 1OGGA 4H83A 1EEPA 2V2CA 5MKGB 1K8CA 3C0LA 3BZGA 2YL8A 4TVCA 4FB7A 1SFSA 1WAWA 3G0XA 3AJXA 4OUIA 1VH7A 1SSDA 3DN5A 1XIEA 3GX9A 3S1GA 3T0AA 1HO4A 1PWLA 3W27A 1XLDA 3GIYA 3VZYA 3DHPA 5MF5A 3O0FA 4J9JA 5E5CA 3DDMA 1W3NA 3MHGA 3N2BA 3QVQA 2YYTA 2NWRA 3AFBA 1ZP3A 4J3UA 4FP1A 3AUOA 3QPEA 1E0WA 2RDWA 2ZOXA 3RX2A 2BVWA 4EOUA 1KD0A 4B15A 2GOUA 2R1NA 3CO4A 1JZ7A 2WZMA 2BXZA 5FEWA 1ISYA 4PUWA 3NOYA 5M3WA 4U3CA 2WMFA 4QX4A 2WKGA 1LOLA 3BLIA 3N9RA 5HNRA 1DHPA 2PWGA 3QYSA 2OJPA 4PMJA 1KFWA 4DNHA 1Q6QA 1E6XM 2BY2A 4NZJA 1F74A 3CHFA 1HKMA 4LBRA 4W7UA 2WK2A 4AIEA 1SJAA 3WQFA 5EB8A 2XIBA 4HNUA 1TQXA 1W32A 3CBWA 1OD8A 5IHRA 2XGBA 1XRFA 3H7UA 5C9RA 4X61A 3P74A 3KCLA 5KEZA 1VP5A 5JBEA 3S1VA 4YCOA 1K9FA 1WCGA 1YX1A 1JNEA 2WAGA 2VD8A 4AZ7A 3H4GA 3QF0A 4N0RA 3CHCA 3USBA 1NDWA 2QPSA 3L12A 3ATYA 1Q4WA 4BJHA 3QV9A 1AA1B 4FOJA 1SFTA 3TYUA 3CV2A 4YTQA 3P60A 4IF2A 4XAPA 1BF2A 4K37A 1EL3A 2JKAA 1YTKA 5CQ1A 1TV5A 1ITQA 2AQVA 1EHNA 1GVOA 5CLWA 4JTRA 4RUBA 4TTUA 5JH2A 2ZRXA 3TC7A 9XIMA 3VE9A 4DO6A 4KWWA 3W26A 4RLIA 2PDIA 4WGHA 2D24A 4H01A 2Y5EA 3N9KA 5T91A 3TNBA 4P7QA 4KKXA 1HJXA 2EG8A 4HNTA 2CKRA 4RE2A 1BRLB 5LNWA 1JPKA 4WDWA 6REQA 1DXIA 1L8PA 3M43A 4JICA 2A85A 1B9ZA 3WQEA 4PTVA 4AWEA 4DPPA 1ONXA 1XQLA 5C70A 4GY0A 4B4HA 4NAFB 5D9PA 1XRVA 3UXDA 1BWVA 3VM5A 3TZNA 3PAJA 3P2VA 4C6CA 4KH2A 4AYGA 3VGDA 3PBGA 3SCWA 2IPWA 5BCAA 3ALFA 3W3OA 4JIRA 4UCGA 1IR1A 2W63A 2WSSG 3RK8A 3TROA 2XNDG 4C6LA 4KEZA 4IIFA 2NSXA 3GG7A 3TN3A 3C52A 2YCEA 1FDJA 4QBXA 1PZ0A 2V3FA 1JYWA 4IX2A 4DUVA 4CQBA 3L9CA 3O6YX 3A13A 3WH8A 1ADDA 3NURA 1H1ZA 3L4YA 2J8GA 1OYCA 3LM3A 4XZBA 2F9RA 1SO5A 1JG9A 4NZ5A 1WXYA 3W7HA 3EOOA 3G22A 3BTNA 4A3QA 2JIWA 2ISVA 3CLWA 1DPMA 4FNSA 3TSBA 2EPOA 4L4LA 2EXOA 3W2JA 5HBFA 1GQLA 1GKQA 1KFLA 4D71A 1FWDC 5JUVA 2B81A 1QPNA 4AW7A 1XC6A 1EA0A 2W92A 3PPFA 3ZO9A 1E5NA 2ZICA 1P48A 3IJ6A 2QE7G 1FFRA 2QYGA 3SECA 2ZADA 2F7FA 4HPGA 3F2DA 4E38A 2VM8A 1BAGA 1I75A 4G2DA 3FSUA 1TWDA 3IWPA 5EMJA 1VJIA 2IW0A 1Z7AA 2QUVA 3UWUA 4AHOA 1FCQA 3B0VC 3DEQA 1AW5A 1PYMA 2ABAA 5CJNA 1SR9A 3M0IA 4NHVA 1VYPX 4JN6A 4C1NA 1MFVA 2FZ9A 4ERIA 3AMCA 1FHUA 4LT9A 5CSUA 4V27A 1E9YB 4FLSA 2OKTA 4ZFMA 5HINA 4AEOA 4GYPA 2WMGA 1DTUA 3H6OA 1RY0A 1OFPA 3PZTA 3RILA 4GPNA 3A23A 4R34A 5BOEA 4Z2GA 4ZEPA 4CCDA 5LA0A 3AIVA 3OVQA 2Q8LA 1J2WA 4Y9MA 1SQ7A 1UUOA 4IMFA 3WK0A 2QUNA 4B5SA 1MQRA 2BY3A 3AZRA 3GFXA 4Q8WA 5E93A 1W3HA 2D3NA 3AIQA 3ZSSA 4LVFA 4N9CA 5BRBA 3XINA 1CGYA 4D8LA 4WY0B 4DLFA 4GIRA 2JALA 1IEQA 4WXZA 1FY6A 4R7WA 3UU0A 4MB1A 4PUKA 3Q4DA 3C2FA 2WJEA 4L9ZA 3W7IA 4B3LA 3CPRA 4NX0A 3LHWA 2J4GA 4UQBA 2VRJA 3URQA 3PZVA 3B04A 4DEFA 3WY1A 1FOBA 4GJIA 1OHLA 1A5AA 1W8GA 1ICSA 3KP1A 1WZMA 2AAAA 2D2OA 3HQPA 3SFWA 3WBWA 2J74A 1CCWB 3BQ6A 1M7PA 1PL9A 4IMEA 4JN7A 2XDFA 4YVVA 2GVLA 3LTYA 1DWJM 1B3VA 1K77A 5I78A 5LZLA 5KMYA 4UTKA 2CLOA 3TWAA 4D6HA 3MSRA 4ASUG 3G18A 2POTA 4Q4MA 1QHPA 2WWCA 1Q7QA 3LGGA 1TPWA 3URAA 5GQBA 1S2UA 4LEFA 3CIWA 4FZIA 3BG9A 3HO8A 3L2MA 4ATWA 3CL6A 2V68A 4FX7A 2J27A 2REQB 2ZX8A 3VOIA 1ADSA 1JUKA 1WKYA 2XIIA 3W72A 4YVXA 3N34A 3QM3A 4Q4QA 3TR9A 3PJTA 1LROA 5AC4A 2IPGA 4MAZA 2FPVA 4IT1A 2PE4A 4ZFCA 2YBUA 4A8LA 3R89A 2JEQA 1RD5A 2Q8ZA 4EAYA 4XO7A 3N4EA 2H90A 3CTLA 4G1NA 4W9TA 4TVDA 3O1NA 4NUWA 2DIEA 5FKYA 1EGVA 4PRTA 1KTBA 4NASA 5J04A 3JU2A 1GZ1A 3CZKA 2R24A 3SEPA 3VIMA 2PC4A 1JAEA 2V5JA 3O15A 3KBJA 1TMHA 3OYXA 4MLJA 2TAAA 5HWNA 3ZM8A 2FVKA 2PDFA 5HNTA 2BDQA 3W74A 2WCGA 4GQ0A 2E9BA 1P6CA 3F4DA 3QHMA 4DPQA 5C9ZA 1O5KA 3HPXA 3V16A 3LSBA 5FCZA 5G2HA 2QMKA 4GIYA 5AYYA 2G41A 2YOCA 2RGLA 1C8XA 4JFUA 4PMDA 1F4AA 3WELA 1YMYA 1HVQA 3ZT7A 1T5AA 3VTRA 4W7VA 4DF1A 4D2JA 1PDYA 5EY5A 1EB3A 3FW6A 3SUVA 2EJ1A 4S3FA 4OJYA 3TR2A 4E8GA 3A4XA 2HJPA 4DAFA 1QU4A 7REQB 4B92A 1FWRA 3WQDA 1AL8A 5BOFA 2J78A 2QKFA 4DZAA 1HVXA 4Q8OA 5GPRA 2HPIA 1A0CA 1KM1A 4NXKA 4NP7A 1FHDA 3SRDA 3VD9A 5DMYA 3T0BA 1ZQ5A 3OLIA 4GJ1A 4HTBA 1B57A 4EXQA 3MUAA 2PDMA 1YNYA 2QPUA 3SQMA 3ZR4A 3M0YA 4OOZA 3EDEA 1A53A 1XXXA 4HMCA 3L66A 4NNCA 2JF6A 2PLKA 1VFFA 1RBOB 3QLLA 4OTKA 3NTYA 3QPZA 4M6VA 5I7GA 5EMUA 3R8HA 1JZ4A 4E8CA 3WMSA 5HQMA 5K4ZA 2D20A 2BVTA 1X39A 4H6KA 4JTDA 5CSSA 3T55A 3ZR5A 3VFCA 4I7UA 1W1YA 3ITLA 4J35A 2FGZA 4C90A 4Z0JA 4E4PA 3P14A 2WM1A 4UTUA 1BGGA 3QH2A 4KIEA 4GZEA 1S2VA 3NZPA 4AD1A 1H5YA 3HPSA 3B3DA 2GQ3A 2YCIX 1G4PA 2PU1A 3W71A 4MFDA 4DM2A 3QRHA 1Y5VA 1FDZA 5C71A 3BW3A 4ZOCA 4WGXA 5A8NA 4F2UA 2XVLA 3PBVA 4PA8A 2YDSA 1P0KA 4Q4SA 4S3EA 1XDJA 4E2DA 1ZHAA 3PHAA 4DN1A 4LCQA 3AISA 1JCMP 2Z1BA 3NQ8A 2A3EA 4DJED 4LVGA 3B0YA 3VKBA 1W1IE 4OBSA 1NVMA 2NVDA 2HE5A 4WXYA 4D6IA 1UKTA 2IQTA 1XBZA 2YLLA 3KM8A 2G5WA 3M5YA 1GNXA 3HGJA 4AHPA 1ITXA 2C0AA 1JUBA 3VOFA 1P7TA 3IIVA 3IK4A 4O53A 5TNVA 4DNMA 1K8YA 3MJYA 1LM1A 1PKLA 4HZ7A 4H9TA 2PBGA 1V7YA 3SBFA 4LC8A 1KXHA 1TV2A 1XLGA 3W07A 4GBUA 3GHSA 4G7FA 3ABQA 2J9ZA 3SUWA 4LW7A 3U3HA 3WK3A 5I09A 3URNA 2Y0FA 2VOTA 3TJXA 1A5BA 2WJZA 2D0FA 3ZJ8A 4E0CA 3CT2A 2O56A 1LG1A 1G4TA 1WDRA 3NFUA 2BOEX 1ALDA 4Y90A 3VVGA 4DJDA 2DPEA 2ANUA 2HCVA 3VKAA 2Y6ZA 3LS9A 3AXIA 5CGQA 3RPMA 4G5DA 3VE7A 4C6KA 3ARXA 5DY2A 3ZWSA 1DJNA 4DJDC 5A95A 1HKWA 4GHRA 3UVIA 2DJXA 1FWWA 3L4WA 1TB3A 3CHEA 3HBLA 2YBTA 3EWUA 2NXHA 5JBFA 4XAYA 3VKKA 4IIGA 4FALA 2JDIG 1A5MC 3IIPA 3TWBA 2PS2A 1X1OA 4FS9A 4Y8EA 2J8TA 4JTIA 4ZE5A 2OEMA 2G4JA 5EFFA 4EPKA 5C9UA 2X1TA 3ZR6A 3KZSA 1JCXA 4IQLA 3W1NA 5D2TA 1MXGA 3PJWA 1SMAA 3WDJA 4NJGA 1OX6A 1K9EA 3P8JA 1SU5A 3WEZA 4XAGA 4PTWA 3NIYA 4JYEA 1EKOA 4H04A 2WNQA 2ATSA 1Z42A 2W6JG 4O8AA 3EWZA 5I3DA 4G8TA 1W0JG 2OLHA 3FEMA 4FAMA 3TJ4A 1WDQA 1LF1A 1FBAA 3WQ4A 3VMPA 3TSMA 5A8OA 4GQRA 3F1QA 1OJXA 1T8XA 2PDHA 3XIMA 5CJ5A 3RFAA 1Q6RA 1MUCA 4NRSA 3M0HA 4IZGA 1YDNA 3M64A 4PFMA 1VYRA 4Q4KA 2A5HA 2VEIA 4L64A 4LYPA 3AYRA 2YR1A 2C18A 4IMAA 2V5BA 3SZ8A 5G1TA 4G7EA 4IP5A 4UR7A 5CBBA 4QGCA 1OADA 3WF0A 3GTNA 1KCXA 1GVQA 6ALDA 2H8ZA 2P8BA 1JNDA 3DZ1A 5LHEA 1US0A 3SY5A 1KLZA 4IFRA 3E0LA 7CGTA 3CAVA 2IKHA 2V69A 2PBOA 4B5TA 2AAMA 4K8GA 5DX7A 1TPEA 1H7PA 4JHOA 3BAKA 3QEZA 2WVSA 4G6CA 4LYRA 2X1IA 2RHGA 4AEFA 4GH1A 3GBEA 2V9DA 2XSXA 3CQHA 2ISDA 3C2RA 1I1XA 2QDDA 1FWJC 4L9YA 3OVPA 2PDNA 3SIZA 2YA0A 2ZWZA 1XLMA 3H12A 3G8RA 3MT1A 4GYFA 4A3YA 1TREA 2EPHA 1LL6A 1OBAA 3LD5A 4ZSTA 4KW2A 4RNJA 5H2ZA 4GMEA 3ATZA 2C3ZA 2NQHA 2OODA 3PPCA 3JR2A 1FP9A 3KBWA 3O06A 2FTYA 5BROA 3LMYA 1AW1A 1XYMA 3HM7A 4AHQA 1OK4A 1LWIA 4WIWA 1FWGC 2PPGA 4MY9A 4JNMA 5CPOA 3QGKC 1JDEA 5CPSA 5EGRA 5EMLA 2PURA 1D9EA 2C1IA 4MNJA 1VBUA 1FH9A 4DBWA 2IKGA 1FXPA 1GQKA 5C7VA 3CIVA 5DRCA 1XRSA 4L56A 1R3YA 3REQA 4DM1A 3SJNA 5H8MA 3WUEA 1TSIA 5I3GA 1R6WA 3O9NA 4CNOA 1JEZA 5AVHA 3EX1A 4HPHA 3W9ZA 2VFIA 4ORMA 3WF4A 1FH8A 1PVNA 3A24A 4JFTA 3WNOA 3B9DA 1P5BA 2OQHA 4WOZA 1GVFA 4PMNA 1G1YA 4IIEA 1AG1O 1LWJA 3SY8A 3WD0A 1GOXA 3S2CA 2XIMA 4UNLA 3WYZA 3V18A 1P1XA 4QJ1A 1DE5A 2PU0A 4D6EA 5T26A 1VEOA 2F2KA 3UXIA 2VR5A 2Z1WA 1JD9A 3NL2A 1JRBA 2HISA 2HROA 3GFZA 1B3XA 3W2MA 4QJ3B 1W9DM 3W2LA 3QHOA 4KFPA 4O52A 4JCLA 3DERA 1BGAA 3GU1A 3G6LA 2FZBA 3WLRA 4LXFA 1EXBA 3LV6A 4FPSA 1AMYA 2V3DA 1J0JA 1NF0A 3SGGA 3CB8A 1E9IA 1KKOA 4EWND 2Z6JA 2V2DA 1QOPA 4PCNA 1R3SA 4US6A 4NJKA 1V08A 2JKEA 1LZOA 4KRTA 1M7XA 3B0PA 2AGTA 3QC3A 4KERA 2DZPA 3RO8A 4I7WA 1EF2A 3UA3A 3TYEA 1T96A 3M0JA 4R9XA 5CC3A 1HL8A 2V7QG 2VDIA 4ICCX 4J5NA 1V77A 5AHMA 1GGOA 5CJMA 5CG7A 5AHEA 4C6BA 2Q01A 4BK9A 4YJ5A 3W7PA 4ROPA 3NXLA 2J13A 3MA8A 1KM3A 3N2CA 3VO0A 4B5XA 2UY4A 3KHDA 3V75A 3MSGA 3AOFA 3D5HA 3P0XA 3EZ4A 3A12A 4MZ8A 2DVXA 2XOKG 1MW1A 1LRNA 3CPGA 4OQVA 4N9DA 2OKOA 3S5OA 1BTCA 3LCXA 1NWRA 1ZZMA 5XIAA 2PDCA 1P0NA 1ZAHA 3O6CA 1HJQA 2QF8A 2WM0A 2JGQA 1N7KA 2GZXA 3VC5A 4JNYA 3E49A 4M19A 4MB3A 1W5NA 1DJWA 3W29A 3GW0A 2QCGA 4IFKB 5G4EA 3CEPA 1R8LA 2QHAA 3SW6A 4UMCA 1JL8A 1CGVA 3FCPA 3KRUA 4R85A 4XWUA 4ZR8A 4US5A 2BP1A 2RKXA 3GC2A 3UYCA 2J47A 1KRCC 1JDCA 2BMBA 1FRBA 5HQEA 4ACZB 1UKQA 1OCBA 3MYOA 3EX4A 2PD5A 4AC7C 2A4AA 5H91A 3H55A 4JTLA 4LEQA 4CNNA 4U2ZA 1OX4A 3SN1A 3VILA 3RLVA 2CLKA 5DF0A 4YTSA 4XAFA 2VCAA 2W61A 1XCFA 3ARZA 3TTSA 3PFRA 4GG9A 3W1XA 4B3ZA 4UNKA 3U2ZA 2P10A 4PL1A 4AZHA 2I5IA 2WOQA 3UJ2A 3AIUA 2OT0A 1E4MM 2X42A 2YDQA 1R3VA 3DESA 1MQQA 3PPHA 1F6YA 2O0TA 4JS3A 1CWYA 4GFSA 1M7OA 2ZZ5A 3EWYA 1WP6A 1X1NA 1QNOA 3SCVA 2OXNA 3L0GA 4RNIA 2WJFA 2XYLA 1L6WA 1PIIA 2CESA 1TJPA 2HZGA 3HPZA 4EKJA 4W8BA 3IJQA 4GVHA 1WOBA 4M24A 2VC5A 4I9MA 3VD7A 4Q7NA 1XW8A 2Z26A 4ML4A 4CCEA 1EYEA 4BFAA 4ZQCA 1BG4A 2G50A 4ECLA 1Q65A 2FTWA 1W3JA 2XH0A 3M7WA 5C9XA 1ADOA 4WQ6A 2CLPA 3E96A 1LQ0A 2FGBA 4F9JA 2XINA 2P8CA 3GYEA 4TV6A 4JKLA 4URIA 1VJSA 1MNSA 1JPDX 1GJWA 3KVLA 2DW6A 4G9PA 2HK0A 1P0EA 1I2PA 2XVKA 1W1B1 3L0KA 3OZYA 1NH6A 1IT0A 3EXTA 4JHMA 1XYAA 2VT0A 3CB3A 4LUTA 4O54A 3SCRA 4ADUA 1B54A 1WXJA 5D8WA 3UETA 1VFUA 3R5EA 4NZ1A 4WF7A 4Y96A 1GZGA 4QLJA 2DEPA 2A6LA 1NJJA 2ZFAA 4Q6XA 3CQ0A 2YL6A 1EHAA 1F4HA 4YWSA 3VIFA 5M2FX 1XIHA 5BYWA 3OQEA 4H4IA 1OM0A 1CNVA 4WD0A 3DHUA 3J7HA 3TQ0A 3GW3A 2GVGA 2BSLA 5A6KA 4QG8A 2VEMA 4JQ3A 3DGRA 5BU9A 1JDAA 1XYCA 4IH3A 1XHGA 3RX4A 2CIPA 5E0FA 1GJPA 2WCAA 3NGFA 5JH1A 1TIMA 1YEYA 2R6OA 1Q45A 5CZ0A 2C15A 5D2VA 1GCYA 1S39A 3GKAA 3AIWA 3TC3A 4CEXC 8XIMA 3KBVA 3H21A 3NYZA 4DWSC 1HZYA 3KOWA 4FLOA 2QJHA 3ANYA 4KWSA 1CEOA 2DUAA 3E12A 1RCXB 4O1DA 4FX6M 1OINA 5AOUA 3S5YA 4AF0A 4DYKA 3UYIA 3TA9A 3GVQA 4KEVA 4X0NA 2DUZA 2Y1HA 6TIMA 2ZUMA 1CENA 4RZ5A 3H24A 5G4WA 4DUXA 3WLQA 1LOSA 1E6RA 3B8DA 1EPXA 2VVSA 3PWAA 3HN3A 5K3VA 3BAJA 1O5QA 4JTEA 3LI0A 4Z1DA 2C8NA 2HS6A 4RE4A 1JCJA 3DU0A 4L80A 3TLQA 1DKWA 1EUAA 2XZ7A 4Z1YA 2O9OA 1TRIA 1UWRA 3AHXA 1IIHA 2XUCA 2VI0A 1BYDA 2DP3A 2J24A 2WQPA 1WKDA 2BLEA 5M1TA 5D38A 5J5RA 2OGYA 4ILSA 2BOGX 4XIAA 2ICSA 3B8IA 3SJ3A 5G2IA 1E73M 1DTNA 3KTXA 1XJBA 4HK6A 5IHSA 1R7OA 1XV8A 2DSKA 3EB2A 1FKWA 2ZA1A 4C5ZA 3UZXA 4PCFA 4JPGA 3WJWA 4F0MA 2Y7DA 1HP4A 3GIQA 3ABRA 2A3CA 1O66A 1GOWA 2CWNA 2CZDA 4W89A 2WZHA 2B7PA 3L21A 4A8RA 2VZTA 1A5SA 2Z2UA 1LQAA 3C86A 2O9TA 2P3ZA 1V8EA 1JCYA 1Q8AA 1K7FA 5BMWA 2YYUA 1GJUA 4M80A 1JFHA 2UWFA 4F79A 3SUTA 1T99A 3W1PA 2Z1SA 1TPVA 4O4VA 4HA4A 3WLOA 4L6HA 1KM0A 3CHDA 4XZ9A 4QJ4B 5F7UA 2P0OA 2AGKA 1EJ7L 4L4MA 1GEQA 2WSKA 2CETA 4C1KA 3GFYA 1R9XA 3GRIA 4QCFA 2PDQA 3IARA 3CC1A 1AMKA 4C7DA 5A6BD 4N6EA 4O11A 3SAZA 3TYZA 2TODA 1JRCA 1ICQA 4GISA 3A9BA 1YQ2A 3OLGA 1XP3A 2GQ8A 3AXXA 2NWSA 1OCNA 2ACSA 3HFTA 2Z6IA 4UOZA 1GOMA 1UZDA 2J7HA 2ZXDA 2WVVB 3CV6A 4HSHA 4TXEA 1K03A 3EX6A 1EOKA 4C6FA 3ZLFA 4KBXA 2DGAA 2XFYA 4K1GA 4IUOA 1ZJAA 2QAFA 3DG3A 5AB3A 4YPJA 2OWWA 3TC6A 1JZ6A 3WEOA 2VTFA 4JTKA 4J2MA 5MHBA 3TJLA 4EXBA 2VCBA 4AU0A 2PI6A 2FMOA 2V5LA 5K2ZA 3B9NA 4CD5A 2V5KA 5K9CA 3GVWA 1KR0A 2QXWA 2XH7A 4NKCA 3VDGA 1OF8A 1OYAA 1A5UA 3QXBA 2GYIA 3KLLA 2A7RA 3YPIA 1AJ0A 3N15A 1U1HA 4PRRA 4I5XA 4WUIA 3A4AA 1D7FA 1JI1A 3KL5A 4TX9A 4MVAA 4AZCA 4D8AA 3K4DA 1DORA 3RNDA 1W54A 4H6QA 3N18A 2ZXBA 1I1WA 3OZMA 3JUGA 4MGGA 5HMSA 3MUY1 2ESCA 2OGJA 2E25A 1DWAM 1UWIA 2VUYA 4UFMA 3AXKA 2Z1XA 4QITA 7TIMA 1XGZA 3DUGA 2X09A 1W3IA 2XM1A 2A0NA 1PB0A 4W88A 3AI0A 2VVNA 3Q67A 3KRBA 3LCFA 4YWIA 3OODA 2JE8A 1KQYA 3M0LA 3BJFA 2FVLA 3NSNA 4CQDA 3A4JA 5AZ1A 1UMLA 5XINA 3SRKA 2PTZA 4R88A 1RPKA 3SCNA 4MUPA 2D2HA 3VDCA 3PTKA 1H62A 1I0DA 1S1RA 2QF7A 2VGFA 2WC3A 5BXTA 4O0QA 2XFWA 3TN6A 2CBIA 1TJRA 4ZSUA 1GVRA 1R85A 2WHJA 3OEXA 1L6SA 3DKLA 4H00A 5HPOA 4F8XA 5EA9A 4ASTA 2FPTA 3BLKA 3UZWA 3TCSA 4F66A 4UZUA 4X3ZA 2Y88A 3C56A 1POKA 5KZ6A 2QNEA 2FZNA 3GLCA 1KRAC 3EB4A 1HFBA 3R11A 1C90A 3ZIAG 1CECA 1S5NA 2E6FA 3EWDA 2QGHA 4P7OA 3EPNA 4O16A 1VBGA 1E15A 1DYSA 4BQ5A 1K4HA 3M16A 3QBUA 3EWCA 4ZODA 2Q6ZA 3DFTA 5K7JA 3VKDA 3BOXA 2BXVA 1QFEA 4XKYB 4DF0A 1YXCA 2X1SA 1N8FA 5FESA 1UCWA 4JQAA 2NV2A 3PPGA 4CKQA 3CH0A 1W1ZA 1EO7A 1QASA 3GTIA 3OGRA 1S3HA 4BR1A 3DFHA 3AIRA 2W79A 3QLDA 3C0JA 1MDLA 3HJZA 1WYIA 5REQA 2KZHA 1P6BA 3SB0A 2DZTA 2IS7A 2VX6A 4GIEA 1EF3A 2G3JA 1TJ1A 3L23A 2CLMA 3TAOA 4K7VA 3UWVA 3NDYA 2OYKA 3IV3A 4P8UA 3TW7A 5AYXA 1ONWA 2F8QA 4OKDA 3OA5A 5A6LA 4JAWA 3VCNA 4O10A 1Y65A 3BLLA 1W9VA 4H8NA 1G67A 2IKJA 5A8GA 1PCWA 3ARWA 2H6RA 5ABFA 3PJXA 3ARVA 3M4HA 3ZVHA 1V6VA 1CB2A 3SUSA 1XI3A 4OBRA 3Q94A 3KOYA 1XLBA 3RYSA 3S1UA 1H1YA 1AODA 2FJKA 3RU6A 3ABSA 2CW6A 4YMZA 4C6NA 3K5XA 4EACA 5GNXA 3TNOA 1W3LA 4Q3MA 4S2CA 3MV01 1H7OA 1XIMA 4BEUA 2V30A 1RLDA 3MJMA 3RAOA 3QW4B 3F03K 3OE7G 4K36A 5C8BB 4XBKA 4MY8A 1TV7A 4XAZA 4A3RA 1R2SA 3LEPA 5D2WA 1HXJA 2V8ZA 1MRQA 4EPEC 2DDXA 3RR4A 4ZE4A 5JQ9A 2I5QA 4P2VA 2OSWA 4AX6A 1M9HA 4EWJA 3QPYA 4HSNA 1MSSA 3S46A 2A3BA 4Z1BA 5DBUA 1PKYA 3K1GA 1IXQA 3K4WA 5AC5A 3VNDA 1U1JA 2ACRA 2PDXA 2DU2A 3UWEA 3GB6A 1E55A 2DORA 1W6TA 3REQB 4PB5A 4ZBCA 4C6PA 1K7EA 1PX4A 1TPC1 3TTEA 5IOBA 4Q4RA 2WZIA 4IQEA 4XVEA 4CCZA 3OGSA 3R12A 2FB2A 1VAHA 1OZQA 3WIJA 2B31A 2ZX7A 4YXWG 4M7SA 4CQ9A 3AU2A 3K46A 2GK1A 4FNRA 4MF4A 4TR9A 5DO8A 3WH9A 4HOWA 3SCQA 3VX0A 3T78A 2DV0A 5C2XA 1C92A 1H0IA 3ARTA 1TJ0A 1GOIA 1MW2A 3A6OA 4DWSD 3VNLA 4XV0A 1O6IA 1WBHA 2AQOA 4PODA 5HAOA 5GJPA 4M8UA 3HURA 2VEKA 2INFA 1W3KA 4B91A 1TRDA 4W93A 4AY8A 4D1IA 2QJIA 3UZJA 3BGAA 3NQGA 5FAGA 2JJ1G 3WF1A 3D47A 1QVBA 1RP8A 4O1BA 4F48A 4X22A 1GHRA 3OHMB 5A8QA 1YE6A 3O8AA 3WJZA 1ZY9A 4WCJA 4F9DA 2TPSA 2VQUA 3BGJA 4XZMX 4GK8A 1LBMA 4HNOA 5I24A 1LL4A 3WLMA 4MPKA 4XZWA 1H7WA 1TMLA 1S2AA 3H4WA 3AU6A 1PSCA 4OU1A 3GC4A 3AICA 4LAOA 1RP9A 4EF9A 3VGBA 4DQWA 3VOJA 3DECA 2XWDA 2DT3A 2ZDSA 2BY1A 1IZCA 5CPLA 3ZOAA 3EDJA 4JTAA 5FEZA 3NOEA 1X7IA 4HN4A 3UWQA 5JXQA 3W7LA 2J7EA 5HANA 3E1F1 4J3SA 3OHIA 1EBHA 2PCEA 1GVEA 1GWJA 1TWSA 4GC3A 3W7DA 3LPGA 1V0NA 4A6GA 2E8YA 1JULA 4JNZA 4P8VA 3PK7A 2V0TA 5I06A 3KWSA 5DT5A 1XYBA 4Y7EA 1TZZA 2CHOA 2ZUWA 1HKVA 1TE1A 1DQXA 5HR6A 4I6VA 4DWDA 3N14A 4DVOA 5I03A 1IEXA 4P8WA 3DH7A 4H8VA 1WZAA 1E5JA 1IE7C 3HA1A 4K6AA 4L4PA 1A5OC 4F2BA 1L2UA 1NARA 2VCCA 2WMIA 4NG3A 3H2NA 2HVOA 3PF3A 5HMEA 3TOPA 4AC1X 4DXVA 1GPFA 4ZMGA 4DHGA 4I9JA 2HVNA 1A3HA 1QNRA 1EJUC 1IZJA 4TMBA 3HPAA 5C55A 4ZOAA 5DBTA 4F0LA 3TONA 3PY2A 3NPVA 4J1OA 3G1SA 2Q3OA 3QR1A 4HNCA 3NO5A 4GUHA 1DV7A 1W1PA 1V6WA 4FX8A 3BPWA 4WRHA 3ME3A 1H09A 4UQ9A 5CC5A 2F61A 1TA3B 2VFHA 2X0SA 2ZBTA 3PTMA 1UZHA 1TPFA 4RJEA 3TEVA 3GG0A 2CLEA 2JGYA 1E43A 5CZTA 4HPXA 4RDYA 3MCMA 1M65A 1H11A 2QVHA 4A3HA 4PMYA 3DFPA 4HA3A 4N6FA 4BF5A 3T09A 1UP0A 4WSHA 4LY4A 1EPVA 1DXEA 2PDLA 5EYWA 1KXVA 1DJQA 3D3FA 1QBBA 2E6DA 4E4FA 5KINA 2Y4SA 5EMKA 1UKOA 5AYBA 4J3ZA 3R7MA 1WXZA 4HNVA 1J0ZA 2QV4A 3DYOA 3MYPA 1YPFA 2DQWA 3RX3A 1YXDA 5D9OA 3T1GA 3RPTA 4Q7IA 2MUCA 3N6QA 3UPBA 3N2MA 3TYCA 1V0KA 4RW3A 3N6JA 2UZ9A 3W28A 4HOXA 4Q8TA 1HJUA 4ZCWA 4NYYA 3OO2A 4QSHA 1QI4A 3FJNA 1F3EA 4OV9A 4GVFA 3A3HA 3U5UA 3W75A 3IIZA 1U5VA 1IIGA 3A5VA 1DQWA 3DFNA 2X16A 3C2VA 1K6AA 2WKLA 1XPYA 3RIKA 3TAKA 6ENLA 4RE3A 4JTHA 3VMNA 1D8WA 5FJRA 4O1CA 4DUWA 4ES4A 2XVGA 2R94A 4S3KA 1DJYA 4LU0A 3M46A 2PDYA 3W24A 1MYRA 4MZYA 1M68A 3PBUA 4AWUA 2XTKA 3UD6A 3P8IA 4REQA 4BI7A 4RZ6A 5C7HA 5AKQA 3ABXA 3H54A 1HF6A 3SRHA 2QIIA 5AYZA 2CLFA 3AWOA 1NU5A 4M56A 4CUCA 5IDIA 3MB9A 3N19B 1EWEA 6XIMA 4GINA 4NZ3A 2ZXQA 4H9XA 5L9FA 4PUUA 2HDJA 2RDUA 4MUZA 1W31A 1KRMA 3LDVA 4EPBC 4N9BA 3WCZA 1XIFA 3LCIA 5A2AA 4XBSA 1WA3A 3I3DA 2RGMA 3H2AA 3C3NA 2P76A 4QDWA 4XZIA 4ZXLA 4AY1A 3E02A 4ZO8A 3HIJA 3ERPA 1SZFA 3SCOA 3GNRA 1TE6A 3FLUA 2ON3A 2O7QA 1NFPA 1WOAA 3EPMA 4U4MA 3E5BA 3BCFA 1JDFA 3CZGA 2ADAA 1DHKA 3AZSA 4DWSB 1MQPA 4AIOA 4JYFA 1XLLA 3NPUA 1UQZA 2QUMA 3FGCB 1VBHA 2ATMA 4KRZA 2VEFA 4MWAE 4MWAD 3BLEA 3O0KA 1S5TA 4KF1A 3DAQA 4PEEA 1Z89A 3VYLA 2EPMX 2W91A 3SRFA 1K8ZA 1W9UA 2BV9A 4C1LA 4YTTA 4LC6A 4AQLA 4HB7A 1YPIA 1JCLA 1Y8BA 2E0PA 1QPKA 4HYVA 3CUHA 5A2CA 1JYVA 4D6CA 3P67A 3NR0A 1H0GA 3S2MA 1MVYA 3GHRA 1RCQA 2O55A 4JXCA 1XG4A 2WO5A 3WNMA 1ML1A 1TZ7A 5DMLA 1W3TA 3LTSA 3STPA 3OTRA 1CGXA 2R91A 5HOSA 4S3AA 3FVMA 3LXCA 4KWVA 2J7CA 1FA2A 3U7BA 3CWHA 5E70A 4GZ7A 3BK0A 3IJ8A 3RRAA 2YCLA 3LGEA 2Q3RA 3VMOA 1Z69A 2PWHA 1EZWA 1F6PA 3IAPA 4GLEA 4HA1A 1H5VA 3W1TA 2D1ZA 3H7RA 1JUEA 1NDVA 3OGVA 3PNUA 1C7TA 2PODA 1V3KA 4Q8UA 1UD2A 4KCTA 4JDBA 4JTUA 1DJXA 3WMBA 1HX0A 3GDLA 4JTQA 2O4QA 1UWQA 1E72M 1VRXA 4FOKA 3SN0A 1J0KA 1QI3A 3AQUA 2P1FA 4MY1A 1VFOA 1O5XA 1F8MA 2NLIA 3W53A 3S1XA 1VIZA 1Z41A 4GI6A 4RX0A 3GD6A 1BYCA 5F2GA 2X2YA 1D2KA 4H9VA 1PWMA 1FVPA 1A0EA 1OF6A 2QCFA 4LCSA 4H41A 3I65A 4AD4A 4AD5A 4KCUA 1K9DA 3SY1A 3UP8A 4N9EA 4X0VA 1GW9A 2QJJA 5G4HC 1IZKA 1SW7A 1EUNA 4JIEA 1P1MA 5C2GA 2NQJA 3ITXA 2Y62A 1E71M 1CGUA 3TDFA 2OEKA 4C65A 2ALRA 4GQGA 2GWNA 4KMQA 3GHTA 2VMFA 4HZMA 4ZB5A 1PTAA 3PG9A 1SGJA 4NI8A 3T0TA 1YTEA 2O9RA 2W66A 2XFRA 4HPJA 2W5FA 1TCDA 3MUXA 2E6AA 3WEMA 2PGEA 2GJXA 2YCKX 1LP6A 1CX9A 1XS2A 3NXFA 1MWOA 4JY9A 4AZBA 3QKZA 4U5IA 5HMFA 4EF8A 4GRSA 4WLCA 3GDRA 2DIJA 3WSUA 2OWCA 5CBIA 4S3GA 3AYTA 4L5ZA 2E5CA 4RL3A 1O95A 1Z8AA 3W85A 3WBAA 1S2WA 4IJBA 2E28A 1O4UA 3W81A 2CFFA 5I3JA 1XLIA 2PFHA 1UJPA 3NQ2A 4L6DA 3PZIA 4LNCA 1R5YA 3WNKA 4O1FA 2GQAA 1G7VA 2C14A 2TMDA 4M1RA 3W7NA 3UGVA 3JS3A 1R38A 1HN1A 3WBYA 1XICA 5H6HA 3QZEA 1F5ZA 1WDWA 2VEGA 3GE7A 2ZUTA 3ONCA 4S1FA 3OB8A 4BQ3A 2PWDA 2QPXA 4HYRA 4WX2A 4ZQOA 3ZYZA 3AMKA 4GUJA 4QS5A 4DZIA 4YL2A 3A22A 2GQ9A 2A6NA 4B16A 1UR9A 3SURA 5A8MA 3LLFA 3IGXA 5G5IA 3B0UX 3QZ6A 1GOKA 4I7VA 4RZBA 4Y9NA 3S3GA 1UD4A 5AY7A 3NDOA 3UT0A 3ISIX 1NOUA 1XLHA 3WG6A 3FFSA 3QW3A 1V0LA 1RPXA 5A8PA 4KWOA 3TIMA 4GO8A 1RJRA 1J96A 5HNUA 4FLQA 1XYZA 4Q6JA 1SW3A 5GJNA 2BGNE 4UUIA 5JMUA 1YADA 2UY2A 3CV7A 3R2GA 1BEUA 1R7AA 4K68A 4NAEA 4RR4A 1XM3A 3IGSA 3AC0A 1Q8JA 3R79A 1QPRA 3OG2A 2VDHA 1J2BA 4J3WA 3I6RA 4HMNA 4CNUA 1FS0G 4PUMA 3VDAA 1LUCA 1SYTA 1MZRA 3Q58A 2JK2A 3F5JA 1ZU8A 4IICA 4MKNA 3IS4A 2CNCA 3N4FA 1FH7A 2RDTA 4B3KA 2E5DA 2R1KA 2WSRA 4I5UA 1KWKA 2POZA 3USZA 1S5WA 2CHRA 3LHYA 2J88A 3BLDA 4JIQA 5CCZA 4O17A 5FJJA 2PGWA 1UWTA 2E9MA 5FOOA 1UZ4A 5CG0A 3RMJA 3STGA 2GFTA 4OT7A 5DY3A 4Q33A 3IANA 3P82A 1HQTA 1QUMA 1J01A 4GUGA 4CNTA 2D0HA 2E6YA 4WDTA 5CXPA 4JQ1A 3A3WA 1JIBA 4MOZA 3VU2A 1PS9A 2GL5A 4MWAB 4MJ2A 2Z4GA 3DX5A 1CZ1A 1E1CA 1XCXA 2QUTA 2X30A 1Q2RA 1O1ZA 1RQBA 2BS9A 2D3LA 3PWIA 4W84A 4LV9A 1Q66A 3BICA 4AY7A 1C8VA 1REQA 4CD7A 5LNRA 2AL2B 4XISA 2RJGA 1LJYA 4A22A 4LH8A 1XINA 1XFCA 3IJLA 2PTXA 4N42A 2WB5A 4CQ8A 3B4YA 1B0IA 5HUPA 1G4EA 1D3GA 2H9AA 1K1DA 3GY1A 2NQ5A 5E9XA 1Q2SA 3CXOA 1W5MA 1H2JA 3P6LA 5TD4A 3FS2A 2DUXA 2BTMA 4DJFA 1H63A 1OEPA 2NT1A 4JN8A 2IXVA 4OIFA 1J10A 4DJFC 3R43A 3ALGA 3NQFA 3MWCA 3S0CA 2FZDA 1BF6A 3UFYA 3R13A 2BY0A 5IBXA 3M6DA 1PV8A 3MU7A 5U4NA 4FOUA 3PP7A 5IBXC 5A6AA 1S5VA 5AHNA 2VZVA 3MBFA 2PLMA 2JFEX 5KITA 4XUGA 1XWYA 1TELA 3FIGA 4V1XA 1EJXC 4JX6A 4U28A 3PS7A 5CAKA 1W9XA 3L4UA 3TMQA 1K4GA 4YVPA 4QISA 1D3CA 3GC5A 3WQCA 5E6ZA 4LUSB 5EMYA 2XZ9A 4WOQA 2P88A 8XIAA 1NSJA 3CUFA 4FIRA 3ZVHB 3MO7A 4W5ZA 3VDHA 3NQBA 3W01A 4E4UA 2WMKA 2ZUSA 4MDOA 2G37A 1EH9A 3S42A 2PUZA 1U5JA 3AWNA 2P5NA 3T42A 2PZ0A 2GVEA 1SSGA 3BAYA 3E2VA 3KS5A 4K2SA 1T0OA 1YLVA 1V6UA 2PTWA 1T6MA 3F4VA 1FX6A 5MKGA 3OLEA 1RK6A 1FWCC 3WUFA 1UR3M 5CPNA 1F9CA 1C8QA 1RJQA 3CTTA 5C5YA 3KRZA 4FXSA 3I3BA 1C3FA 1AQFA 3SI9A 5D2YA 4TTGA 1E6PA 2F2HA 4B5NA 3APYA 1S3TC 1YBQB 2BOFX 1S2CA 1UWSA 1ONEA 4IUGA 2XN0A 4LS1A 1MO0A 2J25A 3LQGA 4YU1A 5KSWA 5E09A 3T05A 3WNPA 4P5UA 1XGEA 3A3XA 1UH2A 4LTSA 5KZMA 3TW9A 4Q8VA 2G96A 3RPDA 4HGXA 3OLDA 4NXSA 3KWXA 1E40A 5CZJA 3SCTA 3VFLA 4XUYA 1QXLA 5KTLA 4CQAA 3W88A 2B7QA 4HD5A 2WNNA 1HUVA 1VD6A 4FXFA 2XJ7A 3W2NA 3VD5A 4HJWA 5LIYX 1PDZA 1UIOA 4UFHA 1WDPA 9CGTA 1HTIA 2F6KA 2XM2A 4LAUA 1Q6DA 1QT1A 3STEA 4J40A 3W7RA 2XISA 3CUIA 3HG3A 3PFMA 4YYFA 1JXJA 3CMFA 3HJEA 5BRPA 2RUSA 4GACA 1JYNA 1TWWA 5HXMA 1KQZA 3QOKA 3A64A 2C19A 2OX4A 3EXRA 3IEBA 2YB1A 4XG1A 1VLWA 2QUUA 1PTGA 1BYAA 4B2DD 2P53A 3KCOA 3T2QA 3N73A 2Z7KA 3MUZ1 3RJXA 1KBIA 4GGHA 3SSZA 3MQTA 1WNOA 1ZTVA 5LNVA 2PB1A 3W22A 2DSUA 2FFCA 3GH5A 3F7JA 3HG5A 4C6QA 1O68A 5IXEA 5AVNA 2EQDA 2A1YA 4KFOA 5E9AA 2UY5A 1KA9F 2HE8A 3V0SA 3E3HA 3S2NA 3B40A 4EXAA 4LUIA 3AAGA 1EEXA 3LG3A 1DIOA 1OZMA 3ITCA 5KZEA 1IQ8A 1YW1A 2RH9A 1XSKA 4PMXA 2PA6A 3W2UA 3S2JA 1NM9A 1KBKA 2W6IG 3S5NA 4X2RA 2OELA 1XYFA 2C71A 4MNMA 2WJDA 4GY7A 4PBEA 3D3AA 1VFLA 3NDZA 4ENLA 2GVJA 1BRLA 3TN5A 1AD4A 1XRTA 4QDPA 4ZQPA 3F4WA 4JEJA 1R0MA 3QSRA 1UP2A 4A2SA 2EJAA 4S23A 3ITOA 4UMAA 4NL1A 2OOGA 3AO0A 1O94A 2D69A 2WKJA 1VGAA 4CN1A 5FF7A 1FCUA 4NAFA 3ZJ7A 1NEYA 6PTDA 1UB3A 2QJGA 1DJIA 5CAHA 3GYCA 4XD4A 5PTDA 2Y61A 3ID7A 1MMFA 1NFGA 4UIOA 2Q09A 4YN5A 3QMSA 2GDVA 1PIGA 4XQ6A 4IG2B 1XSIA 4KCWA 2G3FA 1DVJA 4GYPC 3T0CA 2VO5A 3HU7A 3ZJKA 2GSHA 1BFNA 1TPDA 2PEVA 2DT2A 4GXMA 4AVOA 4HU8A 1OFBA 1H7RA 3SM0A 1UC4A 1GTEA 1KLYA 5I3HA 4E2BA 3CL7A 2DH3A 5AC7A 2LLEA 4D6DA 3HB9A 4M29A 2DJLA 5D4YA 1KM4A 4PCPA 3HGSA 2DZUA 3I7SA 5CGTA 5DCDA 5GNYA 4X63A 1VENA 4QG9A 1GW1A 1B3OA 2J9XA 3W00A 4AH7A 3CMJA 4WDXA 4BA0A 3WMCA 2YJQA 5FF0A 4ADTA 2NUXA 5IM51 2Z29A 4D6GA 2WSYA 4JL2A 2OZTA 1JZ5A 2ISWA 4UZSA 1WDSA 4UQEA 1W8SA 4MJZA 2PP3A 2ZRYA 4YTUA 2D0GA 3RGTA 1I45A 2G0WA 2FYMA 3BUVA 1KM5A 4UOJA 3MP5A 2QS8A 1UD5A 1RA0A 1JFXA 1C29A 4B4FA 2PLJA 2VP8A 1KFEA 1ZGDA 1I60A 3U8GA 2DT0A 1VC4A 1EQCA 2DW7A 1B2YA 2PGRA 1ECQA 1JF5A 3CL8A 1Q85A 3W7JA 4PBGA 1P6WA 2E1WA 3TCEA 1MEHA 4NZCA 2ZRWA 3WUGA 1T8QA 1V0MA 3P93A 4Q22A 1RA5A 2W27A 2ZE3A 3U6WA 4B5UA 1QNQA 1XIBA 2R1PA 3U4FA 4QNWA 1K8XA 4JFWA 2XPKA 1OWQA 1T57A 3KTCA 3AZTA 3II1A 3W0KA 5D03A 2VC6A 2INZA 1OD0A 5FEPA 3W7MA 4FMVA 4J28A 3LHUA 3FSTA 4LBUA 3UZ5A 1SPQA 2CXEA 3G0SA 3MDWA 1O67A 2XHYA 2YW3A 2QCDB 1QK2A 3EWXA 3G1YA 3O7UA 2QQ6A 1TR9A 2QDGA 4IPLA 5CH9A 3QTPA 1G5AA 5FJTA 1FWIC 2QIWA 3AMDA 5BOOA 3CWNA 1B9BA 1KXQA 2Y5SA 2F6XA 4Y2WA 3WDQA 1AQMA 1KKRA 3QY6A 2VYOA 2E68A 2WLYA 2DH2A 1NP2A 2VZUA 3GDBA 3GU9A 5FD0A 4ZVJA 1HIZA 1I6NA 2BG5A 4ZOEA 2DSZA 4MYAA 3LPOA 3NA8A 4P61A 3ZWTA 3RXZA 1QHOA 4S3DA 3FDGA 4XZLX 4MFEA 1VR6A 1V3IA 5HDRA 4AAJA 2CC0A 4DBUA 2QJNA 2X2GA 4PMRA 4CU6A 1ZAJA 4KIRA 1ITUA 3KS6A 3FKRA 3UESA 2BGSA 1YHTA 3DFYA 4BQ4A 4HK5A 4L7ZA 1BXBA 3KOXA 4LANA 3VNMA 1WZKA 3N13A 2A3LA 3TQVA 2YPIA 3UBPC 1HJVA 3HPFA 2V63A 2WWDA 4XZNX 3EDFA 5D30A 1DWGM 1QPOA 1JXKA 1H1NA 4Z2LA 2X7WA 3L4VA 1ZJBA 3O6DA 2CLHA 2GUUA 4E2OA 1KCKA 4LWWA 4P7RA 2VX7A 4IGMA 5CZKA 3WNNA 2Z28A 2IQDA 2R1LA 4UCFA 5FA5A 2VHLA 3RUBL 3L68A 5G2WA 2VEPA 1QO5A 1TVNA 3GIPA 3THDA 3NPWA 2VFFA 2G3IA 1ZAIA 4HN8A 1BSLA 5LIXX 4ZA0A 2PCQA 4JOMA 4D8ZA 5HWMA 3CO8A 5HATA 3B05A 4ACYA 4HHLA 4BF7A 2YL5A 3GUWA 3T44A 3F5KA 1DE6A 4RV8A 1BVNP 1JJKA 1SZRA 3B8VA 1QHZA 4Q8NA 3ANVA 2WXDM 3V35A 4EIVA 3OBAA 5I77A 3TFCA 3QQWA 4NF7A 2ABBA 1JVNA 4LUYA 1KRBC 2C0HA 3MKKA 2JBMA 3SCPA 2B4GA 5CC7A 5D9MA 3QGVA 1SZGA 1BVZA 4CD4A 2DSVA 2ZZ7A 1KM2A 1Q6OA 3WK1A 2X05A 2DQXA 1QWKA 4I8YA 1J0IA 5T9BG 1N82A 5EBUA 4N4PA 4YIWA 3U57A 1UKSA 2NQ9A 3VKJA 3HMCA 4NIRA 4GFIA 4W7WA 3BSHA 1GEHA 4MTVA 4E3VA 4Y9OA 4H7ZA 1XIIA 1I0BA 5A69A 3FJ6A 2EKGA 4MZ1A 2Z2BA 5HK4A 4RK8A 1H61A 7REQA 3MKVA 1UR0A 4JTSA 4E8DA 4MADA 1E3XA 4NRRA 2GSJA 1ZBVA 1SO3A 3ZS4A 3EWWA 3INPA 1H50A 2HWGA 4GNVA 3CIXA 5E0CA 1LRTA 2BWGA 5DMMA 1XBYA 3TJIA 4POCA 5I5RA 1YTDA 2YDAA 1TCMA 4ZB0A 3O16A 1UJQA 1UIPA 1XYLA 5IRPA 3CJPA 3VIOA 2UV8G 3KXQA 4Q32A 3U5YA 4QJ5B 2YKKA 1ZLPA 3BMWA 3VOGA 3C5QA 1QMLA 3AS3A 1QCWA 2HBVA 3MMWA 1X98A 3QTGA 4DI9A 2OQLA 3BARA 4RCXA 3S9ZA 2W3ZA 3MV11 5D9NA 2DZBA 1OYBA 2E67A 4LRTA 4UTTA 1XLKA 4EANA 3T2PA 1OFOA 3C2OA 5A6TC 3M9YA 4GX9A 4FNTA 4UTTC 1WUFA 1WPCA 4E6MA 4Q4OA 1Z48A 1IWPA 3OQ8A 1EBGA 3QZAA 2A2IA 3AS0A 1WUEA 4UR8A 4KGLA 1SO4A 5LSMA 1KGXA 1SMDA 3KRSA 3UEQA 1GYMA 4G56A 3FN9A 3EA2A 1Z32X 2VR2A 4GOAA 1EYWA 4M51A 1GQJA 2YXGA 3UW6A 8CGTA 5HPCA 1NY1A 3QQ1A 3D46A 1EJVC 2I9UA 4QSFA 4PTMA 3M0XA 1L6GA 1X38A 1R3RA 3EMCA 1GZJA 2ZX5A 3E2RA 3FJLA 3AIBA 2D22A 1DIEA 3F4NA 3T4WA 1VLIA 1QPQA 1V3HA 3C3UA 3TLLA 5C0QA 3WLNA 1G6CA 3WX7A 1M3UA 2PMQA 2XIJA 1OGSA 1MXDA 3W86A 3ZSTA 4F0KA 1M01A 1NOWA 1KB3A 1KBLA 1KR1A 1DWHM 4DUOA 4GC4A 1W1A1 3ARPA 1SW0A 2GSEA 1MZHA 4FF7A 2ZE0A 3N6HA 2GGHA 1XG3A 4YS1A 4MLRA 4S3BA 3C0QA 1XLAA 1DJZA 1QNPA 4NAEB 4O12A 3LRKA 3CNYA 1MXSA 3W87A 1H49A 1OT1A 1NP0A 2GJNA 3ES7A 2RDXA 4RXFA 2Z1VA 3LSCA 1S5MA 4IPIA 1VEPA 2H3BA 1K6WA 3IVTA 4PR4A 4ZQNA 4KT2A 1PBGA 2CHNA 3CZEA 2W67A 2V38A 4JBRA 4XD5A 4XBJA 4I9TA 1K02A 5LIWX 1V6XA 4ZGYA 2BNJA 5A6MA 3UR5A 1PYFA 4OGZA 1HNYA 3B9AA 4YHEA 5J8LA 3BAWA 3T2OA 3TFXA 2J8FA 2VGBA 9RUBA 3FYYA 2F84A 4KFNA 1OG0A 3S4TA 4RNFA 1MW0A 4MSSA 1UG6A 1QBAA 3M44A 4RW5A 3P61A 4TMCA 4GXWA 3HGOA 4IMDA 3L5LA 4RPQA 4MMWA 3VOCA 3P3BA 5D09A 2OT1A 1OQFA 2DZWA 3V36A 1JAKA 3GXIA 4UTIA 4FR6A 3RLHA 1KBBA 4O1EA 2OCZA 3DBPA 4W8LA 3RLGA 4JQ4A 1X1ZA 2G3MA 1CXFA 2PF0A 4JD4A 3KBMA 3VGFA 3PZUA 2PWVA 1IHIA 2Z24A 5IDZA 1NFBA 2CERA 3R8GA 2BX7A 4GWEA 3IIXA 3UGRA 1LBLA 4S2BA 3QV7A 3EPOA 5JU6A 1FWTA 4QG6A 3GVRA 1ZL1A 5FAJA 2CCRA 4HCLA 3TSDA 3JVAA 1KFKA 2FH6A 2V6AA 1JQVA 7XIMA 3CUZA 1TV3A 1KWGA 3ES8A 1S46A 4B9YA 3TXZA 3WKZA 4DXKA 2FHBA 5D33A 3E0VA 3WQ6A 4K38A 4YXGA 1UR1A 4UTWA 1US2A 3ZFHA 1RAKA 4TX6A 3G8EA 4UTWC 2WV8A 3E2SA 3ARRA 3EOSA 3KP0A 1ZJHA 4R3UA 2VRQA 4HU0A 3SR7A 5CLTA 3UCCA 4O1AA 2WCSA 4LVDA 4IJCA 1VS1A 1U22A 3G1RA 2DSWA 5U7SA 3I4EA 3MP4A 3KVMA 3V5CA 3BW4A 3RMEA 2GDUA 2HQAA 3WFLA 3S2LA 4OFCA 3GVVA 2PRMA 1BYBA 4BWLA 3VZZA 1VJZA 4IOTA 5I02A 3NQVA 5F2LA 3UF9A 3K30A 4BWLC 1M04A 4GI4A 4C6EA 1XD1A 1RBLA 4EE9A 1HGYA 4ZO7A 4FIQA 3FA5A 2YFNA 3TA6A 2WMJA 1G9HA 2HK1A 4W87A 3LNPA 2Q02A 5HR7A 4DZ5A 1AJZA 2ZZ2A 3NJ3A 3LPFA 1EGZA 2QULA 2OLSA 3RN6A 2QZRA 2XIQA 1EDGA 4BI6A 1W1TA 4WSKA 3BQ5A 2P3EA 4JEQA 1JPIA 4JL1A 3AYVA 3AYSA 2Y24A 2GLKA 3NL5A 2ALDA 2WC4A 1LT8A 4M0XA 1OFEA 1H8EG 3HFYA 4UFKA 3NQCA 4GO9A 3WNLA 3HTWA 4XX6A 3P62A 3TTQA 1F3XA 3N17A 1UBPC 2Q8XA 4LAMA 1CGTA 5IFPA 2V81A 1CXEA 3WZ0E 3CV1A 2GGEA 1RQHA 8A3HA 1BQCA 4F4RA 1R86A 3W7OA 6REQB 1W5PA 3R4IA 1B1YA 1JF6A 1IF2A 4O28A 4IM4A 5G1YA 1VPYA 3HGRA 3PBWA 2WHKA 3ARYA 4L1XA 1C8YA 4B9ZA 4FF5A 4RNHA 3CAQA 3GNXA 5FL7G 3W4RA 2WLZA 2AKZA 1TTPA 3N12A 1WQ5A 1MEIA 4JTCA 2WYSA 3OIXA 4DJEA 3WQOA 1RXOB 1CGWA 3OOQA 5I00A 2I14A 1NQ6A 2VR4A 3AAMA 4DJEC 3EB3A 3MI2A 5TIMA 3OFNG 1WX0A 2JQXA 3G3MA 1E56A 3CZ8A 4S39A 2KX9A 4GA8A 1GQNA 4IPJA 4QNEA 1E6ZA 3TXVA 4ALDA 2FLIA 1X8CA 1XIJA 1NF7A 3FK4A 1W91A 3LLDA 4GGBA 4WY0F 1LQ2A 4GQBA 3FHQA 2BBFA 4P7LA 2H8XA 4GY1A 2EPKX 4NNBA 3M47A 4A4AA 2XFFA 6CGTA 1NDYA 3TW6A 4IGSA 4WKFA 2CBUA 5DT7A 3B9OA 3NZRA 4HYWA 3RHGA 3VUPA 1KV8A 1K9TA 4H8HA 1R3WA 4GKLA 4DRSA 3CAKA 5T9CE 1OC5A 2ZCGA 1LRQA 2J6VA 3NL3A 4IL0A 5FACA 3IJ9A 2XVNA 2HTMA 2VD9A 4A8IA 1MDRA 3KL3A 2E9LA 3IIOA 4K3ZA 2PD9A 1UR4A 3S9IA 3KEHA 3NSMA 4M6PA 3IGUA 5BWAA 2PC8A 1I4NA 4KEMA 4YHGA 3CUGA 3SUUA 2ZXAA 3TUUA 3CT7A 3OVGA 4PSRA 1EJRC 4LNYA 4QE1A 4W8AA 3MPGA 5A5WA 3N9SA 4LAKA 1UR8A 3QY8A 4C1NB 1Z9AA 4CQCA 3ZJ6A 3EAUA 1N2VA 2OB3A 5LKYA 2ZC1A 1W37A 3A47A 2AL1A 4CN4A 1EP1A 3DFQA 4AX7A 4IFKA 3GR8A 2WSPA 2ZTJA 2FKPA 3HV9A 1V93A 4DLMA 1GKRA 2JKPA 4P8XA 3VUSA 1XIGA 4BQ2A 2XU2A 1ZPTA 2BODX 3BH4A 1H4PA 2J77A 4NILA 4ORIA 2EF9A 3HZ3A 1F6KA 1QNSA 1J5SA 1IEIA 2XWEA 3A9IA 3GXMA 4IXHA 4NT0A 4ACZA 4EX4A 3K4AA 2CEQA 3AMLA 4R5EA 1W9BM 2C16A 3WBXA 3VDBA 4GYKA 4HTYA 2VJXA 1RK5A 2FB3A 1TTIA 3DXIA 4C6JA 4TO8A 3NPXA 4DJDD 1GT8A 3WQPA 1TUXA 3OVRA 4ERGA 1GKPA 4Q8QA 3B0XA 3FOKA 1P0BA 2ZTKA 3FX4A 3PULA 3GQYA 1POJA 3ZIZA 3W6YA 1LLZA 2HPMA 1Q6EA 1VCGA 1EO5A 2VENA 5HQLA 3TVAA 1KCZA 4JY8A 3DHFA 3WLHA 2V3GA 5TF0A 1A4LA 1LLOA 3TYDA 3ITVA 1U30A 1E9LA 3H2FA 1NIUA 1R2RA 3PB2A 1TWZA 1PCKA 5F2MA 3DC8A 2XIOA 5F4SA 1ZBCA 1F7BA 2Y5JA 4OZOA 1UA7A 3O05A 1Y7VA 2OLAA 4W5UA 2WHMA 1SJDA 3TE9A 1PZ1A 1OFQA 1VRDA 4K1WA 3R0UA 3TZFA 1Q7ZA 2NX3A 3G0UA 3IUIA 2E4TA 1J93A 3LCWA 3NEVA 4LB4A 3ITTA 4V28A 4WR3A 1PXGA 1AD1A 1TPH1 3ZT5A 4E3TA 3MSDA 1E0UA 3W1LA 4AZ5A 3CM4A 1UW9A 4AB4A 5A3HA 4F0HA 4W4QA 1R30A 1RCOB 4AD3A 4QCEA 3VINA 2VNCA 3H4XA 4N7QA 3S9YA 5JBDA 5ABTA 4ZENA 2ZZ6A 4AZ6A 3LZ3A 4TU1A 3GXTA 4BEQA 2CYGA 2I16A 1O1HA 3B97A 2YX0A 4PE8A 3PM6A 1HW6A 4KRUA 3BURA 1KM6A 3THAA 4KEUA 3N1AA 3CASA 1EX1A 4Z2IA 3KFTA 2X0HA 3NGJA 2ZZ1A 4I8DA 1RALA 4N2YA 4Q8MA 5FI8A 3CQKA 3JZEA 3GDKA 3VI2A 3W7KA 5EPDA 3UWYA 4AISA 1JR1A 2RFGA 1PX3A 3O2LA 4Q4PA 3BW2A 1ME9A 3N3TA 3OJGA 4ONVA 2CWXA 2FFIA 3RJYA 3G1DA 3O63A 3H70A 1OC7A 4QHRA 1L6YA 3E2QA 3FEQA 1XBVA 3LOTA 4BS0A 3GXFA 4GZJA 4ERAA 1UQYA 2G3NA 3PBYA 4Z08A 1X8FA 1YDVA 4UR9A 3DG6A 1J8VA 4XK2A 3W70A 3PAOA 2ZRVA 3UXLA 1BTMA 3NWRA 3OZPA 4OV4A 1AL7A 1UROA 1YDYA 1GG1A 5T8GA 1FXQA 1VBJA 3LM7A 3TQPA 1KGWA 2JIZG 1YE4A 3NQEA 3ZLHA 2OYMA 1BD0A 1TIWA 1UC5A 5AYIA 2WPGA 2FIQA 4I5RA 3UCDA 1MFUA 3UNDA 1ZJIA 3APGA 1ECEA 1P0DA 4NJIA 2PTDA 4QP0A 4YTRA 4UOQA 1TJ2A 4HK7A 4QXIA 2EKCA 2GWGA 4HP5A 1VHNA 1FWAC 3LRLA 4PGLA 1SJCA 3S6DA 1R9YA 1SZEA 4BCEA 1C91A 5L6UA 4WEVX 5HJXA 2GJLA 4LS0A 4PN2A 1CYGA 2RJHA 3KCJA 4ZXOA 4CD8A 1HO1A 1F2JA 3VOHA 4D6FA 3FAXA 3G1HA 4FNQA 1ZUAX 1KFJA 3VCCA 5C9WA 4AXNA 1LWHA 3IJ7A 4A3UA 1O5RA 3CZLA 4LJ3A 2NV9A 4JZ5A 1SR0A 1FHLA 3BANA 4IIBA 4IL2A 3G2GA 2VX5A 3M7SA 2AMXA 5AC6A 1L0PA 1N55A 1EJWC 1H41A 1AK5A 3OU8A 4RZ4A 4DO7A 1SFJA 4GUIA 3HG2A 1F3WA 3VD4A 1P7TB 2ZVIA 3HF3A 5LXEA 1IYXA 3Q37A 4MM1A 4HHMA 1OFAA 2J7BA 3W73A 3W2KA 2YXXA 1R2TA 1VPXA 3TTOA 4XZHA 1FP8A 2GUBA 5CPTA 4FNPA 5C2CA 1AVAA 4W85A 1JCNA 3CYJA 3NM3A 3PB0A 4NVTA 3BAIA 2PRLA 2ZUNA 3GG1A 1UYQA 2C7FA 1ODUA 1V4YA 2GPTA 1JZ2A 2D2GA 3WN6A 3M5XA 5D2XA 2DT1A 2WSQA 1TFVA 2FQIA 1RLCL 2WHLA 4RXGA 2W9MA 2AQWA 2YA2A 4MIMA 5FF4A 3IRDA 3URBA 4H7VA 3WBEA 2HV5A 3WH6A 2PWFA 1F05A 3BMXA 1PO9A 5CZSA 1G01A 2BHZA 3THCA 4HNNA 3VA8A 3CQIA 1ISXA 2QJMA 1A50A 4LGXA 4AD0A 1HGWA 3SGUA 2W62A 3UR8A 3BLOA 3WJYA 2WVVA 4PSPA 1QW8A 2W0UA 1J9YA 2BGQA 2CZ5A 4KPLA 4CU7A 1FKXA 4K8HA 3OEEG 3PTQA 2XGIA 3MCOA 4EAMA 1G69A 2BVYA 5AC8A 3U9IA 3RU8X 3L5AA 1SVDA 3QYQA 1QR7A 1UD6A 4GIAA 1YRRA 1DIKA 5EBAA 3SDOA 3POHA 5LA1A 1EP3A 2VOMA 4EVZA 1YNPA 2VQTA 4LQ1A 1ZBKA 5CPMA 1OC6A 4CD6A 4PUNA 4ZQRA 1LBFA 4GVGA 4US5D 3KBSA 4PMUA 4XIMA 2ZX9A 2OU4A 1IV8A 2R8WA 3UPMA 4JKKA 3WDPP 5DN6G 1XQKA 4NY2A 3NQ7A 1E70M 4KESA 3ZZ1A 2QVNA 3MDUA 2OZ0A 3H53A 1ME7A 3F4CA 4NJHA 1Q6CA 3SADA 1B4KA 1BWLA 1XLFA 3VZXA 4ZZ9A 3KAOA 3NQDA 5BNKA 3K8MA 1UOKA 1W2PA 3OW1A 1HG3A 3WDHA 3UJFA 1PUDA 1D7KA 1EP2A 2BZNA 3AS2A 5BXRA 4AVNA 3S5SA 2J6XA 4QS6A 4S3JA 3MTWA 4G7EB 3KVKA 5K9XA 4TX8A 3G24A 3P5ZA 1KFCA 1VFTA 1PJ9A 3KX6A 3NL6A 3R1ZA 4Z2KA 3UWWA 1XIDA 2DVTA 3GVGA 3BCJA 4LB3A 3LX9A 3P81A 3GXNA 3QR3A 1GONA 4GZIA 2XN2A 2VFDA 4UQAA 4MYXA 1AH0A 3QKEA 4PCTA 1A0DA 2AOSA 7TAAA 2QCNA 2VWTA 3EYPA 3LHTA 4CCCA 4PTDA 2I7GA 4D9PA 1N8WA 3V0TA 3JRKA 1E0XA 3H23A 1UBSA 3H8AA 2I17A 1FWHC 4Q7BA 5J5DA 2XH4A 3FAWA 1FWSA 2O9PA 2ZVRA 3PZ9A 1C9DA 3UR7A 3NYDA 1PX8A 2QT3A 1V3JA 5I0DA 4JDYA 3WF2A 4Y6GA 4QFUA 3FKSG 5FIPA 1FFQA 1S1PA 5D04C 2F6UA 2P0IA 5I79A 3CQJA 3OBKA 3AXMA 3IJIA 5TQLA 3DKJA 3LPPA 3GTXA 2QCCA 2CITA 3QMTA 2Z2AA 1RVKA 3ARUA 4HJFA 2VL4A 4OECA 5DANA 3W7EA 1SUXA 1ZCCA 4HCHA 3OG3A 2GVYA 1Q6FA 4V2XA 4PMVA 3T8LA 1KNWA 1W1VA 2CZEA 4JX5A 3UJEA 1OIFA 4XKYA 1MUWA 1KBJA 1VKFA 3QGAC 1PHWA 3W37A 4ZB2A 4EPDC 3COTA 4L65A 3OIHA 3AIEA 2OFJA 3MS8A 2VURA 3V1HA 4E2VA 2IPJA 3VCRA 4L9XA 1H51A 3GDTA 2C1GA 4HBKA 4GABA 4V33A 2HNEA 3BLFA 5HJYA 2J62A 5FF2A 1L6FA 3B8SA 3N2XA 4JGDA 3P5YA 4KCVA 4UFIA 2EAWA 4DXXA 4AIBA 1E0VA 1XDLA 3STFA 4HNLA 1AUSL 2HXTA 2ZUVA 2PDWA 1O60A 1T40A 1QI0A 4C6DA 5LIUX 4X2PA 2HEJA 3RM8A 3ZT6A 4M5PA 1F8IA 3CU2A 3FVDA 1OB0A 4UC5A 5E6YA 4V15A 3VNYA 2CZFA 2WVTA 3UG8A 1K70A 1V3LA 3Q65A 2PTYA 4O0ZA 1JPMA 1X6NA 1JD7A 4IWWA 5BW6A 2CLIA 3L4TA 4LVAA 3V0UA 1A5CA 1JGMA 2Q71A 5DFAA 4AXKA 4FR1A 3VPLA 4HCDA 3IRSA 9XIAA 3NQMA 3OAAG 4GH3A 3I6EA 3VD3A 2J7FA 1DL3A 3VNJA 4TT3G 2XN1A 3VM7A 1CXIA 1TMQA 1Y5WA 4F0RA 3HQOA 4LPCA 2X1UA 2GGGA 4GUFA 3NVTA 1CIUA 2ISFA 5IFTA 4LV4A 3LXAA 1YPXA 2B7OA 3I68A 1LTDA 3TP4A 3GTHA 3RLUA 5FEXA 3TYAA 1DJGA 1OCJA 5I07A 4UTJA 3PC0A 1GTHA 3PBMA 3UG5A 3VNZA 2E1DA 4LCRA 4IHCA 3NQ6A 3IAQA 1XX1A 2Y85A 5A6BA 4MAVA 2A79A 4H19A 1ZFJA 5HUOA 1TQJA 1RHCA 4RE0A 4OE7A 2YLAA 3L2LA 3WQVA 2XG9A 4KQNA 1WAUA 4MNKA 4ML9A 1TPUA 4GX8A 1J0YA 1VZWA