1E0UA

Structure r271l mutant of e. coli pyruvate kinase
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
470
structure length
461
Chain Sequence
MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Allosteric Regulation of Pyruvate Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
molecule keywords PYRUVATE KINASE
total genus 166
structure length 461
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.33.10 Mainly Beta Beta Barrel M1 Pyruvate Kinase; Domain 3 PK beta-barrel domain-like 1e0uA03
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1e0uA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 1e0uA01
1IZCA 3QLLA 1F8MA 1S2WA 2XZ9A 4B5WA 4HYVA 3OQ8A 4JPGA 1ZJHA 4KCVA 2DUAA 4QG8A 1E0UA 3QV7A 4FXFA 3E5BA 2XDFA 1DXFA 4L9ZA 3M0KA 4HYWA 1T5AA 1ZLPA 5TAOA 2VWSA 3T05A 1VBHA 3B8IA 1S2TA 4IQEA 3GR4A 3LYEA 1Z6KA 3IS4A 1DQUA 1E0TA 4KCWA 2G50A 4FXJA 1MUMA 4IP7A 4B5VA 1PKLA 3SRKA 3U2ZA 3BJTA 2VGGA 4QG6A 2V5KA 3MA8A 4LSBA 3PP7A 3SRDA 2R82A 1F61A 3VAVA 4YJ5A 4DRSA 4L80A 2KX9A 4B5UA 3EOEA 3PUGA 1KC7A 1U5VA 1F3WA 1VBGA 1PKMA 4G1NA 3P0XA 3R4IA 2HJPA 3QTGA 4KCUA 4MG4A 1F8IA 4KRZA 4L7ZA 1F3XA 3QZ6A 4KCTA 3OYZA 2QIWA 4WJ8A 3EZ4A 4RPPA 3HQNA 1T57A 2VGBA 3I4EA 1DXEA 2V5JA 3OYXA 3EOOA 3T07A 4ROQA 3M0JA 4L9YA 3KHDA 3QV9A 1AQFA 3E0WA 3GQYA 2XZ7A 1O5QA 4MF4A 1M1BA 1U5HA 1JDEA 1XG4A 1A5UA 3T0TA 4B5SA 1A3WA 3H6OA 3FA4A 2OLSA 1A49A 4QG9A 4B5XA 3KTXA 1OY0A 3LG3A 3ME3A 1IGWA 2HRWA 3FA3A 1S2UA 4B2DA 3QV8A 1M3UA 4B5TA 1A3XA 1UJQA 3G2GA 1SGJA 3HQPA 4IMAA 1O66A 3SRFA 3HQOA 2X0SA 2VGFA 1GGOA 1XG3A 3EOLA 2VGIA 1VP8A 4QGCA 2E28A 3E0VA 4YNGA 3QV6A 2DIKA 1KBLA 4TV5A 4B2DD 1S2VA 2HWGA 3QQWA 5JVLA 2HROA 1O68A 2L5HA 1PYMA 3BJFA 1PKNA 2VWTA 4IQDA 3GG8A 2ZE3A 1DIKA 4TV6A 3N25A 2BG5A 1OQFA 4KS0A 2WQDA 3SRHA 1PKYA
chains in the Genus database with same CATH superfamily
1XFBA 4JQ1A 4ECLA 1KWGA 1K02A 3ZJ8A 2I9EA 2Z26A 1MW2A 3FLUA 2PUZA 3BLFA 8XIAA 4JL2A 4XK2A 4INFA 2GGEA 4AZCA 2ZZ2A 4A3HA 3QRHA 1EF2A 4LAOA 4O18A 1LL4A 3VC5A 2BASA 3AHTA 1A47A 3K8MA 3UR7A 5JIWA 3PF3A 2GGHA 4XKMA 4LANA 2J6XA 2VC6A 3MMTA 1Q7MA 3INPA 3ARXA 3MKCA 3HQ1A 5T9CE 2Z29A 5C7VA 3EGJA 4GQBA 3WQEA 3F2CA 5CKSA 1NP2A 1UQYA 4DJFC 2X1RA 3IJ8A 1LQ2A 4KWUA 3OODA 4GZIA 1MW3A 3WQCA 1C29A 2O55A 3QHMA 3UFYA 4Z2IA 3WZ0E 1BVNP 3SFWA 2WYSA 5HANA 3LNPA 3CV1A 4NZ4A 3W2NA 1GK8A 2PZNA 1G0CA 3W7MA 2NX9A 3QBUA 4K38A 2CWXA 5CAHA 4LC8A 1JPKA 3G1DA 3NNTA 4O0QA 1WX0A 3N11A 1ZP4A 4Z0SA 1KGWA 3VGBA 3V75A 1UPPA 4WOZA 1U30A 4WGXA 4GXPA 1PX4A 3BW3A 3TZFA 5FF0A 3VIGA 1EXPA 2Z7GA 2CLFA 1KV5A 4XUYA 5IDIA 4S3GA 1SMAA 5CCZA 4MNJA 1OFOA 1VFHA 3LV5A 6CGTA 1OK6A 4D6FA 1GYNA 3N13A 3C61A 5IOBA 5I3FA 1HVXA 4Q8VA 1LT7A 1V77A 1EO7A 4J5NA 2AKZA 4HNVA 3Q45A 1VJSA 3QKZA 4KCUA 2A7PA 2HXTA 4JZ5A 8TIMA 2PLCA 4G5DA 2XISA 1HTIA 1SO4A 1YTDA 3BLDA 2G4JA 3NWRA 2Y5JA 1RR2A 1YYAA 3TQKA 2VT0A 1SSGA 3T4CA 1F5ZA 1HJXA 1UROA 2HLDG 5BCAA 3EKZA 4CNPA 3FDKA 4LVFA 1MQPA 2CU0A 1P0KA 1BPLB 4BA0A 2BHUA 2YSWA 4ADUA 3B8WA 2QCEA 4DJDD 5HQEA 4CU6A 2JF7A 3I7SA 3NFUA 3TYEA 1A5BA 5FJIA 5AFDA 4IG2A 3HB9A 3M7SA 1XM3A 3RCYA 2J7EA 1O12A 1FWNA 1UP0A 1VPXA 1R3SA 2PS2A 2B81A 4QNEA 3W88A 3WQDA 3CUXA 3HG3A 3BAXA 1PKNA 4EX4A 1S5VA 3SUUA 2ISDA 4R34A 3PTMA 2GJRA 2W63A 1O60A 3S2JA 3SW6A 1B2YA 4UQAA 1OVDA 3LCIA 1DQWA 3M5XA 2QNEA 4UQEA 2OO6A 4FHAA 2VO5A 2B7OA 2CFFA 2BBFA 4AWSA 3FYYA 3NVTA 2HPMA 1FFRA 5FEPA 1L8NA 1OGSA 4PUKA 1S2TA 3H55A 3K4WA 4FXJA 1QPKA 1XRSA 2XVLA 1L6SA 4HT3A 3UG3A 5DANA 4FAMA 5HWNA 2YPIA 2VFDA 4ACZB 2E8YA 3PFRA 2X2GA 2ZX6A 1XLIA 1K8YA 1ZUAX 3RJXA 1T8XA 3QTGA 3W1AA 2WVTA 3B0VC 2UZ9A 1HIZA 4WX2A 3EA3A 1KRCC 1FHLA 1UWQA 5HULA 2PA6A 1SZFA 1NU5A 1E3XA 1XXXA 3BQ5A 2Y4SA 1TIMA 1J0YA 1HL8A 5A6KA 2XIOA 4K1WA 2PLMA 3VM7A 4GO8A 5H2ZA 3B9AA 2WLYA 5KZDA 2PGWA 3KVLA 2ACQA 5KZEA 5G4EA 2VFEA 3RU8X 1E6PA 2WHMA 5CG0A 5DO8A 5F1UA 1BF6A 4GO9A 3IRSA 3TTQA 1ZALA 9XIMA 1XQKA 3VNJA 1GOWA 3E5PA 1RBOB 1LQ0A 1EP2A 3KBMA 5TIMA 4BI6A 2H3BA 3VKDA 1A5OC 1OCBA 1NEYA 2IPJA 2DIKA 5M2FX 2PDYA 5A6LA 3W85A 1EO5A 3QSTA 1HP4A 1YX1A 4AWEA 1UKSA 2R1NA 4LCRA 1OINA 1VHCA 4WJEA 3ARZA 3TUUA 5KTLA 2J6VA 3ONBA 1Q3NA 4ZR8A 5A8PA 4HCDA 2C6QA 3HV8A 3W1QA 3RLVA 3N14A 3S2MA 1HL2A 3L2MA 4I9MA 3WLKX 4LRTA 1FVPA 4KEZA 1RXOB 2OJPA 2QAPA 1W3HA 1QO5A 3DFPA 2P1FA 3GNPA 3OHMB 4CNTA 5HDRA 1XQLA 3H23A 2QPSA 1FH9A 1RPXA 4YVXA 1GOMA 1KFLA 3PM6A 2QKFA 3UWQA 1T6MA 4GX9A 5FJTA 2PC4A 1KFKA 1TZ9A 4UFLA 4MWAC 4K3ZA 4IXHA 4H9VA 3ME3A 2AL2B 2H9AB 4LOCA 3N2OA 3NG3A 4IG2B 2JIWA 4QNWA 3G2GA 3EDJA 2OU4A 1W9VA 2P76A 3T8QA 5HATA 3WEMA 2V2CA 1J0HA 3A23A 4NAFA 3ZO9A 1D7KA 3LPOA 3NOEA 3VIFA 5DMNA 2F84A 1CLKA 4UCGA 3VD9A 3H54A 4JFTA 2J77A 4B5WA 5EA9A 1E40A 3QR1A 5FEXA 4DZAA 1R85A 1OFAA 1TRDA 1M68A 3WMCA 3JU2A 5K4XA 3IJDA 2VFFA 2PF8A 4DWSD 3DKJA 3NXLA 4PULA 1RBAA 1S5TA 4HHLA 2WO5A 3RO6A 4WDUA 4Q8MA 4GKTA 1BXNA 2XYLA 4LAZA 1OADA 3CGTA 4JTKA 5EMMA 3PJUA 3W53A 1D2KA 5FAJA 2ISSA 4D1JA 4K68A 4LYPA 1HW6A 4Q8UA 1XLDA 4GBUA 1NWRA 2E7FA 4W89A 5BW6A 5LNVA 1D3HA 1SMDA 4Z2KA 1TELA 3FOKA 5LA0A 3LHTA 3MU7A 4IIHA 2X05A 4W7VA 3VMNA 2P5NA 3AS0A 2PEVA 5CZJA 3PTDA 4H83A 4IJRA 3G3MA 3TMQA 4PMXA 5I3HA 3NEVA 3THUA 3DESA 2E5CA 3NTYA 2ACRA 3CO4A 3FA3A 2DGAA 2BNJA 3TTOA 3PY2A 1HJQA 4RK8A 3OEEG 4FX8A 4Z1MG 3KVJA 1BF2A 2VD9A 4L5ZA 3EB2A 5DLCA 1X8CA 2X1UA 1G4SA 3BLEA 2HISA 2WHLA 1EZWA 1KBLA 5FA5A 3URBA 1J2WA 1FWFC 2VOTA 4Y8FA 1KQYA 2V82A 4OV9A 3SCNA 3L9CA 2H8ZA 4NQ1A 4XV0A 3NYDA 3TSDA 1I9CB 1EKOA 3B97A 1VR6A 2WVVB 4HMNA 2JDIG 2QV4A 3NZPA 3QFEA 2D24A 3GNNA 4R7WA 1QI3A 5CG7A 4RZ6A 2Z24A 2ABAA 4MVAA 4TOQA 1KKOA 3NA8A 3CQ0A 3LHVA 5F2LA 3C5QA 1XL9A 3PZGA 4N9DA 3VAVA 5LIYX 3KM8A 3P14A 3SCPA 3UPMA 2PTZA 3GUWA 1K77A 4GACA 4ZBCA 4DF1A 1WP6A 5I3IA 4AHQA 2EPHA 1JD9A 3AIQA 3CU2A 3BLLA 3S9IA 1WDWA 4IMGA 4OUEA 1NAL1 3W2MA 1VPYA 3SUTA 1ELSA 4UTIA 1MXGA 1JDDA 4AVFA 4YTSA 2MNRA 4MSSA 3JW7A 2VX5A 3GHSA 2PDNA 2J9ZA 3J7HA 3FIGA 4OBTA 4Y7EA 2BTMA 1FWBC 2NUWA 1JAKA 1WAUA 1GWJA 2ZVIA 1DXIA 3UCDA 3NQ7A 3GE7A 4ZE4A 2Q8ZA 2WKGA 3W6LA 1CGUA 1OX4B 1TV2A 3GG8A 2G96A 1V0KA 3ECQA 4F2UA 2JGYA 4HCLA 1IT7A 4U10A 1GW9A 3LY0A 4AY7A 4D6HA 1HF6A 1KLYA 4F0KA 3R8HA 3A6OA 1TR9A 1Q13A 5FL7G 4QE5A 2QJNA 2CESA 4DZ5A 2A6LA 4DF0A 1ZSXA 4XIAA 3PWAA 3R13A 2AL2A 1IEIA 1U5VA 5CBBA 3ATZA 1UZ1A 3S42A 4UQDA 4PB5A 3NOYA 4UMBA 4NNCA 2QCHA 1LCOA 2C3ZA 4NJKA 5LNUA 1DPMA 2ZZ5A 3IIOA 3W7CA 4AZIA 3SCWA 1DOSA 3KXQA 1TVNA 2ICSA 2FVKA 4R85A 6TIMA 4XSMA 3RM9A 3SN1A 3M07A 5ABFB 1W3JA 4NJGA 4WY0B 4AEOA 1US2A 2GUUA 2E1DA 3S46A 3MP5A 2HRWA 4CNOA 4WDWA 2J8FA 4UTHA 1EQCA 1OC7A 1KXVA 4BQ5A 5FJUA 2QLYA 2J8TA 4ZE5A 1V7AA 4WOQA 5IDZA 4GD0A 4BI5A 4GVFA 1AD4A 3CV6A 3MP4A 5TBOA 3QQWA 2BXYA 2O9PA 1KRBC 5AYBA 3OB8A 4BJHA 4XVEA 1AZ1A 1IWPA 4DO5A 2WPGA 4NYUA 5DCEA 1TPUA 1HJUA 3T44A 2EJ1A 3ZLHA 2FKPA 3QGVA 4KFNA 5CJ5A 4C6EA 4FNQA 1OB0A 4A3RA 4MGGA 2WHJA 3O0KA 2I1OA 4EPEC 4GJIA 1DTNA 3MHGA 1V8EA 5ENLA 5HPOA 3PNZA 1UH3A 2E77A 5GPRA 4L56A 4W7UA 4Q8WA 3DFOA 4DAFA 1PHWA 3C8NA 2FZBA 3H24A 4Z42C 1JGMA 1PJ9A 3R89A 2PU0A 3MQTA 4ZZ9A 3NSNA 4ES4A 4DYKA 1MVYA 1UR0A 2HBVA 4JFUA 1AUSL 1OYCA 2PDMA 4KCTA 4H3DA 4AF0A 1FHDA 2PP1A 3H4WA 3CHEA 1W2VA 3H4XA 3BAKA 4AYSA 1EGVA 3M0JA 3STCA 1EFZA 1P6BA 1PCKA 3TYUA 3BSHA 3CZLA 4ORIA 3ANVA 4DUWA 1JYVA 5AC6A 2IKGA 2OGJA 4KGLA 1X7FA 3GC5A 1HX0A 1BQCA 1VEOA 3TX9A 4J3XA 2OOFA 4ZQPA 5BOOA 3H70A 3CZGA 2QHAA 3LZ3A 4PTVA 1UKOA 1V3LA 4DWSC 1RVGA 1V03A 3TZNA 3HGSA 3CPUA 2HBXA 5GJNA 2VUYA 3T9PA 3UJRA 3FXYA 4O17A 3T8LA 1YPXA 2Y5EA 4HK6A 3TJXA 1BXCA 1G7UA 2OX4A 3MMWA 4LW7A 4Q7IA 3GDBA 3IWPA 3T05A 1WZKA 4AU0A 4JTQA 4KCWA 5LSMA 4ZXLA 3GB6A 1HZYA 1R6WA 5EMLA 4HZ8A 3WQ8A 3KRZA 6PTDA 1QO2A 4HMCA 4YWIA 1QAPA 1U33A 7TIMA 4MYXA 2ZA2A 2VZUA 1FKWA 2WJEA 2C18A 3GIPA 3VNIA 3AIEA 4Q4OA 1OCQA 3T42A 3IJ7A 3NM3A 1EYWA 4A8RA 1KD0A 5MKGA 4KIRA 3EA1A 4FNRA 3S1VA 2ZKMX 3LEPA 2ZA1A 4S3FA 2EF9A 4DJED 2ANUA 5HNNA 2V3FA 4G8TA 5A8OA 3HFTA 3A22A 2WQPA 4CN4A 4EKJA 2PLJA 2X16A 2KZHA 3WD3A 4MWAE 2WZHA 1TA3A 5D9NA 4MY1A 5C8BB 3WBEA 2DQWA 1DJHA 3WD0A 3AYVA 3WL0A 3ZIAG 5CC5A 1RALA 3WH6A 2AQOA 3MCNA 2BGSA 3FCPA 1KR1A 2FGZA 3CUIA 1LUCA 3BJSA 4W8BA 4JYFA 3WD2A 3UYIA 1KM1A 2GSJA 3IV3A 3MCOA 3UZ5A 3SEPA 3PZOA 1PXGA 3SGUA 3OG2A 5FCZA 1O1HA 3W75A 5E9AA 2DZWA 3FKSG 4A3QA 5T9BG 1ONRA 4S39A 4C1NB 1F61A 1ITCA 1CPUA 1TFVA 3IVSA 1U2YA 4AWTA 3QOMA 3EWUA 1VFOA 4AY8A 3S5SA 3RHGA 2OG9A 5CPTA 3CQIA 2V3EA 1SW3A 5D2XA 2E0PA 4LFYA 3BLPX 3EEZA 1Q6CA 2F2HA 2PP3A 3AYRA 1OEPA 3R0DA 3L2IA 3AQUA 2XUCA 3N3MA 2C79A 4EP8C 3V0TA 3CHVA 1G4PA 1CB7B 1GOQA 3GQYA 1Z9AA 1M65A 3HPSA 4S38A 5CPQA 4D6IA 1FCQA 3WQ6A 3S3GA 6TAAA 1RQHA 4K6AA 4UCFA 3W26A 4HSNA 1X97A 5GJPA 3W70A 1XIGA 3LGGA 3BWWA 3G0SA 3EEGA 3TCSA 2RFGA 3TVAA 2W5FA 2BHYA 5T91A 1M9HA 3M0YA 3PZMA 3OA5A 3RRXA 3NGJA 4FPSA 1Q6RA 3PHAA 3LQLA 4JIIX 3IUDA 2CKRA 4LB3A 2F6KA 1XIIA 4DEFA 2WWDA 5G2HA 2CBJA 1IR2A 1W9DM 3G8EA 4FEZA 4Z1DA 2XFWA 2X1IA 2YR1A 4RUBA 3TLLA 3WLLA 4CVUA 4XAZA 2HDJA 4OQVA 2NQJA 1UWSA 2YDAA 4QRNA 4EPBC 4N42A 1B57A 3CK5A 4L4PA 3P5ZA 2A3HA 4U2YA 4JOMA 3BLKA 3U5YA 2FPVA 3GW3A 5DN1A 3TONA 4B9ZA 4UOJA 2J9XA 2PCQA 4JIQA 4WZHA 3KDNA 3LS9A 4PB3A 3GFZA 4D72A 5I06A 1RLDA 1CI1A 3WDQA 3U7BA 3FDGA 3C0LA 1VP5A 2YB1A 3R10A 3U5UA 3PNUA 2QAFA 2O0TA 4ICCX 5CPNA 3AU6A 3M0IA 4IQJA 1Y5XA 3PK7A 1SUXA 1OY0A 3FEMA 3S2CA 1W0MA 1YPFA 1ZQ5A 2CLMA 4NASA 3MW7A 1E15A 3DFQA 1QR7A 2J79A 3QPYA 3MHFA 2D0FA 1E6SM 1L9WA 2WNZA 2E9MA 1R5YA 4QBXA 3FGCA 2V7QG 1AODA 1YDYA 3LD5A 2XFFA 1FWIC 2X2YA 1EOMA 3JUGA 3SUWA 3F4VA 3BV7A 4QDPA 2PSNA 1WO2A 2A3AA 2QCLA 4MZ8A 1CGXA 2J74A 3IIZA 3VOHA 3ABSA 2YW4A 4IX2A 2HK1A 4BK9A 4HZ6A 4M1RA 3W4RA 4DRSA 1R0MA 3WQOA 1GZGA 2FJUB 3R5EA 5KZ6A 1NDVA 4GCAA 1EA9C 3HPZA 2Y8UA 5DMYA 3FGCB 2RH9A 4ZB5A 5J04A 3MUIA 2QPUA 4GY7A 1RUSA 5FF7A 5CBIA 1SYTA 1HXJA 4XD3A 2V5JA 4HKPA 2Y61A 2WNNA 1F76A 3RF9A 2NQ9A 4IQLA 4HTYA 1NDZA 2PPGA 2RGMA 4LNYA 5TNVA 3VKAA 1B1YA 4IGHA 4OUIA 4GI6A 5H91A 1UOZA 2YCLA 3NQAA 3M1ZA 4GE8A 3W2UA 4GK8A 3KHJA 3NZRA 3ZR5A 1NVMA 1FWCC 2CBIA 2EEXA 4ZB2A 1GQIA 2BB0A 4ZO7A 3RR1A 3QF0A 3N15A 4PMVA 4BF5A 3B03A 1DWAM 1W3NA 3LN3A 4H8VA 3VCRA 4HNLA 3LHYA 1WKYA 1OC5A 3TC6A 5FEWA 2Y63A 4EOUA 3SSJA 1UUOA 4O50A 1JCLA 5KETA 1EF3A 5M5DA 4G7FA 4O4WA 3AMKA 1NQKA 4HPGA 1VBHA 2ZXBA 4IQEA 5ABGA 4UTMA 4Y9PA 2E25A 4HA1A 5D9MA 3A13A 2R8WA 3SCOA 1M7JA 3BJTA 1EL3A 2VGGA 3M9YA 4D71A 3O6CA 1Q66A 2QMJA 3P84A 4CU7A 1F74A 1ONEA 2A0NA 5BROA 3MI2A 2POZA 4DJEC 1UR4A 4JTDA 2CERA 3BC9A 5GVJA 1W5NA 3L21A 4S3EA 3MO4A 4D9PA 2XFRA 1T57A 3HF3A 1AFSA 3QMRA 4TX9A 1R30A 3WLTA 4LV4A 3V5CA 1GG1A 3SJ3A 2GJPA 2OWCA 2AOSA 1XG4A 3M0LA 3NM1A 4G7EA 3GSMA 4NX0A 2W6JG 1HKKA 1X96A 3EX2A 1WE5A 1FX6A 3EB4A 3EB3A 2QF8A 3W7KA 1DE6A 3UWWA 5HPCA 4LBSA 1KBIA 1FWWA 4ZL1A 1JR1A 3E2QA 1IV8A 1ZAHA 1F3EA 1BLIA 2BWGA 4IMCA 4U33A 1E71M 4QQ3A 4EF8A 2VR4A 3RCNA 2EPKX 2FZ8A 2RDTA 1CZ1A 1UIOA 1EC8A 1R86A 1TJPA 2DT2A 4H4IA 4P7NA 2PURA 3TW6A 1E5NA 1RJRA 4JEQA 3PUDA 4DNHA 1TX2A 3AXKA 4WVXA 2WSSG 3AMDA 3WMBA 1R2RA 3N2TA 1YDNA 1DWIM 4UQ9A 4L1XA 3F4DA 2UWFA 4OGZA 3MZ2A 1UD3A 2BZNA 1KCKA 3S5YA 4PUNA 5BRBA 1N82A 4XKYB 3P8JA 3PZ9A 4UTWC 3HZ3A 1ISXA 1OIFA 5LA2A 1TMLA 1YDVA 3QSRA 1KFBA 3BCJA 1BKHA 3ORWA 1EIXA 3BCFA 3DGBA 2DT3A 1NELA 3FSTA 4ZMGA 3AWOA 4KQNA 4LVDA 2D2GA 4IMAA 1WB0A 3NQCA 2XH2A 1ME9A 3CH9A 1YW1A 2IQDA 3G18A 1NFGA 4J35A 4IPNB 4D6DA 4GQQA 4MAVA 1E43A 4L9XA 4AXKA 2I14A 5I79A 3KTSA 1KGUA 1U22A 3EAUA 2O56A 4GISA 1DJYA 5EBAA 3N34A 2E6FA 2PZ0A 3E9AA 1QU4A 1V3IA 4O1AA 4A3UA 4NXKA 4MKNA 1NFBA 4KWSA 5AHMA 2A79A 1A5NC 4Q32A 2ZZ4A 3VU2A 3U2CA 3PTKA 4YJ5A 1VHNA 3LCLA 1JF6A 2O7SA 2WVSA 4Q4RA 3M46A 1OG0A 2BGQA 2VFHA 5LHEA 4DXXA 3NYZA 2B7NA 4U3CA 1LLOA 4ZVJA 4YS1A 1QI0A 2P0OA 4H7CA 3TROA 1H60A 2XIQA 3HGOA 2CLEA 1DL3A 4JQ4A 2ZXDA 3PJXA 1UKPA 2NVAA 2TPSA 3ZVHA 2D2HA 1LROA 2ZTKA 3F5LA 4G7EB 4O11A 4NNAA 1XJBA 4PUJA 5KEZA 3A4WA 4FR6A 1IGSA 3IEBA 5G1YA 1PDYA 1T99A 1XIJA 2QMKA 2CEQA 3DCPA 3P3BA 3I3DA 4B92A 1EJSC 3PSWA 2DZPA 2HROA 4TX8A 3AC0A 3PVFA 2E6AA 5A6BA 4HOWA 4KEVA 3QMSA 1UWUA 2A3BA 1V3HA 3TP4A 2JQXA 4KRUA 3ZVHB 5T8GA 5G4WA 1ICPA 4W5ZA 3UA4A 2REQA 4QEEA 4H6QA 2ZBTA 4LALA 1CXIA 1TE1A 4L65A 2ZCGA 3U2ZA 1ZTVA 3G1XA 4RV8A 3N12A 1UWTA 1T96A 3GD6A 5I2UA 4AISA 1DP0A 1G6CA 1XUUA 3L4XA 1H4PA 1OYAA 4X0NA 1ESWA 4Y8EA 1R7OA 4AYGA 2JALA 2JFEX 1UZHA 3CM4A 3H2OA 1XYZA 3UWZA 4LCSA 3HIJA 1E6XM 2R1LA 4WJ8A 1FTXA 5L6UA 2YXGA 5REQA 1FCUA 3MO7A 4GHRA 4ROQA 2I56A 3WH8A 4N0RA 2JKPA 3BLIA 2OZ0A 5I02A 4FSAA 3F7JA 3TAOA 4DO4A 1B3YA 2FDMA 3VO0A 9XIAA 3JR2A 2FZDA 1SGJA 1FCVA 3GKFA 5LIWX 1LF1A 1XKYA 3ES8A 5LXEA 3L67A 3BAWA 3SM0A 4E5TA 4XAGA 1F4AA 3WBXA 4XZIA 1E51A 5M17A 3CMFA 3GHUA 4JTTA 3GNXA 2PWVA 2OMAA 4JTAA 1SJAA 1E1CA 1RCQA 5A8QA 1RA5A 3NURA 1C7TA 1FH8A 4MFDA 2WKJA 1W5QA 5B80A 3AJ7A 3WN6A 4ZODA 4KEUA 4C6KA 3UXLA 1XRTA 1GVRA 2ZUNA 3USZA 3B9OA 4JYEA 4NZ3A 3L65A 4O19A 1BTMA 1WUEA 2V63A 2D69A 3TYDA 1Y65A 3SZ8A 1GONA 1BEUA 2AAMA 2OWXA 2OGYA 4BS0A 1NIUA 1UOKA 1JZ2A 1JPHA 2PDJA 3IRDA 3VDCA 2ZUMA 4MY8A 5I3KA 4UMAA 3MZNA 3UGVA 4Z2HA 3QMTA 2WSKA 1O94A 3WYZA 4KRZA 3LB0A 3O15A 5CPSA 3FK4A 3L0NA 4RDZA 3BLOA 3KBJA 3EA2A 3GBDA 1QPOA 1QOQA 3SI9A 3AALA 3PJWA 4LRSA 3SCVA 1JQVA 3S0CA 3GKAA 3VFLA 5F4WA 3B0UX 1ZBWA 2Q3RA 4GZJA 5HK4A 3TTYA 5K9XA 3GK0A 4DXVA 2B7PA 4LVBA 4QCEA 4NZFA 1AQHA 5D8WA 5HINA 3SIZA 2V5LA 4A22A 1QBBA 2YB4A 3DUGA 1MWOA 1W9UA 3BUVA 4I6VA 1YLVA 1RPKA 3VYLA 4NI8A 3EOSA 1VFTA 3EOLA 3M7WA 2GFTA 4M7SA 2QVNA 1I8JA 3LSCA 4OZOA 3QOKA 4GI4A 2GVGA 1TTPA 4EWND 2ZDSA 1V0MA 3GTHA 2DZUA 4DXKA 4FR1A 3W84A 1C8XA 4TR9A 3N9RA 4AC7C 2IPGA 2O9TA 3PBYA 1JI1A 3TJLA 1Z89A 4GQRA 5HJXA 1SPQA 3OBKA 4Z0JA 4Q6JA 2V5KA 4E8DA 4LPCA 1XISA 1LOSA 5XIAA 1W0JG 1S46A 2HEJA 3EOEA 4JN6A 2BVTA 1QVBA 3MTWA 1OIMA 3EWCA 3VZYA 4HPNA 3BMWA 1E56A 4IJCA 2V69A 4BCEA 3PUEA 2X30A 3AXHA 2WSRA 3I7RA 3WLQA 1TYGA 4NZ1A 3NEHA 1P43A 5ECVA 4ATWA 1ZCOA 5TF0A 3LV6A 4AWUA 1CECA 5FF4A 2VC9A 2ZA3A 3QH2A 3L7RA 3WQ5A 1L6YA 1KBJA 1ZNNA 1XIDA 1PB0A 1CTNA 3RJYA 3W7GA 6REQA 2NQ5A 3P80A 1V6VA 5DRIA 5CH9A 3TW7A 5BU9A 1TVLA 2Q8XA 1WXZA 1VFMA 3BO9A 4REQB 2ZX9A 3G6MA 3UQNA 1O5XA 1GVOA 3W25A 1PCWA 4RV3A 3RPDA 5JH1A 1EPVA 3W1RA 3V1HA 3WFAA 1JQXA 2Z27A 2OVLA 5E5CA 4NRSA 2G3FA 3GXMA 1PPIA 1IXNA 1PTAA 1QWKA 3I68A 2VELA 1RK6A 4PMDA 2C13A 4FOKA 1ADSA 2PI6A 4MUZA 4PFMA 2J7BA 3NSMA 4QE4A 1DTUA 1Z32X 1V3MA 1YHTA 2R1MA 2XH7A 4B5UA 1AH3A 3DI1A 2Y8KA 3W29A 2FHFA 2QQ6A 5D9PA 3AUOA 1F6PA 2PTYA 4U28A 5G5IA 1CCWB 4RJEA 1JCXA 4C6NA 1W3TA 3AICA 3HMCA 4UFKA 4JX6A 2QGHA 2JKAA 2OX1A 1UR2A 2GDVA 4A8IA 2POTA 1RJQA 3DKLA 3FA4A 4R53A 3U0HA 3HPAA 1A49A 1JCYA 4JQ2A 4H01A 5CLTA 4PE8A 2BY0A 1E0WA 1LM1A 1AK5A 2VC5A 3VOGA 1NDWA 1H63A 2XH4A 2RAGA 3UEQA 4FNTA 4H6KA 5E09A 1UBPC 1E4IA 4O1BA 1QW9A 2PTDA 2QXWA 2WC3A 2GL5A 2BSLA 4GNJA 3F03K 1ZRQA 3CQHA 3LBCA 4TVCA 3SRHA 1FH7A 2ASHA 3BURA 1B3XA 4JTIA 3IS4A 3NDZA 4GXWA 1PL9A 3RM8A 4GJJA 4E8GA 3OVQA 3NXFA 4FI4A 3HPFA 3VGEA 2GVYA 4JFWA 2QYGA 2H9AA 4Q4SA 5F2IA 5C2XA 1A80A 1N55A 5GQBA 3QY7A 4XTDA 3S9ZA 4LAUA 2ZRUA 1GHSA 3WNOA 4P5UA 3VD5A 3MY9A 5D04C 3WLOA 3DFYA 3A47A 2BVWA 3Q4DA 4LGXA 3ZJKA 2INZA 3SB0A 1JF5A 4MF4A 4G2DA 2G3MA 3C3NA 4AVOA 2GQ8A 1A3WA 3H6OA 4YHGA 1BG9A 4F2BA 3LTSA 1WAWA 4LYKA 3UWUA 1K8ZA 3W1MA 2BVYA 3MUZ1 3OO2A 2QPXA 1J12A 4NZ5A 4K37A 2TMDA 4EF9A 3ITGA 2Q01A 4QFUA 4XAYA 1C8QA 1OFRA 3NZ1A 3EKGA 1GOXA 1OD8A 3UGRA 1XPGA 3IGSA 3OLGA 3WY1A 4HJFA 3GHRA 2TYSA 4FA3A 2WMIB 2I9UA 4WY0F 2PMQA 1OFBA 3THQA 4CQBA 3BPWA 5G2IA 4Y9NA 1OF8A 1H41A 1M6JA 2DZBA 3CHCA 4K39A 3OZYA 3TH6A 4PMOA 2P3ZA 3KOWA 2GSEA 1RSCA 2ON3A 1J10A 2J13A 3P60A 4B9YA 3GXPA 3IGXA 1VLIA 2BXZA 4GBDA 4Q6XA 1W1ZA 1DXEA 2EQDA 1PZ2A 2J9YA 3C0JA 1Q4WA 5XIMA 3ZM8A 4JX5A 4XIMA 1W1IE 3C8FA 1U5HA 1V3KA 4LTSA 4AZ5A 3UWVA 2PRMA 4EAMA 1IWAA 2OZ8A 2W91A 1YXDA 1MFUA 3QR3A 4Z1BA 3W76A 4GNKB 3KVKA 5C55A 3MI6A 4IOTA 3ZWSA 1T0OA 4F2TA 3RNDA 3IUHA 1UA3A 3H2FA 4W4QA 1EJRC 3LQGA 4GKLA 1AVAA 4FLRA 3WO8A 1AH0A 3BQ6A 2H6RA 1A4LA 2GOKA 1R3QA 5DT7A 5D2YA 2L5HA 1LLZA 1EDGA 1VC4A 4UMCA 1CGYA 3VZXA 1AQMA 1OFDA 4I8YA 3CMJA 1J6PA 1ICSA 2FJKA 2QJJA 3LCHA 2V38A 3PBGA 4JY8A 1SO5A 4I9TA 3GX9A 1AMKA 1WOBA 4JTCA 4J2PA 2G37A 4NNBA 2B4GA 3G77A 5A3HA 4HN4A 3IVTA 2EPMX 1KM5A 1PE1A 4GYKA 5I3GA 4TU1A 1HKVA 2WCSA 4R7JA 1CGTA 1A5CA 1QJWA 2P53A 2XTKA 2ZIDA 5D8ZA 4KWOA 4IT1A 7CGTA 4X61A 4EXBA 2QF7A 3FKRA 2OYMA 2ZZ7A 4S3DA 2V68A 2ZUSA 4PUEA 4DJFD 1C9WA 2X0HA 2DW6A 2XOKG 2ZRWA 3MSYA 3EMZA 4DWDA 2XN1A 3FYPA 1CXHA 1UASA 5K9CA 1V6TA 3TEVA 1ZFJA 3S1XA 5CJNA 4GJ1A 3DHUA 3UVAA 4PUWA 4E2VA 2EPNA 3FN9A 4HN8A 4A8LA 6XIMA 4JN7A 2QUTA 2QJHA 2J88A 2E9LA 4PCPA 3STEA 3SECA 2G4FA 4D6JA 1GEQA 3V1PA 2P0IA 3ARTA 4Z1AA 3B9NA 4I7WA 2YL9A 4HA3A 1LBMA 2F9RA 2FTYA 2VP8A 2WZTA 2DUAA 3PPCA 4AZ7A 1QDSA 3MV11 3XISA 3SY8A 3SCSA 3C56A 2QULA 5I5RA 2OPJA 3SY1A 2ONEA 1YTEA 4ASTA 1TPVA 3L4UA 4G56A 4AZBA 2GQ9A 3DYOA 3MSRA 1DJIA 2V5CA 4WSKA 5IFPA 1WCGA 1KC7A 3TFCA 2CZDA 4D1IA 3WBYA 2FVLA 5AC5A 2E5BA 3AYTA 1LOQA 1ME8A 4KERA 2QIWA 4C6CA 1SFLA 3K8KA 4JKMA 1XCWA 3HURA 3DBNA 3QTPA 2QDGA 1CLXA 1GTEA 2AL1A 3WLNA 4JKKA 2PRHA 3P82A 1KXQA 3MJMA 1M01A 2YCIX 5F7UA 3W7EA 4LF2A 1DWFM 2YKKA 2WJFA 4A4AA 2XZ7A 2A1YA 2VD8A 5DQPA 1XYLA 1Z69A 1FCBA 3PG8A 2NQLA 2YCJA 5BOEA 3FFSA 2QIIA 4L64A 1PX3A 1L2UA 3Q65A 3QPEA 1ONWA 4ONVA 3AS2A 7PTDA 4JICA 4MYAA 2OOGA 2WOQA 3W07A 3E49A 1ONXA 4QHRA 2OSXA 2G95A 4GC4A 3PBMA 3GVGA 3CAWA 4XVDA 1PYMA 4RXFA 3SUSA 4JN8A 4C91A 2X40A 2YA1A 1E72M 4PODA 1SJBA 3BAYA 4DUVA 4DO6A 1IHIA 3URAA 4URIA 1J4EA 3OA3A 2C16A 3R1ZA 3PBUA 3P81A 3E5BA 2PC8A 2QDEA 7ODCA 4O8RA 3KEHA 2E8ZA 1P7TB 4DZHA 5LIKX 4IHCA 1SFJA 1GVQA 3DYPA 4RE4A 4DBUA 4IF2A 3L12A 3H2NA 5C9WA 4CD7A 3WJWA 1W17A 1NWUA 5A2AA 3BL3A 2NSXA 3IUIA 2QCDB 1UWRA 6XIAA 2J27A 5DEZA 3AS3A 3L66A 4QAWA 3KRUA 1F07A 2VGBA 3N9SA 1MRAA 4XZ9A 3GRIA 3N18A 4EK7A 3EXRA 5E93A 1XYAA 4B15A 3UA3A 5DF0A 1V51A 2WANA 4JTFA 3ZIZA 4F0LA 3OIXA 3CL8A 1BG4A 1M1BA 5CAKA 4B5SA 3RN6A 1FKXA 4NRRA 4CD5A 2C1GA 4ZTYA 4DJFA 3AXXA 3LXBA 3P6LA 3KBWA 4LEQA 2Y7FA 5D4YA 1NM9A 1ITQA 1JJKA 3TYCA 3GDKA 1CWYA 1JFXA 4AW7A 5HMSA 3NQ8A 3OBEA 1NARA 3O16A 3WEZA 2QJMA 2YIHA 3I6EA 2W27A 3QPZA 1XDJA 4MKSA 1E4MM 2GOUA 3PN8A 1H51A 5AHLA 4MJMA 3R7MA 4WXZA 4CCZA 3GO2A 5LKYA 1KRMA 1W1A1 4PBGA 1UR3M 3WFLA 2GJXA 4DVOA 4FXFA 1ADOA 2BY2A 1I0BA 3T78A 2I16A 2VEIA 3AISA 1J0KA 5BXSA 5BXPA 1K9EA 4Q8TA 3G3DA 5AB3A 3TFXA 3D46A 1IT8A 5DBTA 2R82A 4A2RA 2Y0FA 2XGIA 4AC1X 1VF8A 1VGAA 4ZO9A 5MF5A 2OQHA 3BGAA 1JD7A 2XIIA 3KW3A 3QW4B 4IMDA 3WLIA 2ZRXA 1WBJA 4MG4A 3SADA 3QGAC 3ZLFA 2WV8A 4PCSA 2VEGA 5EYWA 4OBRA 4L7ZA 3LLDA 3GFYA 1Q4NX 3DBPA 4X9YA 2D3NA 2QW5A 3G1RA 2CBVA 1POJA 1U83A 2WXDM 1GVSA 1XRFA 3AMLA 1X6UA 4KWVA 2YXXA 2YBUA 5D32A 1HO1A 3HGRA 2PTWA 1JI2A 3ABQA 3M5VA 2DH2A 5C6MA 5JQ9A 1UZ4A 3NGFA 4PSPA 3F2DA 4AY1A 5C9RA 1GKPA 1RCXB 1Q7QA 1IYXA 1C91A 3RUBL 3DN5A 1Y0EA 5J8LA 3IIVA 3C2EA 1XDMA 2C91A 1T7LA 1X1ZA 3P74A 3M47A 1M3UA 3W0KA 1MW1A 3P93A 4HK5A 4Q3MA 1FWDC 1O66A 2X0SA 3H2MA 3GDMA 4RDVA 1NSJA 3VGFA 4H00A 3W02A 2OCZA 4O1CA 3TJ4A 3FSUA 1PTGA 5MKGB 3CTLA 3SN4A 4K8HA 4KS0A 4XD5A 2D23A 1NJJA 1ZBCA 4ZCWA 3LMYA 4PMQA 1HJVA 5LHFA 5E1QA 3W1UA 4I90A 5C5YA 3ZFHA 5H8MA 5CZ0A 3F1QA 1IT0A 4DELA 3K46A 3NL6A 4TUFA 3UNTA 3T4WA 3MMDA 4MHBA 3Q2DA 3UZYA 1TV5A 4DI8A 2V3DA 4GC3A 1H2JA 1VEMA 1DJZA 2FGLA 4H9ZA 4PMRA 3SCUA 1H49A 1XD0A 3LGEA 3NZGA 1A53A 2IPWA 4PFHA 1ISWA 1VFSA 4OIFA 1YNQA 4LUIA 3A24A 4PL2A 5HAOA 2PP0A 3KCOA 3S6OA 1ODZA 4NZCA 3CLWA 2ZXQA 2P8CA 4GGBA 4KKXA 1QXLA 3I4KA 3QV9A 4CD6A 3I3BA 4BWLC 5D30A 3ABRA 1JDEA 4K36A 1RP9A 3H12A 2NQHA 4Z2GA 4DI9A 4FXSA 2ZUUA 4AHOA 3PBWA 4NF7A 1FWGC 1P5BA 2ZX8A 2CWNA 4GYPC 1V6XA 3VNDA 1W3KA 2TSYA 2NW0A 5AKQA 4QSHA 3OTRA 4JQ3A 2QCDA 4RNJA 1P0DA 4DBWA 1MFVA 3W87A 3SY5A 3EKLA 4ADTA 4Q4QA 3WLJA 5AZ1A 4TIMA 5JBDA 1UPMB 5G4HC 1MMFA 1QTWA 3A9IA 2W67A 4L9ZA 5JBEA 3FVDA 4E3VA 3VIMA 3TSMA 3TC3A 4LYRA 5A6MA 3PULA 2GJLA 4KMQA 2PFHA 1TPB1 3NQEA 2CNCA 3SJNA 2ZRYA 4QLJA 4WSJA 1JYWA 1V02A 5BU6A 2J75A 4Z1CA 2ZTJA 4YTRA 2J7HA 1K6AA 1XD1A 2I7GA 1DJXA 3DAQA 3GM8A 3M5ZA 3WDPP 2X7WA 2WW5A 5FOOA 2YX0A 3ABXA 4N9BA 3UETA 1R9ZA 1XLEA 4AX7A 4FNSA 1OD0A 4MPQA 3S1UA 3UESA 3O2LA 3GTNA 1X1NA 3EPOA 5A6BD 2XFYA 4N7QA 1J01A 1TG7A 3CZ8A 3CEPA 4F0SA 1LWHA 2OLAA 4GH3A 1TPC1 1WXJA 3L5AA 1P0EA 4M29A 2DT1A 1EC7A 2CW6A 2ZZ3A 1TV3A 4D2JA 4MNMA 3SRFA 3TU9A 1RJPA 4E4FA 4CNNA 3QEZA 4BF7A 3BANA 4HQVA 3RFAA 4CEUC 4BWLA 2JEPA 5AYIA 3G22A 1Z48A 2C0HA 4O53A 3D47A 3WLPA 1R3TA 4D8ZA 5FL0A 1OGBA 1VJZA 1H7PA 3N2MA 1ZENA 1IXPA 2GWNA 1YBQA 4AB4A 2GYIA 3CIXA 5GNYA 4P7OA 5G2WA 4OOUA 1XLFA 5E0FA 5HMDA 4B4HA 4IMFA 3VMPA 3E74A 4I7VA 3B06A 3G0UA 4GQGA 1XW8A 2QCGA 3CNYA 3BVJA 1U1HA 3WKZA 2BX7A 3WNPA 3QGKC 4A29A 4LUSA 2YBVA 2FB2A 1QW7A 2FH6A 2V2DA 2Y70A 1W5PA 1UR1A 1WDRA 1WYIA 2YGYA 1BWLA 2Z4GA 5KSWA 3URQA 4LQ1A 2X42A 3R11A 3SCQA 2EBNA 5CQ1A 3UR8A 3GVVA 1E5JA 1UP3A 1XIEA 1UJQA 3LGDA 4IH3A 4PYSA 4IPJA 1EJUC 4CQDA 4C1NA 1QBAA 4RE3A 4F0HA 1QI2A 1P48A 4XZNX 4B91A 1ITXA 4LUSB 1WV2A 4X0VA 2CZ5A 1RVKA 4H9UA 3OVRA 2VOMA 2OYLA 1XRVA 1GYLA 3WNMA 3BSMA 2IKIA 3GTXA 3R12A 4ZFCA 2SFPA 4M6UA 4P8XA 1CXFA 1A5AA 1HKIA 4HGXA 2G50A 5EKYA 4JY9A 4LEFA 1UB3A 4LC6A 4QG6A 2ATSA 3FJ4A 1EJWC 1YNYA 3CUGA 2OKOA 1SR0A 3HM7A 3GXFA 3C2RA 1E6QM 5HMEA 1N8IA 3ITCA 4F9DA 1R47A 1IEWA 3VINA 4DWSB 1QW8A 1OX6A 1J6OA 2CXGA 2RKXA 3BAJA 2BY1A 3AROA 1NWTA 3PZNA 1FXQA 1V0NA 3H4GA 2PWGA 1K8XA 1F2JA 1XGZA 4WGHA 4C6BA 3PWGA 1MNZA 4Y9MA 1W5MA 3MKVA 4KFPA 3P2VA 3FNDA 3M41A 3WLSA 4J7RA 4B2DA 4O15A 4D8LA 3WLHA 3LZ5A 3ZR4A 4M5PA 3H2AA 2D2JA 4PBFA 3LOTA 4YNGA 5I03A 3M6DA 3ZOAA 1SW0A 2EPLX 2XWEA 4J2MA 1KCLA 3T2PA 4Y90A 2C7FA 1QNQA 2NXGA 5FAGA 1SQ7A 1S2WA 1TTIA 3BMXA 1SJDA 4TX6A 2PDLA 5JUVA 5CGMA 1ZCCA 3CAQA 3R79A 5LZLA 2WJZA 1T5AA 4E8CA 1XLHA 1XHGA 5I3DA 4XTIA 3ALFA 4AX6A 2VZTA 4TQTA 2DJXA 1IIHA 1QPNA 4IWWA 3THCA 1UD5A 4HA4A 1F73A 1I60A 3LNMA 1H0GA 1E9YB 2PGRA 5D2TA 1W8SA 1DJGA 3BH4A 1DJQA 1SFTA 2IPFA 2E9BA 2XSXA 3WH9A 1HQTA 3EX1A 1XIBA 3AIUA 3VCNA 4H1ZA 3WH7A 4O1EA 3M6YA 3EDKA 1NFPA 3WJYA 2ZFAA 3TV8A 1VQTA 1H61A 4HYRA 3WK1A 2FVMA 3TNBA 2PWHA 3SBFA 4P7QA 4NP7A 3S5OA 3VNKA 1W32A 4EXQA 5A2CA 1J0IA 2X7VA 3EX3A 1CENA 3P61A 1QUMA 1TZ7A 3N19B 4M8UA 4W8LA 4KIEA 3TMLA 1SW7A 4KRTA 1XSJA 3OPSA 1FWTA 1ECEA 3FAXA 4DN1A 2IMRA 3DC8A 2JKEA 4IFKA 4GYJA 2PWFA 3O1NA 2ZWZA 2CLIA 3K2GA 1CYGA 1XPYA 3S6TA 2WNWA 1D3CA 1EEXA 4IZGA 3W3OA 1V7YA 4AZCB 3DXIA 3UCQA 1JZ8A 2BLEA 2D73A 3W2KA 3TOPA 1KB3A 1K1DA 4PMUA 4P8VA 4J4KA 3IARA 4X2PA 3OEHG 1VS1A 4H8UA 3CAKA 1SZGA 1J0ZA 5I07A 1QPRA 3CL7A 3AAMA 1UR9A 1Z42A 3UY8A 3RX2A 1KM0A 4RKAA 6ALDA 4JTGA 3MWCA 3W74A 3ANYA 2NV9A 1H7NA 4K2SA 4JBRA 4H9YA 3MVIA 1GQKA 1VRXA 3GAKA 4GOAA 2DV0A 5EBUA 3W73A 4GI8A 2WC7A 1KCXA 2XN0A 4QR6A 4R3UA 4H7ZA 2DZVA 2INEA 3PWIA 3FVMA 3W7JA 3RDKA 4PTWA 1E4LA 2VEKA 1YPIA 1VP8A 1NOUA 3W28A 4UTTA 4WEVX 1ZY9A 1NF0A 4C5YA 4NJJA 2VDGA 2ZE3A 4QCFA 5EFFA 4W84A 3LDVA 5BMWA 1EDTA 3RCMA 4OT7A 4IIFA 4OHQA 1RD6A 4R9OA 2YL8A 2QCCA 3B0XA 4A35A 3ID7A 1J93A 2NQZA 3NDYA 4K8EA 4TVUA 1REQA 1K70A 2YL6A 4DPQA 3BW2A 2P10A 3T6CA 4UUIA 1AL7A 2O4MA 5A2BA 3L4ZA 1EJXC 4QDMA 1W9XA 3OVPA 1IEQA 2JF6A 4JTEA 2KX9A 1B90A 4V1XA 5H6HA 2E1WA 2NLIA 3VD4A 1ISZA 4ZO8A 4JTUA 4FOUA 1E4NA 3A21A 3DENA 1HUVA 4MKVA 3PZVA 1VBJA 3KZSA 4HOZA 4RPQA 1PHQA 4O12A 4ACYA 2Z1KA 5LGXA 1EWDA 4X63A 3K4AA 3DU0A 3W23A 1QT1A 2HE5A 2NX3A 3E3HA 2YA0A 1UHVA 4M80A 4RE2A 4S1FA 3A64A 2VYOA 2F8QA 5FESA 3OG3A 5FSEC 3BOXA 4AH7A 4QQUA 3M64A 4ACZA 1R9YA 3GTFA 1N8FA 4V27A 1FHVA 1A3XA 3COTA 3VKBA 3WFZA 1UW9A 3CXOA 3GDTA 5AN7A 1GGOA 1XG3A 1GVEA 3W1PA 3PPFA 1TCMA 2XIJA 2WBGA 2VRQA 4HNUA 4ZQMA 4JDYA 1BVWA 1MRQA 3CHFA 1BRLB 4AD1A 5G1TA 3STFA 1MEHA 4S3AA 1OZQA 4QP0A 5CGTA 1RV8A 3ARVA 4DHGA 2VWSA 1LZOA 4UFHA 3LYEA 3TTSA 4LUTB 1CX9A 3E1F1 4QJ1A 3NO5A 3CWNA 3S9YA 4ATLA 5BRPA 3OIHA 3G1HA 2CBUA 4ILSA 4JIPA 3WJXA 2AKMA 3H53A 4HPXA 1PAMA 2HJPA 2V5BA 4O1FA 4I5XA 5A6JA 5EB8A 5CLWA 5EMKA 3BGJA 2EG6A 1TPEA 4RZ5A 7TAAA 2XSBA 5A8NA 3N4FA 3T0BA 1JAEA 1GQNA 1VH7A 4FOJA 4GA8A 4FO4A 3WSUA 2YCKX 1XLKA 1S2CA 1G1YA 3SQMA 4KGJA 4I9JA 3CMGA 4PTNA 2ZX7A 1TREA 1G67A 1XH2A 4MWAB 3FX4A 3AOFA 4WHBA 5FEZA 1D3GA 2XNDG 5A1AA 4WR3A 2IKHA 2QT3A 1J8VA 5BWAA 3LCGA 3MP3A 4P2VA 4ZOCA 3NSXA 3NIYA 1WZMA 2ZQ0A 3W7IA 4DLFA 2NXHA 4MPKA 1B3OA 1ZHAA 3UY7A 1VENA 3KOYA 3RM4A 5A8MA 1DV7A 2Y7EA 3LCFA 1C8VA 1XLLA 5E70A 2YW3A 2D0HA 1BSIA 1TKKA 1XINA 4HB7A 3AXIA 5HWJA 1SR9A 3IK4A 2FPTA 3MVTA 4Y96A 2UBPC 4JHOA 3VIHA 1DQXA 2DEPA 2VURA 3T2QA 4HU3A 1X8FA 5BRQA 3UZZA 3P5YA 1TQJA 2DP3A 4R88A 2FTWA 5I24A 5D2VA 3MT1A 3M4HA 4HNNA 3W7OA 1R3VA 1SM9A 3DIPA 2OT0A 4PUDA 4CVWA 2I57A 3ITVA 1FDYA 3DGRA 3AXMA 4BY3A 2Z0IA 1GW1A 2YLLA 3ISIX 4QE1A 3P67A 3NZQA 4HHMA 4FLOA 4KEMA 3KHDA 7REQB 3UP8A 5AECA 3KZPA 1ZAJA 1ZJIA 3B05A 2A3CA 1I2OA 1OBAA 4ZOAA 3DHFA 2PDBA 4O28A 4EAYA 2FIQA 1WZLA 5E9XA 1WKDA 3RX4A 3APTA 2QDHA 1X1OA 3P62A 3K8LA 4P8UA 4DUXA 1GEHA 2VNCA 4ICMA 3IGHX 5CSYA 4HSHA 4J9JA 3V4BA 2MUCA 3QV6A 1Z8AA 1N2VA 4KBXA 1HGYA 1J11A 4QXIA 4F79A 2ALRA 1C7SA 4CGTA 1EHAA 1B3WA 5A8GA 4J3VA 2A3EA 3B8UA 1T8QA 2B0MA 1JUEA 2PDKA 4IL0A 4XZHA 3EWXA 1IEVA 3QZAA 2WZEA 3TCEA 1MDLA 1UD8A 3W1NA 2BS9A 3LPGA 4ERIA 3VGHA 1WBHA 3NQMA 3RITA 3I6RA 1E9LA 3XINA 4LUTA 1FWEC 5EY5A 1QRQA 1H09A 3VOJA 1ZPTA 2VJXA 1NQ6A 1VLWA 3TYAA 5KITA 4MZYA 3UNDA 2GVJA 4L6DA 4E2BA 1BQGA 2YFOA 1EQPA 3IK2A 1UH2A 4M24A 4C6FA 4C6MA 1OSEA 2XH0A 3TLQA 4XKYA 1FBAA 3P0WA 1HJSA 3RILA 1PZ0A 1K4HA 3KE0A 2BMBA 3M0ZA 5I77A 1H5YA 3WF3A 1TWDA 3NL3A 3OQEA 2QDDA 3W1TA 3PSVA 3FW6A 3QR0A 4DPPA 5LA1A 4IMEA 1HFBA 3GVWA 3H26A 3YPIA 3GAYA 1L6FA 3V0UA 4XZMX 4A2SA 1WNOA 5LXXA 4B5TA 1VIWA 3W22A 5DMMA 1MI3A 2P50A 4LVGA 4E2OA 1EGMA 3VKJA 3LI0A 3WK3A 2GJNA 4UNKA 6A3HA 3B8SA 4UNIA 3PS7A 5HNTA 2GJXB 1TIWA 3VI2A 3LPFA 1US3A 3U6WA 4C6QA 5FJOA 4LY8A 3CV7A 3GZAA 4LWWA 4F3HA 4J3UA 3NPXA 3PTQA 4C6LA 3K13A 4L80A 1YXCA 3GS6A 1VBUA 4WKHA 1W8GA 5I0DA 2EKCA 4HIBA 1OFEA 3VK5A 1DIOA 4NAFB 3DHPA 3IGUA 1MDRA 1B5TA 4DM2A 2BFGA 4BEQA 1D8WA 2NLYA 1PEZA 3QXBA 1BGGA 3E6EA 3G1SA 3IJIA 4AG0A 2QUMA 2Z28A 3DZ1A 4HZ7A 1JULA 4LS0A 1UKQA 1YQ2A 3M0MA 1WQ5A 4FIQA 2D20A 4MUPA 1TR1A 3T1GA 4LB4A 3E0LA 2Z1WA 2J8GA 1OGGA 4WRHA 1KM3A 3R8RA 1CGWA 1S1PA 1MZHA 2WCAA 3H2CA 1QCWA 5CPOA 2ZYFA 2G3IA 4IJBA 3LTPA 3PR2A 1V08A 2CLPA 4H6EA 3SAZA 5AVNA 5A6SA 1AMYA 2QZRA 1M41A 1ZBKA 2H8XA 1R9XA 3H21A 4B3LA 3PB2A 3TDFA 2Z1SA 1N7KA 1YTKA 3GG7A 2YL5A 1H7WA 1KA9F 3S5NA 3PP7A 2VFIA 2OZ3A 3M0VA 1C3FA 3NQFA 2A85A 3UPWA 2Z2AA 4RW5A 1XI3A 4FLQA 4ORMA 2E3ZA 4JTSA 2WAGA 3VOFA 4DY1A 5AHFA 2Z00A 3TK7A 1XLCA 1SU5A 4F0RA 2YCEA 2CLLA 5JU6A 2WMJA 4UR9A 3WMSA 3W1LA 1KNWA 2XG9A 4TT3G 1VB9A 2OEJA 1DHPA 3LRMA 3BGGA 1CDGA 1G69A 5ABFA 2EO7A 3BICA 4Q4KA 4UBPC 1VCVA 4WY0A 1S39A 2WVVA 3II1A 3IAQA 5RUBA 3RAOA 4GY1A 5TD4A 4RZBA 1EHNA 1L2QA 1FDZA 3WD4A 5IXEA 4CQAA 4GFSA 1GYMA 2PODA 3DFHA 4QGCA 3BSGA 3ZT5A 5F2MA 3UG5A 1B4EA 2IQ0A 1Q6OA 1KFJA 1LL6A 4QJ4B 1R8LA 3AIRA 2GSHA 2GLKA 3GH7A 1Q6QA 4C6OA 4ML4A 4CCCA 2GWGA 1RH9A 4H9XA 3DFNA 3QY6A 4IPPA 3NO3A 3R6IA 1AJZA 1TRIA 4J28A 4OVXA 3LCXA 3VKKA 4DF2A 1LQAA 1RLCL 1ML1A 4BFAA 3KX6A 5FJPA 4TTGA 1FRBA 4JXCA 1ECQA 2DSZA 4DUOA 1UC4A 3GDLA 2Q8LA 3UJEA 3GVQA 1BFNA 1Y8BA 4GG9A 1JCTA 4OE7A 4G9PA 5FSDC 1US0A 1UD2A 2ISFA 1C93A 2IXUA 1FUYA 3W81A 3G1FA 3ZSSA 4UOZA 1C90A 2VDIA 4QJ3B 1EOKA 3H7VA 3FS2A 3DDMA 4XO7A 1H62A 1H1ZA 2W66A 3DG3A 1T41A 1V5XA 1EUNA 4DYJA 3GXIA 4AD4A 3IJ6A 3N6JA 3M0XA 2VENA 3DH7A 2EKGA 3VE7A 4NVTA 3WH5A 2OTDA 5FJJA 3AHXA 1GOKA 4O13A 3CYVA 1GOIA 3ABZA 4HHHA 2NUYA 3B4YA 4FK9A 3MB9A 3BE7A 1RCOB 1XBXA 1XDLA 4JFVA 1OM0A 2Y8VA 3AIBA 3NQDA 2V5DA 3KRBA 3A4JA 3UYCA 4MMWA 5BXTA 3CASA 1F8MA 5A69A 1JZ3A 1QNOA 2AQWA 2OODA 5CZKA 1Y7VA 4JCMA 3CWOX 5IHSA 3V5OA 4IIDA 3W7LA 2VC7A 1NP0A 3I10A 3RLUA 2ODOA 1H1NA 3S47A 5KMYA 1PV8A 2PE4A 3N9KA 5AHNA 1E73M 1XYBA 1PYFA 4HP5A 3LA4A 3B40A 4NT0A 2NWRA 1K7EA 5ABTA 2ESCA 4NJIA 4AMAA 1EZ2A 1PKMA 3C52A 2GQAA 3THDA 2ZXAA 3GYCA 3S2LA 3CUJA 4HPJA 5DN6G 1IXQA 3E2RA 3OYZA 3B8DA 3L4WA 3F2BA 1TB3A 3C0QA 2HV5A 4JCLA 1UC5A 2PTXA 4O16A 3FJNA 3VIKA 2QCMA 1MXSA 1E79G 1FY6A 5LYRA 1WXYA 4NJHA 1X98A 3G1YA 3N2CA 1NDYA 5B7YA 2VX7A 3RPTA 2DVUA 1YNPA 1VYRA 1WOAA 2R9RA 1R3RA 1FXPA 2A4AA 2R24A 4LBUA 2Q02A 1GG0A 3G1VA 4P7RA 4GFIA 3HQPA 4MNLA 3PANA 8RUCA 2OEMA 3KP0A 3VPLA 4Y6GA 5AVHA 1A0EA 1H11A 2WMFA 4HHPA 4W88A 1XYMA 2NWSA 4RDWA 1J2BA 2DJLA 2I5IA 2G3JA 1O68A 1YMYA 4DBSA 3U3HA 2WQDA 4BKNA 3PPHA 3VGDA 4PA8A 1GTHA 4O57A 4W93A 5FACA 1IEXA 4ML9A 1ZB5A 4E4UA 5AC4A 4RXGA 1J18A 4XAPA 3KUMA 3OFNG 4JKLA 4M56A 3MUY1 1VRDA 4C7DA 4HMEA 5M03A 1BYCA 2EXOA 1NOFA 3ARRA 2RGLA 3MC5A 5CSRA 4IIEA 4L1GA 5HNUA 3L0GA 3ENLA 1GVIA 5D05A 1E6ZA 1JRBA 3BOLA 1TV7A 1ZJAA 1UA7A 4I6KA 1QOPA 3NO1A 1TUFA 4MTVA 3S83A 2PGFA 2C71A 4TO8A 3SQSA 5FD0A 1PS9A 4IUOA 1YADA 2CHNA 3L68A 5JXQA 1B9BA 4FIRA 3WF0A 2WC4A 2CCRA 3IIXA 3RRAA 3NAVA 4U4MA 3NUKA 3KTCA 3PUOA 1RHCA 1D7FA 5KZMA 2Z6IA 4LNCA 4GGHA 3MYOA 4JDBA 4E2DA 4GUIA 1R87A 1VEPA 4F8XA 2W0UA 5M3WA 1PIGA 5CJMA 3V35A 4YXGA 2GQ3A 3QHNA 4US6A 1UUMA 4XWUA 1ME7A 1K4GA 4Z2JA 4B2DD 5DFAA 4H2CA 4AFYA 3L5MA 1ZZMA 5A6TC 5DRCA 4KFOA 5A5WA 4XZLX 1DKWA 2WPDG 4LAMA 3TSBA 4NZJA 2GPTA 4JNZA 2QVHA 4EVZA 4M6VA 1GKRA 1FP9A 4UFMA 5EMUA 4LUJA 1W1PA 3SGGA 1VYPX 2C1IA 2YA2A 3MA8A 2HNHA 1CXEA 4GVGA 4C1LA 1EIBA 4I5UA 4JTJA 3CQKA 5FL1A 3VIPA 3S1GA 2UY2A 5C9ZA 3UZJA 4GCXA 1I2RA 3RLGA 1OYBA 4PTXA 2VX6A 3CHDA 1Q8AA 3K5XA 1X6LA 3KWXA 3AWNA 1GUVA 3NPUA 5HR7A 3V0SA 1WDSA 1V3JA 2V30A 4HNTA 4I7UA 5FI8A 2PBOA 1TMQA 2C19A 1FQ0A 4PCNA 2EG8A 2VEFA 2DSUA 4H9TA 1TQXA 2P88A 2DVTA 3QM3A 3HPXA 1K6WA 2QR6A 3KFTA 2YDSA 3LRLA 3O6AA 4J3ZA 5E0KA 2OQLA 4CQCA 1QI5A 2VI0A 4N02A 4L1WA 3REQB 2E28A 3VA8A 3U4AA 2WBKA 3TIMA 2G5WA 4AMCA 4IGMA 4AIBA 2UY4A 2VTFA 2DUXA 1AJ0A 4H19A 2W4XA 3L23A 2GZXA 1DIKA 5C7HA 4R5EA 2YYUA 1KQZA 3UERA 1EUAA 2VUNA 3VNLA 1H7RA 2BOFX 1O4UA 5AY7A 3RMEA 4DBEA 4BQ4A 1LRQA 2FZNA 1P1XA 2WSQA 1F4HA 1QNPA 1ZLPA 4U3AA 5TAOA 5U4NA 4D6GA 2EJAA 3DFTA 1OJXA 2I5QA 1KM2A 2F61A 3GXDA 2PD5A 1JZ6A 5U7SA 1TWZA 3PUGA 1G94A 3GW0A 3WNKA 3FHAA 1X39A 4V28A 5HUOA 2DZAA 1F8IA 4EPKA 4YYFA 2QUNA 1F3XA 3EWBX 3KCJA 3W6YA 2W62A 4UXDA 3M44A 3O06A 3EZ4A 3H7RA 4GI9A 3HQNA 3VD7A 2VZOA 3FKKA 4EANA 1IF2A 3APGA 4PUMA 2Q09A 1DHKA 2JJ1G 2AMGA 3N4EA 2HVOA 4WD0A 4M0XA 2VQUA 3GUGA 3W7QA 1A5UA 2G8ZA 3DHDA 3QZEA 2CHOA 1P4CA 5IHRA 4C5ZA 1WPCA 3H8AA 5BXRA 4NG3A 3B8VA 2J25A 3IACA 3WUGA 4GQ0A 1UCWA 2BDQA 3AJXA 4TXEA 3CUZA 2G3NA 4NSBA 4GUJA 2V6AA 4H8NA 5FF2A 3WQWA 5G1MA 5CPMA 5CXPA 1G4EA 4CCEA 1GCYA 1PIIA 2VKZG 4W85A 4A21A 3TR2A 5AZ0A 4YU1A 3S8HA 1FP8A 1GT8A 4NI3A 4BZYA 1KWKA 4HYVA 2W9MA 1FWRA 4PCTA 5BZAA 3EDDA 2Y5SA 1O7AA 3F4CA 4GRSA 4PC8A 1A5KC 4AD5A 3A4XA 4L61A 1UBSA 4XB3A 3UR2A 1QOXA 3FJLA 3MUXA 3VOCA 4S3JA 3RIKA 1YDOA 4RNFA 1I2PA 4CU8A 3UXKA 4POCA 5HQLA 2YOCA 3N73A 1XX1A 1X6NA 3WJZA 5CZTA 3ONCA 2CLKA 5T26A 3E96A 3CLMA 3V3WA 4US5A 3GIYA 4N4QA 8CGTA 4W87A 4AIEA 3AZSA 3WLRA 4FXRA 1IQ8A 3ARQA 1AQFA 3QVQA 4YTUA 2W3ZA 4RDYA 4IGSA 1VPQA 1M04A 4L4LA 2FHBA 4OU1A 1THFD 1QNVA 3BOFA 2Y6ZA 1JPIA 5BOFA 1VCGA 3ARSA 4C6DA 3C86A 5CSUA 1LT8A 1SJCA 4GVIA 4TSFG 4S2BA 5LIXX 2G41A 1MEWA 4PH6A 3R8GA 3VDBA 4O1DA 2WHKA 2RDWA 3ITOA 1NWSA 3N25A 1TTQA 1B9ZA 1C9DA 1GORA 4FP1A 3GU2A 1JPDX 1BRLA 1UH4A 3GNRA 4W7WA 1JDFA 1ZJHA 5HJLA 1AW5A 2R14A 4AVNA 3WMLA 4ZGYA 1Y5VA 4J40A 2OEKA 3UXAA 2CKSA 1PZ1A 2VVSA 5AYZA 4K7VA 4E3TA 3E0IA 1GZJA 1KW1A 3OZPA 5C9XA 3WQ4A 4B5VA 5HXMA 4DAIA 4P7LA 2ZE0A 3I3EA 5GJMA 1UG6A 4IPIA 3H2EA 1QNRA 1QWGA 1P6WA 4PRWA 3OJGA 5I23A 1RAKA 3NPWA 3B3DA 1LLWA 4PRTA 4CUCA 2DQXA 3FJ6A 1XH1A 1K9FA 1QK2A 3VABA 5FJRA 3A3XA 3OYXA 3HG5A 1WA3A 1I45A 1Q2RA 4K8GA 3N2XA 4P61A 5FIPA 1LP6A 3KP1A 3QYQA 1QNSA 1KFEA 4JQAA 1YE4A 3VX0A 2ZVRA 4O8AA 3DERA 2XM2A 2OWWA 4YMZA 3BZJA 2C15A 3RR4A 2PDIA 1H8EG 4F0MA 3OW1A 3WELA 1W3IA 4NAEB 3A9BA 3TTEA 3MHUA 4PTMA 1H7XA 5FF3A 1UR8A 2PDQA 1WDPA 1WKFA 2ATMA 1Q85A 2ACUA 4LT9A 3WCZA 4LBRA 1AG1O 2VM8A 1KKRA 3VE9A 4F40A 4MM1A 4NUWA 2BXVA 1S5WA 1FFQA 4PMZA 3GIQA 3NQ2A 1KLZA 2DH3A 3TN6A 1M5WA 4NHVA 4EXAA 3W72A 4FS9A 1IIGA 1CBGA 1W9PA 3S1WA 3M0HA 3ZJ7A 4GUHA 4HSOA 3CZJA 4QLLA 4WKAA 4G1NA 1XH0A 3T7VA 2HZGA 5K9DA 2YZRA 3M43A 3S2NA 4WXYA 4U31A 3EWWA 4QAIA 2ZRZA 1RY8A 3NL5A 3L4YA 2F38A 1TUXA 4MDOA 1MW0A 4EWJA 1KBKA 4QLKA 3O6YX 1XIHA 1M7OA 3MBDA 1J96A 4GLEA 3BW4A 2Z25A 5HJYA 3D6NA 3VKCA 3D0CA 2DZTA 4UZSA 1V0LA 2O9OA 4G1KA 1LJYA 1A3HA 3ARYA 4LJ3A 4B3ZA 1HP5A 1JFHA 4AZ6A 3K1DA 2G97A 4NU7A 2OO0A 3D3AA 4GUFA 4WCJA 3F4NA 2DSVA 3A12A 3VOIA 4JL1A 3WQPA 3HGJA 3TOYA 3STPA 5J5RA 1CT5A 1OT2A 1AZ2A 3GZ3A 3WD1A 2PB1A 1GPFA 3WQGA 1XLGA 4Q4PA 2UY3A 3UG4A 1MUMA 4PEKA 3E38A 4ZTXA 3E2SA 4BR1A 3LK6A 3W27A 3GG1A 1MQQA 3NCOA 3AMGA 3OHIA 4AQLA 1GZ1A 4PN2A 4RPPA 3DFSA 1F05A 5HMFA 1DWJM 3EOOA 4RW3A 2RHGA 3IV8A 4U5IA 3RGTA 1OG6A 2X1SA 2D3LA 3AHVA 3VILA 2O4QA 4O10A 2ZZ1A 3ZSTA 1NOWA 4UR7A 2J7FA 1RA0A 4GXMA 5AC7A 1JVNA 5DBUA 2NT0A 4S23A 4UC5A 1Q6DA 4MAZA 3LHUA 3KVMA 1EJVC 1PIFA 3HG2A 1RZMA 4WDXA 3AU2A 1TA3B 1QHZA 4FX6M 3MSGA 2ZUWA 4UIOA 2CETA 3OGRA 3OLEA 4L6HA 5BYWA 4S2CA 3KRSA 5CPLA 3KS6A 3FHQA 4XG1A 3DYMA 1G5AA 4W86A 1JDCA 4HPHA 1E0UA 1XF0A 3DECA 3O8AA 1E9IA 5D09A 3DX5A 3UPBA 4DIAA 4QISA 3GBEA 3IAPA 2FMNA 1N8WA 3TQ0A 1TJ1A 3S4TA 1H3GA 3UXDA 3EMCA 3FY1A 3ERPA 2BOEX 3OU8A 5ECUA 2PDWA 4PBEA 2ZUTA 1TSIA 3W7PA 5EMJA 4X9SA 3ARWA 2EHHA 1MUWA 4HU0A 4V33A 1FWHC 1HGWA 2E67A 4Q4MA 4J3TA 3LLFA 3LXAA 4JHMA 3L4TA 4HCHA 2F2KA 5DCDA 1GPWA 2A5HA 5A94A 1PBGA 4YCOA 2OSYA 1QI4A 2VCAA 2PDUA 1A0DA 2RJGA 4JFSA 5LNWA 3DEQA 1X7IA 4U2ZA 4UTUA 1PVNA 3TQVA 1GKQA 4PEEA 1LL7A 3NJ3A 4UTFA 3VM5A 2J62A 1B3VA 3ZLGA 4UTLA 5PTDA 3CS2A 3D3FA 1DE5A 2WB5A 1GJWA 4FLSA 4MY9A 1GQJA 3IJ9A 3ICJA 2V0TA 1HO4A 3EPNA 3WJSA 5XINA 3TJIA 3QJAA 4WUIA 1H5VA 3KL0A 1HVQA 3POHA 5H1WA 4YTQA 2HPIA 3OQ8A 4QTGA 5K4ZA 1R3WA 1BHGA 1TV8A 3QY8A 4JTHA 3SFKA 3U2OA 3ARUA 4MJ4A 3QKEA 2BP1A 4GVHA 1TX0A 3CZKA 2PDXA 4PRRA 2XHYA 3WBAA 3LPPA 4MB3A 3VUSA 2BGNE 3SQLA 2Y7DA 3T40A 5IM51 4REQA 1UQZA 4N4PA 3WK0A 2A2IA 3ANUA 2TODA 1OHLA 3EOUA 1HG3A 4BHYA 4OBSA 1M7XA 3GU1A 3A5VA 3U2EA 3L5LA 1UIPA 3WUFA 1E6RA 1TJ2A 1XC4A 4AAJA 4R9XA 4F48A 1K7FA 2HSAA 1RP8A 5DY2A 4OFCA 4GIYA 5F2GA 2XWDA 5BNKA 3ES7A 2INFA 3OP2A 1SO6A 1Z7AA 1Q7ZA 3TXVA 1F9CA 4ZB0A 1JXKA 4UOQA 5CSSA 2PU1A 1D9EA 4Q22A 1NH6A 3N6HA 4GNVA 3TR9A 3ZJ6A 1MUCA 4TV5A 4DJEA 2GK1A 4S3CA 1KRAC 3WQVA 4GY0A 1DWHM 4D6CA 1XCFA 4RNIA 1Q6LA 4J27A 3A3WA 3GY1A 4YIWA 1UWAA 4KCVA 4WIWA 3A5FA 1MZRA 3THAA 3QV7A 2XIMA 2NUXA 3GXTA 3PG9A 5A95A 2EG7A 1R3YA 3RYSA 2GVEA 1BWVA 1DQUA 2ZADA 3R25A 1YBQB 4K7YA 2OR2A 3LENA 4D8AA 1HKMA 4O0ZA 4NKCA 2V8ZA 2XU2A 3ABOA 1E0XA 1EJ7L 1EGZA 3GTIA 4KESA 2NVCA 2O7QA 2WM1A 1MO0A 1EX5A 4Z2LA 3PZIA 3AYSA 2R91A 1JXJA 1SO3A 2YDQA 2FDSA 3ALGA 4AEFA 2V9DA 3UD6A 3I4EA 3FV9A 5C70A 4DJDA 1I1XA 3LI1A 4PMYA 2X8RA 4A05A 2YJQA 4KETA 2OZTA 2V81A 2WZIA 3PPGA 4JX4A 9RUBA 1JZ5A 3MCMA 4MLRA 4PGLA 3N2BA 3PC0A 1TWIA 4UTJA 5CC7A 1O67A 3UJFA 3A3HA 2VQTA 2OQYA 3VNYA 3F5JA 1L8PA 4UFJA 1WZAA 1W56A 3HFYA 2Y7GA 2RUSA 2VGIA 5C2GA 1S5NA 7XIMA 1YE6A 3MI3A 1L6WA 3P8IA 1FWAC 4RL3A 2I17A 4TTUA 3POCA 4QSFA 1ZS2A 4QEHA 3WDIA 1XYFA 4I5RA 2J24A 2CPUA 1UD6A 3HO8A 1RD5A 3IJLA 1I2NA 4AIUA 3RMJA 1S1RA 5EU9A 4XZWA 1XIFA 2FLIA 2AGKA 3O6DA 2REQB 7REQA 3EDFA 2VVNA 1UP2A 2ACSA 3HBLA 3PJTA 2VEPA 1TPFA 3H7UA 4BQ2A 1LWIA 1Z41A 2DFAA 1P6CA 3ITTA 4ZOBA 1A5MC 1KTCA 3GC4A 1JEZA 3N3TA 3Q94A 5HR6A 3AIWA 1S3TC 4UR8A 5GNXA 1VFLA 3ELFA 1GNXA 3NVDA 4J1OA 1POKA 3MSDA 3AZTA 2FZMA 4QIUA 2DDXA 4HA0A 4IGNA 2DZXA 3TE9A 1JUBA 1A5SA 2Y88A 1MQRA 3JRKA 4JTRA 5D33A 4R33A 4Q8OA 2CZFA 3W37A 1Q2SA 4P8WA 4LF1A 1O1ZA 3W24A 2WMIA 3DG7A 4OKDA 3VX1A 3U57A 1G7VA 2FHCA 4HZMA 3BMVA 4IIBA 3AZRA 4DLMA 2ALDA 4CLMA 2HNEA 2OLSA 3BZGA 3T0CA 1LRTA 2CZEA 4AD2A 2IS7A 4JTLA 5C71A 2NV1A 4LH8A 4C6PA 3QV8A 1A0CA 1OF6A 1Z44A 3V7PA 4O0KA 3WBWA 3N1AA 1XGEA 2GVLA 1B3ZA 4F66A 3E02A 2XVPA 1E6NA 2WMGA 4Q7NA 2EPOA 1CXLA 3UWYA 3BG3A 2OFJA 3KL3A 1C92A 3W7NA 1V02E 4OOZA 3W6MA 4JPGA 2QGYA 3ITLA 1DXFA 3ZQ9A 1QATA 3G24A 5HWMA 3B9EA 4PCFA 3VDGA 2E4TA 4LUYA 4JHZA 1QK0A 5F1VA 2HCVA 1J0JA 1NF7A 4H8HA 1W5OA 2XJ7A 3QC0A 4LYQA 4JR5A 2QJGA 3FAWA 3CEUA 3SIMA 5AC8A 4RNHA 1KBBA 1UYQA 2PCEA 5SWUA 2E6DA 1F3WA 3NQVA 4R7OA 3WUEA 3LM7A 1KFCA 3PAJA 3T2OA 1QHOA 4NXSA 2UY5A 1DORA 2OKTA 3L2LA 1DWGM 3GNOA 4MJZA 5IFTA 3UZXA 5CZSA 2ZX5A 1JUKA 4GX8A 3MMUA 3JZEA 1R38A 2CLOA 3EX6A 3CO8A 3ZR6A 1TPDA 4B16A 3SURA 3O63A 3LHZA 3U7VA 1B0IA 4Z08A 2VEMA 2TAAA 3GU9A 3WF1A 1TZZA 4DZIA 3KOZA 5E6ZA 3UZWA 3CZEA 4ZEPA 3QW3A 2VGFA 2Y89A 3CL6A 3EWZA 3SN0A 1GQLA 5JVLA 4C1KA 1KO0A 2VMFA 3AS1A 3HN3A 1EWEA 2QUVA 3VZZA 3VFCA 3ZZ1A 1A4MA 3BG9A 3S6DA 4ENLA 7A3HA 4GZEA 2NT1A 2YFNA 2A3LA 1W37A 4B5NA 3R94A 1KR0A 3BDKA 2GUBA 2XGBA 1ISVA 1E1EA 3S5ZA 1S3HA 3OGSA 1WDDA 3EPMA 1EYEA 3ZWTA 3ZYZA 4NILA 1KFWA 2CC0A 5F4XA 1Q65A 1R2SA 2C8NA 3PBVA 3WIJA 2PDGA 3E0FA 1KCZA 3C3UA 1KXHA 3R0KA 2ZC8A 1YEYA 3OZMA 1RBLA 4IIGA 4LXFA 4OECA 1XWYA 4HVXA 1K7XA 3KWSA 3ZXWA 5E6YA 2WZMA 5JMUA 1OCNA 2DSWA 2YLAA 1I4NA 4IFRA 2DUZA 3BAIA 4BEUA 4C65A 3KDOA 5I3JA 1TO3A 4JNYA 1EP3A 1IZKA 2D0GA 3P7YA 1QPQA 1HNYA 3AO0A 3O0FA 4XX6A 3LX9A 4WK9A 2OXNA 4OV4A 1FWSA 3BXWA 4JS3A 2JEQA 5E0CA 2QUUA 1JL8A 4E6MA 3OVGA 5J5DA 3UVIA 4CD4A 4WKFA 3RLHA 4H41A 3T81A 1P1MA 3TW9A 2WKLA 4JIHA 4IFOA 4LY4A 3MS8A 4GYPA 2ZRVA 6ENLA 4ROPA 4MFEA 1F6YA 4XZBA 1E0TA 5C54A 4PTDA 5D2WA 1JDAA 1UJPA 2A21A 3GVRA 1LRNA 4ZQRA 3FXGA 2CITA 4YVVA 2CZVA 2PWDA 4N6FA 1ISYA 2YXOA 8XIMA 1J5TA 3GDRA 4PL1A 1AH4A 5I78A 4D6EA 4W9TA 1Q5MA 2AAAA 3EWYA 4FNPA 4IICA 5DXXA 3TNOA 4IPLA 5H8UA 3TN5A 1LWJA 3W1XA 4LU0A 2RJHA 5I09A 3RU6A 4CCDA 1BVZA 5EMYA 3NL2A 1M53A 4F4RA 2BHZA 2Z1VA 3CUHA 4R27A 2X09A 1OC6A 1LG2A 3LCWA 4QG9A 4Z1YA 3C2YA 3DG6A 2HS6A 3NDOA 2PD9A 5K7JA 4JD4A 5I00A 1W6TA 2DPEA 2DY3A 4M7TA 1G9HA 3W83A 3CJPA 3TKFA 1WDQA 1EP1A 2IQTA 5AOUA 2J4GA 4HMDA 4X2RA 2HVMA 3LBOA 4C7FA 3VDAA 4IQDA 2WNQA 2OB3A 1DJNA 2EAWA 1IR1A 2BG5A 4C6JA 4CNSA 3CUFA 1E9ZB 4X22A 4MLJA 5CBJA 2VXNA 2WSPA 2V67A 3C2FA 4AHPA 1M7PA 4JGDA 4ERGA 3WK2A 2XM1A 5CEWA 2O9RA 2Z2BA 4AUBA 5JIPA 1SZNA 2DT0A 1AW1A 1L6GA 4ERAA 3I65A 2J78A 3CC1A 3RO8A 3B0YA 4YTTA 5IBXC 3UR5A 2Y62A 4GYFA 3AI0A 3L4VA 4V1YA 4YLWA 3OBAA 4S3KA 2DORA 3M5YA 4LS2A 4LV9A 3U48A 4AZHA 1ZBVA 2QS8A 5D9OA 1R2TA 4XD6A 1XFCA 3MBFA 3WLMA 1EJTC 4Y9OA 2X1TA 2J66A 3U9IA 2VCBA 1XSIA 1B4KA 3C0SA 4ALDA 2QV5A 3C2VA 2XIBA 2CIPA 3TWBA 1JNDA 1V6WA 3LG3A 4IM4A 2PDHA 4J3SA 4HU4A 3NQ6A 3WUBA 2QE7G 3L0KA 5AHIA 5K2ZA 4XQ6A 5L9FA 4CQ8A 3VD3A 5AYXA 4UWMA 5CGQA 1EB3A 2Z6JA 4GPNA 2E68A 3WG6A 3W2LA 3JS3A 2GUYA 3W7DA 3BG5A 2V2HA 7ENLA 4MZ1A 4H2HA 3R58A 2Q6ZA 4IL2A 2B7QA 2VDHA 2HS8A 4V2XA 4Q33A 4CEXC 4XBSA 4GIRA 1TWWA 4KWWA 3FYOA 4M19A 1W1YA 1ALDA 3GG0A 4HU8A 2WK2A 4QS6A 1PX8A 4J3WA 1O95A 2D1ZA 5KINA 2JE8A 4M51A 4OJYA 1EC9A 1HKWA 1W91A 5HNRA 2BV9A 9CGTA 3KOXA 5DXYA 2FH8A 2IW0A 3HJZA 3EX4A 5CC3A 4PSRA 2HTMA 4A6GA 5EGRA 3LU2A 4XBKA 2PF0A 2BY3A 1IZJA 3T0AA 4DYEA 2R1PA 1TPWA 3GYEA 2J7CA 4QS5A 4TMCA 3APYA 4Q8QA 3T0TA 4I9AA 3IVUA 1PSCA 3E12A 2PLKA 3K4DA 3HOJA 1GVFA 4Q8PA 2AMXA 1FDJA 4G6CA 1IGWA 1B54A 4YYCA 3CT7A 3SR7A 3TA6A 2W61A 4FX7A 3Q37A 4X60A 1IXOA 3CPGA 3LHWA 3U4FA 3RX3A 2WM0A 5C2CA 1K8CA 1ZL1A 1CEOA 3QFWA 1DBTA 2D2OA 3MUCA 4Y9AA 3AFBA 1OQFA 4PZVA 4XISA 1J79A 1PKYA 4X3ZA 3QLLA 4L4MA 4LCQA 2PDCA 3NR0A 4B90A 3VIIA 3V18A 1MEIA 2NSOA 5HBFA 1SVDA 3OE7G 3WX7A 5DT5A 1XLBA 4CD8A 4QROA 2YYTA 1Q63A 3GR4A 3KLKA 4RX0A 3T09A 3R43A 3I6TA 3MDUA 1RQBA 3SRDA 2NZLA 4KF1A 3CTTA 2QEZA 3USBA 4B3KA 4LS1A 3GWQA 4XO6A 2DVXA 3TXZA 1VBGA 2R1KA 2ZICA 3LERA 3E2VA 1HN1A 4DWSA 3G8RA 3SSZA 3T0DA 3MV01 3LRKA 5DX7A 1UD4A 1XR2A 1ENUA 3VIOA 2A7RA 4AIOA 8A3HA 3UF9A 1AW2A 1IE7C 3GFXA 3PFMA 3SO7A 1XICA 1ICQA 1K3UA 4ADSA 4ZQOA 1JCMP 3WEOA 4MB1A 4AXNA 3SCRA 1Z3NA 3UG8A 1XBVA 1W1TA 3VDHA 3OLDA 4W8AA 3RXZA 1W1B1 1V6UA 1LOLA 2CLHA 3UWEA 3LMZA 1JPMA 2C0AA 5LGZA 3QYSA 4A8NA 5D02A 3HQOA 3MWAA 2YBTA 1PO9A 4DO7A 2NXIA 4YXWG 2YZ5A 3VNMA 1MSSA 2JBMA 3TN3A 2VR5A 4GMEA 2ZWYA 4C6IA 1OX4A 1YXYA 3AIVA 4NL1A 1XYCA 2W6RA 4XUGA 4S3BA 1J5SA 4H9MA 3M0KA 1VKFA 2CHRA 1CIUA 4C60A 1Z6KA 3EXTA 1CW2A 3NPVA 4H04A 3O07A 3C4UA 1Q8JA 5HQMA 4GIEA 2VZVA 1LBLA 4HNOA 3VNZA 1TE6A 4TMBA 3GR7A 4HNCA 1BWKA 3KBNA 2XSAA 2PRLA 2FYMA 4ASUG 1FS0G 4FF5A 2ZOXA 2ZZ6A 1VD6A 4ZQCA 2J7GA 4GIAA 2PBGA 4H6RA 1UUQA 2XPKA 3EBVA 4RE0A 2I5GA 3O3RA 2XVGA 3UJSA 4DX3A 3Q67A 1EBGA 2BOGX 3W38A 3WQFA 4B5XA 4YHEA 3UBPC 3V5FA 1F3TA 4M81A 2WJDA 1U1JA 1GHRA 4HD5A 3CIVA 4GZ7A 1XKJA 2NV2A 2JIZG 2CXEA 2VHLA 2WSYA 4N6EA 2FB3A 3AHYA 1IWBA 4MB5A 4ZENA 3LUTA 1OABA 3CWHA 4FF7A 4HTBA 5EL1A 3JVAA 2HWGA 1LORA 3VMOA 4PMJA 1JYNA 2P3EA 1XIMA 1FOBA 1O6IA 5M1TA 1JCNA 3W71A 2H90A 1JZ7A 4HOXA 2DIJA 1B30A 1W2PA 4CNUA 3C2OA 3ZT6A 4BI7A 3DOPA 1EPXA 4NY2A 3TQPA 2Z1XA 2MANA 4M1BA 4FNUA 4IUGA 3W2JA 1HJWA 5AHEA 5DY3A 2HMCA 3TA9A 5JBFA 1G01A 1H50A 4K1GA 4QM1A 1OFPA 4XD4A 1XBZA 3KAOA 2QCNA 4CN1A 4NAEA 3LLXA 2OELA 3P0XA 3R4IA 5B7ZA 2IUZA 1VFUA 1D8CA 1W31A 3GR8A 1SSDA 3WENA 4DB7A 1SZEA 3IIPA 3ITXA 3W7RA 2PDPA 4AF0B 5K3VA 4WDTA