1E0UA

Structure r271l mutant of e. coli pyruvate kinase
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
470
structure length
461
Chain Sequence
MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords PYRUVATE KINASE
publication title The Allosteric Regulation of Pyruvate Kinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 166
structure length 461
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.33.10 Mainly Beta Beta Barrel M1 Pyruvate Kinase; Domain 3 PK beta-barrel domain-like 1e0uA03
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1e0uA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 1e0uA01
3QV7A 4FXFA 4B5XA 4RPPA 1KBLA 1S2WA 3FA4A 4MG4A 4HYWA 3EOOA 2VWTA 3SRDA 2V5KA 3B8IA 3PUGA 3OYXA 3EOLA 1S2UA 1PKYA 3GG8A 5TAOA 2DIKA 4IP7A 4B5SA 3OQ8A 1E0TA 1KC7A 3P0XA 1S2TA 4G1NA 3HQOA 2ZE3A 1M3UA 2QIWA 1XG4A 1SGJA 3GQYA 3T0TA 1DIKA 1ZLPA 3SRHA 3T07A 2L5HA 4JPGA 3QV6A 2VGBA 4B5UA 1T5AA 3G2GA 3HQNA 1S2VA 1MUMA 4KCUA 3VAVA 2HROA 4ROQA 3T05A 3HQPA 1A3WA 3QV8A 3E0VA 3SRKA 4KCWA 1XG3A 3QV9A 3IS4A 1A49A 4B5VA 2OLSA 1PKMA 4FXJA 4TV6A 4L9YA 4QG8A 2HJPA 1DQUA 4YJ5A 2KX9A 1PKNA 4HYVA 2DUAA 1T57A 2VGGA 4DRSA 2V5JA 4B5TA 1IZCA 3U2ZA 1OY0A 2E28A 3M0JA 3M0KA 3N25A 1O66A 3OYZA 1O68A 4QG6A 4WJ8A 1PKLA 3KHDA 4B2DA 4B5WA 3LG3A 2VWSA 1A3XA 1OQFA 1VBGA 1JDEA 2G50A 1IGWA 3MA8A 4L9ZA 4QGCA 3GR4A 2XZ7A 4LSBA 3H6OA 4KCTA 4IMAA 4B2DD 1VBHA 4L7ZA 3FA3A 3QZ6A 4IQEA 1UJQA 2HRWA 3BJTA 3KTXA 4TV5A 1A5UA 4KCVA 1U5VA 4IQDA 1DXFA 3EZ4A 1F8MA 3LYEA 3PP7A 2VGFA 2WQDA 3E5BA 3QQWA 1ZJHA 4L80A 1O5QA 3SRFA 3QTGA 1F8IA 4KRZA 1E0UA 2R82A 3EOEA 2X0SA 2XDFA 2XZ9A 3R4IA 5JVLA 4KS0A 3ME3A 1GGOA 2HWGA 4YNGA 1U5HA 1M1BA 2VGIA 1DXEA 1AQFA 1PYMA 3BJFA 4MF4A 1F61A 1Z6KA 3QLLA 1F3XA 3E0WA 2BG5A 3I4EA 1VP8A 4QG9A 1F3WA
chains in the Genus database with same CATH superfamily
1XYLA 2Z6JA 1OADA 4AZBA 3JU2A 3H2MA 2QCEA 1XV8A 2W3ZA 4F79A 1ME7A 1VPYA 3OZOA 1H60A 1XG4A 3GRIA 2OGYA 3K8MA 1CLKA 1MRAA 3T07A 1KM6A 1UP0A 1J0KA 3F5LA 3PJWA 2Y4SA 5LXXA 2HVOA 2E5DA 6TAAA 1UZ4A 4JQ2A 2OXNA 3A24A 3BGJA 3EOSA 3NQEA 4QJ3B 4YVVA 4MZ8A 1OHLA 3BL3A 1QFEA 3CQHA 1H5YA 1ZP3A 3CQJA 2O55A 5E6YA 3PSVA 2REQB 4C6JA 3N9SA 1TVNA 2YCEA 4JTRA 3WL0A 1GVQA 1WDQA 3L7RA 4ADSA 3CXOA 4CQDA 4AWTA 4QSHA 1DTNA 3HA1A 5FJTA 4KCTA 4MPKA 4M80A 2HMCA 2VEFA 1JPHA 3KS5A 1Z7AA 3LYEA 3W26A 4MNJA 3WBWA 2JGYA 2PDHA 2YDQA 1DJZA 4AHOA 4UQAA 4LYQA 2BY0A 3WLSA 4P7NA 3GX9A 3VTRA 4JL2A 2J79A 3DH7A 1E15A 4QCEA 1LT8A 4AC1X 1LDCA 1FRBA 3AZSA 4OT7A 2E1WA 4C65A 2OQHA 2XJ7A 3NDYA 1WOBA 3TOPA 2J9YA 1EX5A 4K39A 3NZPA 3BDKA 4HA3A 2XU2A 3UJSA 3RX2A 1QPRA 1K8XA 4RE0A 4B9ZA 3SADA 3GNRA 2HNHA 1UH3A 1SVDA 3CMFA 4XUGA 2FTWA 3KZSA 3K4WA 1Q7QA 4WVXA 4WLCA 1OCNA 5FKYA 1W32A 5T91A 2ISVA 1OC6A 1V5XA 1Z32X 3QPEA 4WKHA 1R9YA 1POJA 4J3SA 2VFHA 4HYRA 3ZS4A 4M3PA 2VI0A 1UR9A 4KWVA 1IZCA 4NG3A 2AAMA 1U83A 2QCDB 3S6DA 1KLYA 1FP9A 4M7TA 3W1AA 5F2MA 1RVGA 5EU9A 1HJXA 3CPGA 1OT1A 5ABGA 4ZGYA 4JQ4A 3BANA 2OZ0A 5CCZA 3OODA 3LN3A 1I2OA 2VL4A 3APGA 1IYXA 3R4IA 4MJZA 5EGRA 3G6MA 5DQPA 5D03A 4MADA 2GUBA 1FWDC 4W8BA 1KQYA 1E4LA 2ZUWA 3UT0A 1XD1A 2OPJA 1GPFA 2OEJA 2F7FA 1KD0A 4AXKA 2VC5A 1RAKA 2XIIA 4DPQA 5FL1A 5EYWA 2OB3A 4K8HA 4HK5A 1TVLA 1LRQA 4G1NA 1K4HA 2H8XA 1BAGA 2CCRA 3HPFA 2OKOA 3WD1A 3EA3A 4J3VA 1R0MA 3PPHA 2W6JG 2PLJA 2IKHA 3BMVA 4PUDA 4HTBA 1MZHA 2NLYA 3G1XA 4P7RA 3AJXA 3CAVA 1UA3A 2QPSA 3VIPA 4BKNA 5A8NA 3YPIA 3MI2A 3GC5A 1AJZA 4TV6A 1CXFA 3VNJA 5E1QA 5AC7A 2VCBA 3R0KA 1RBOB 1HUVA 2O9PA 2ZX7A 3I6RA 1O66A 1OB0A 4WGXA 4W8LA 3STEA 1O60A 4AMCA 1YDVA 1VBHA 4J4KA 4OV4A 2XVKA 2PDGA 1F7BA 3M0HA 4ICNA 5DMLA 3MUCA 3SUVA 1TREA 3PANA 2CBVA 2PTZA 1FWNA 3PBUA 3WLRA 1QNRA 4H7VA 3HJZA 2J88A 3PNUA 1TO3A 4GHRA 2CZ5A 4XZWA 2DT1A 3AJ7A 2RJGA 2WCAA 3VOHA 4JFVA 3UA3A 1GEQA 5H2ZA 2WHLA 5BXRA 3BUVA 4QP0A 3C2OA 4KPLA 4F9JA 1M7JA 5I78A 5E70A 1US3A 2RAGA 3NQDA 3WELA 1O5KA 4LS2A 3OQ8A 3RK8A 2P0OA 5AVHA 4WUIA 1MFUA 3UR2A 1QBAA 4H9YA 4IFKB 1TR9A 3DC8A 4V15A 2AL2B 3PJXA 3TNBA 3THDA 3T1GA 4ROQA 1G0CA 1C9WA 2ISSA 3T8QA 4PCSA 1G1YA 1UC5A 2C16A 1IGSA 3SW6A 4BQ4A 4TXEA 1V79A 2VNCA 5CSYA 3GZAA 1Z3NA 3OB8A 4GJ1A 2AAAA 3ANVA 2B4GA 5DBUA 1F74A 4LCSA 3HMCA 4WXYA 3DCPA 4TVDA 4E3TA 1E6SM 1KFJA 2PGRA 2WV8A 3FSTA 2FVMA 4LVBA 4GUGA 3GR7A 4IPNB 1ZJHA 3LUTA 3WMBA 2ZZ1A 5TBOA 1Z8AA 2GFTA 3B9AA 1RD6A 4J3WA 1NDWA 4H6EA 4RNJA 3VABA 1M01A 3N11A 1NJJA 4HHLA 1OSEA 3QFWA 2QPUA 4TSFG 4CQ9A 3BAXA 4MLJA 2RKXA 1EOKA 1HVQA 4QEEA 4OZOA 3RU6A 2HNEA 4EE9A 1R3WA 3WUBA 1LCOA 4GQBA 2GGEA 3W1TA 4WKAA 4UZSA 1RLDA 4Q8NA 3UWWA 4BK9A 2V5DA 3CZLA 4NNBA 1E73M 3PUDA 3IJIA 1H49A 1TA3B 4IIBA 3OA3A 5HJLA 4BWLA 2DW6A 3G2GA 4UTJA 1HGYA 4H83A 4DIAA 3T05A 3RPTA 2ZA1A 4W93A 2QJJA 3AHTA 3TYBA 1AVAA 3VKCA 3CZGA 2XFFA 1BEUA 1Q45A 4DVOA 4EX4A 3GAKA 1R30A 3RR1A 3M16A 4MWAB 4QE1A 4O18A 1O68A 1YPFA 1FBAA 5CSUA 4JFUA 4GXWA 1TTJA 3S47A 4PN2A 4YCPA 4DWDA 4B3ZA 1SQ7A 5I00A 1BWKA 3I6TA 2O9OA 2X1RA 5DY3A 1EBGA 3GD6A 1JFXA 2VDIA 3PK7A 4XZLX 3W7JA 4AWSA 3BLLA 2P3EA 2E9BA 5D4YA 2H8ZA 2BWGA 4C6PA 4HPJA 3URQA 4RCXA 3RIKA 5B7YA 1LROA 1TKKA 4LVAA 2EPLX 1G4PA 4PTXA 4XBJA 2C71A 1KXVA 2Q8ZA 1ITUA 3M64A 4P8UA 1CXEA 3BPWA 3FHQA 4EWJA 3M6YA 1GQNA 1H3GA 4DI8A 2Y5SA 4PEKA 2WAGA 4ZBCA 4CNSA 2D22A 3RPDA 4XO7A 1BGAA 3W02A 3DHFA 1B3XA 1V3KA 3EPMA 1UWAA 2ZZ3A 1EPXA 3WZ0E 1J96A 5M5DA 4RJEA 4UBPC 3QR3A 4U28A 2EXOA 4YXWG 1OFQA 2WC4A 2W5FA 1TZ9A 3EPOA 3BG9A 1YDYA 1QWGA 1XR2A 3LNPA 2OR2A 3M9YA 1V77A 1I60A 4N2YA 3GHUA 2DUAA 1NFBA 2WANA 3RG6A 4NJJA 3N6HA 3WSUA 1C8XA 5CPQA 3FIGA 4LOCA 4GQRA 4LUTA 1EXPA 2VELA 2J4GA 1JZ5A 1H7OA 2PE4A 3AHXA 5FAJA 1ENUA 3H70A 2Y24A 1VLIA 3Q4DA 5I03A 5T8GA 1XC4A 1J6PA 1GOQA 1VP5A 4J3XA 4AEEA 1XFBA 4OQVA 1YTDA 1DEDA 1SMDA 1KB3A 1W0MA 3TVAA 5C8BB 5D9NA 3MB9A 2FPYA 1CBGA 1B4KA 4RDZA 1N55A 4GFIA 4J28A 4JQ1A 3S2MA 1EYWA 1WQ5A 4AF0A 3NR0A 3FJ4A 3UCDA 4ZEPA 1B3VA 3WQWA 3CTLA 3RM9A 1RY8A 1DKWA 1OYAA 3QOKA 2V82A 3BICA 2Z6IA 5H8UA 3K5XA 5AZ0A 3SR7A 2P0IA 2J6VA 5G1TA 3GDTA 1L6FA 2BOEX 5K4ZA 2YLLA 3MMDA 4JTDA 3VD3A 7CGTA 1FA2A 1GUVA 4JQAA 2Q8LA 2B7OA 2Q02A 1ADOA 2PSNA 4AQLA 1YHTA 2WWDA 3I10A 3REQB 2Y61A 1OGSA 1A5MC 2WJZA 1DHKA 5BMXA 2DT3A 1ODZA 2MNRA 1DWHM 4MZYA 5HK4A 1LRNA 7TAAA 1GKRA 2MANA 4IUOA 5K7JA 1QW7A 1TPC1 1IIHA 3IIZA 4W9TA 4U5IA 4UNIA 3W2KA 2HXTA 3M0JA 2OT1A 2PRMA 1E51A 2W27A 1OFAA 3QC3A 3SIZA 1YE4A 3K30A 5HNRA 2D23A 1TE6A 5CAKA 1J11A 1TR1A 3TWBA 5C9RA 1UR8A 1YTEA 5AFDA 3M0LA 4JIPA 1QHZA 4AIUA 3HU7A 3M41A 3TSBA 4I3GA 4U3CA 3O6AA 4HNUA 1GZGA 4XZHA 4JD4A 3U5UA 5GQBA 3W7RA 1LBFA 2NX3A 3W4RA 1XGDA 1E3XA 4HK7A 2IMRA 1R2TA 1GCYA 3N4FA 2DH3A 7ODCA 1RQBA 5GVJA 4O57A 1B2YA 1WV2A 2Z1XA 4MMWA 1HVXA 3U9IA 1S1PA 4O50A 4HOZA 4HNTA 3ZMRA 1D2KA 2ZRYA 5LHEA 2AL1A 4BQ2A 4I9AA 4F2TA 4H9XA 1V3MA 4R33A 2G41A 1W5MA 5IRPA 4PMJA 1KGWA 4K7YA 3I65A 3N2CA 4A22A 3EKZA 4QROA 3NQMA 4QG8A 1S2AA 4XWUA 5FCZA 3PJTA 3EWYA 1IF2A 1HKVA 2X1IA 2QUNA 2XUCA 2QUVA 2NSOA 3VM5A 1RHCA 2ZWZA 4REQA 2XIJA 1EPVA 3R6IA 3OYZA 3WYZA 4E0CA 4EACA 1UJPA 1A3XA 4YTUA 3SUUA 1G4EA 4DUWA 4QAIA 5FOOA 1UZ1A 5XIMA 1DJIA 4NZ4A 3DFSA 2DUXA 3EZ4A 1VYRA 2NVCA 2HEJA 4KEZA 1PWMA 3E5BA 2PLMA 4KIEA 4DQWA 1WPCA 4U3AA 1KFEA 2B0MA 3PR2A 3U57A 5BWFA 2P1FA 5JIPA 3H55A 4Z17A 4LEQA 1NEYA 1R86A 4P8VA 5FJRA 3UWZA 5JIWA 3PWAA 1TMQA 4UMAA 1FHDA 4PTNA 1S38A 2JFEX 4DJFC 4EVZA 4WJEA 4CEUC 3TN3A 3CZEA 3LCFA 1HO1A 2VD8A 2XH0A 2FZMA 4DWSA 3LHVA 3OEHG 2PDMA 3TSDA 3RYSA 1BYBA 3N3MA 5F1UA 4YXGA 1PDYA 5CPOA 4C6MA 3VDAA 4JTIA 4FLSA 3W81A 2PCQA 3CUGA 2PGWA 1BVWA 1R6WA 3K2GA 4Q8TA 1JCLA 3CH0A 3FYOA 1V3HA 2YDAA 4P8XA 2WVVB 1Q6EA 3VX0A 3KAOA 4A8IA 3GYEA 2EG7A 3W7LA 4XSLA 1J0HA 2Q01A 5D38A 1GQIA 3QZAA 1W9VA 1EDGA 3R8RA 1W3IA 4UTFA 3N34A 4HSHA 4L6OA 2V2CA 2Y88A 3R0DA 1S1RA 2V6AA 3B40A 2YL6A 5A69A 3ABZA 4J3TA 2PMQA 1RUSA 5SWUA 1HNYA 5I0DA 4Y9OA 2VX7A 4U2YA 3DHPA 4M1BA 4CD5A 3Q58A 1S5VA 4WIWA 1RBLA 5D30A 2QUUA 3Q37A 2HSAA 3POHA 1TZZA 1PYMA 3N2BA 1BD0A 1D8CA 2J7HA 1KGUA 1TG7A 2G4FA 3GHSA 5LA2A 3AI0A 1MW2A 3G18A 1KXQA 3KXQA 3W28A 4F40A 1H7PA 4LAUA 1TV5A 1B57A 1TTQA 3EWXA 2P53A 4Y2WA 4L1XA 4RZ6A 3H2NA 1C7TA 3BE7A 1MEHA 2R1NA 2DIJA 4JTQA 2J62A 4L4LA 4NP7A 1CYGA 3G24A 5FJJA 4FS9A 2EKCA 1M9HA 3DGBA 5A3HA 3DBPA 3NTYA 4KCUA 4O13A 2ZC8A 1Q6QA 4DF1A 1NWRA 5D9MA 3CLWA 3PG9A 3WK1A 3DZ1A 4AMAA 1EX1A 2PWEA 2A1YA 3Q45A 1TZ7A 2XOKG 3BCDA 2QS8A 3UNTA 5A6MA 2XWEA 3VMPA 4JX6A 3MWCA 1CGVA 4MAVA 4Z1CA 2YFNA 3P8JA 4FLOA 3J7HA 3JW7A 3WD0A 3DN5A 2DZVA 1XLHA 3NDZA 3APYA 3W25A 2VC6A 2EF9A 2ACSA 3FA3A 4NX5A 3CGTA 3PZUA 1U1JA 4M0XA 3PZGA 4DYKA 4JTJA 1YNYA 2PDBA 1EL3A 1FHLA 5IHSA 3LCGA 4HVXA 4PTMA 2ZDRA 4QQ3A 3FKKA 3DC0A 1QOQA 2E9MA 3L2IA 4A8RA 2YXGA 3GNPA 1RCXB 3ZSSA 1TRIA 1CW2A 2ZRUA 3LV5A 3F7JA 4U31A 6XIAA 1NWTA 2RDWA 1TV8A 3VNMA 1KRBC 3HGOA 3WQEA 1DJQA 3AMDA 1ZZMA 1RK5A 4KWOA 4CUCA 4ACZA 1MRQA 3PZOA 5AYXA 1E0TA 4GA8A 5FJPA 3P0XA 2HVMA 4D6JA 1QR7A 4B3LA 5AC8A 3FAXA 3M0YA 2ZUTA 4DO5A 1WZAA 4YLWA 3W22A 2QCHA 1XH2A 3BSGA 1W9PA 2JBMA 4INFA 4FP1A 2PURA 3B4UA 5FEPA 3PAOA 2GSEA 3L4VA 3RMJA 4KFPA 4O15A 1QW9A 3A9BA 2QCMA 2UWFA 3CUZA 4CN6A 2QNEA 4B2DA 2DVTA 4C6QA 4HQVA 3T78A 4RPQA 3K46A 4WKFA 2X09A 4H9TA 1D7FA 3DEQA 3AMCA 3ITYA 4WOQA 3LPOA 1VFOA 3VVGA 2OMAA 2O7SA 5HAOA 5E93A 4AVFA 4HGXA 3V5FA 4PEEA 3U2OA 3C3NA 4NUWA 5BRBA 5AHLA 3ABOA 5A6AA 3QTGA 3W2LA 3S5YA 4R53A 3TROA 4JY8A 1CGYA 2FZNA 1TCMA 3ZWTA 1YRRA 4M6PA 4JHOA 4MNMA 3SDOA 4RXFA 5DXYA 4JNYA 2RDUA 4ICMA 3W86A 4OKDA 2QVHA 3OYXA 3EXSA 3LD5A 3RJXA 4NILA 3GXNA 2JJ2G 1PUDA 4UNKA 4ZOBA 1W1YA 2VD9A 4ZQOA 3MUY1 1VCGA 4B5UA 1C92A 3MMTA 1X1OA 1V6UA 1LORA 4S3CA 3S46A 1KTNA 4P2VA 4JICA 5M17A 4TTGA 5CC3A 1HW6A 4LB3A 1E6NA 3O6DA 4ASUG 3RRXA 3W7HA 3MZNA 1XF0A 3GU2A 4R9OA 2OQYA 5G1MA 3PZNA 1VKFA 3AWOA 1JZ4A 5D05A 2QDGA 2Y70A 1O5XA 2O9TA 2V5CA 1R3SA 4DNHA 2VR5A 2Y7DA 3E6EA 4G6CA 4B2DD 1XYBA 1T99A 4LUSA 3UY8A 3UXKA 5FI8A 1TRDA 3KM8A 2QMJA 2JKPA 3L5MA 2VDHA 6REQB 4H4IA 5G4EA 4XZNX 3PZMA 1SM9A 3WLOA 3NPVA 2RHGA 1JZ8A 3CEUA 4AD0A 1R2RA 4US6A 1XGZA 2YA0A 2C3ZA 3RMEA 4IP4A 3S6TA 2G3IA 3RRAA 2V2DA 3VNKA 2BOGX 3KBMA 4QJ4B 3W24A 2Y5EA 5HUOA 4J35A 4HJWA 2BVTA 3WLMA 2J78A 3MCNA 3JZEA 4PL2A 3RLHA 1X38A 1WE5A 1B3WA 2FTYA 3EWBX 5CH9A 4CEXC 1TJ1A 4FR1A 4L4PA 4E2OA 4C1KA 2QW5A 5DO8A 2JF7A 4HU3A 3KCOA 1US0A 3HFTA 3VNLA 5A6KA 1C3FA 5EMUA 4ATLA 3EWWA 3HURA 3WDIA 2Z24A 2VFGA 5FACA 5BWAA 2KX9A 2RGMA 5HR6A 3GH4A 1GYNA 2CLMA 4FIQA 1WOAA 3OU8A 1W5NA 3C2EA 3QC0A 1FXPA 2PODA 3MP5A 4FF7A 5I7GA 3NO1A 3LMYA 3GM8A 2GVLA 5LNVA 3MYPA 2WNNA 3UVIA 1ZPTA 4EOUA 2WLYA 4CQ8A 3GO2A 3WH8A 1U1HA 3CYVA 3KWXA 3WX7A 4P7QA 3GR8A 3R58A 4DUXA 2VFEA 4H6QA 4J2MA 3AMGA 3EWZA 3DXIA 1JPMA 3WJSA 4WZHA 4S38A 4B91A 2GVJA 4FOJA 2ZZ4A 2PDJA 2YOCA 4O8AA 3HV9A 3WLPA 3MO4A 4FMVA 3BV7A 1JCTA 2BG5A 3P61A 1WDDA 4Q22A 3LHUA 3OLEA 3ID7A 2WWCA 2XSAA 3UGVA 3CPRA 3T0AA 1NH6A 4IX0A 4IICA 3S2CA 3THCA 3TW6A 1YBQB 3BURA 5A8GA 1R87A 4XO6A 1E0XA 4W7UA 1FWIC 2BXVA 1OF8A 2PDYA 1SO3A 1J12A 2OYMA 2F2KA 2GDQA 3SSJA 4ZODA 3MKVA 1E4NA 1VBJA 3PPCA 3PY2A 4X3ZA 2HK1A 2HLDG 1UBSA 3SCRA 5LSMA 4AD2A 3MZ2A 2NVDA 2ZVRA 1VCVA 4NF7A 3LM7A 3S5ZA 4JTSA 1MW0A 1ME9A 3BTNA 4M6UA 3G0SA 3GXTA 3ITGA 1DPMA 3BW2A 1AD4A 4HSOA 1HJUA 1S2CA 4JZ5A 1V6XA 2WZMA 4IP5A 4C6LA 1RD5A 2A85A 4F0SA 4U10A 4C6IA 1F8MA 1ICPA 4L80A 4CN1A 1NELA 5IDZA 2W67A 3ZSTA 4C6EA 3LERA 4AAJA 1Z48A 4YWIA 3IJ9A 4X2RA 3AIQA 4XQ6A 4D2JA 4JYEA 4GQQA 2NWSA 2I9EA 2Z25A 3DYPA 4MGGA 4MY1A 2ZXQA 3NL3A 4RW3A 2I57A 4Q4RA 3N2TA 3B04A 5HQMA 3KBWA 3TTEA 1MFVA 1LOSA 2WMIA 3WDHA 4QJ1A 5DCEA 4TMBA 4JTKA 3ITOA 3IVUA 1JQXA 4DJFA 1J01A 1ECQA 3LLFA 3RU8X 3GQYA 2ZQ0A 1AW5A 1OIFA 1GOOA 2ONEA 3KCLA 1FOBA 4X22A 3CWOX 3OJGA 1CLXA 1I1XA 2KZHA 1SFLA 4LANA 1SFJA 1VCFA 3ZJ8A 5I06A 2EPOA 4JBRA 3TC7A 3Q2DA 3UWVA 1E1FA 3AIWA 3VDCA 1A3HA 3KHDA 3VYLA 4I5RA 4H6RA 1L9WA 3QSTA 1H51A 1HKWA 4NNCA 3EA2A 1X6NA 3LI1A 4RK8A 2GOUA 1OFOA 1PYFA 3O16A 1UC4A 4UFLA 1W9UA 3W9ZA 4XSMA 3NPUA 3ZVHA 4H8NA 2EAWA 3FYPA 1OX5A 2YZ5A 4D6IA 1RP8A 2XZ9A 1SW7A 4L56A 3VOCA 4Y96A 2PUZA 3IUDA 5ECVA 3M7SA 1Z6KA 4KW2A 3A4XA 3AS2A 5GNZA 4ZCWA 2CBIA 4ZSUA 2JIZG 1EF3A 3SJ3A 3S3GA 3UPBA 4W84A 5IFPA 4AWEA 3RLGA 1BFNA 2IPWA 2J25A 4PUKA 4QR6A 1I45A 1K9DA 4MJ4A 1XLLA 3RLUA 1VPQA 1XGEA 1W8GA 4OOUA 5EMLA 1GW1A 4XD6A 3WLQA 3VNZA 3TUUA 5PTDA 3HV8A 2PTYA 4NNAA 3GW3A 3WQ5A 1KM1A 4CGTA 2EKGA 1CT5A 3NEVA 4XB3A 4JKKA 4UMCA 2I1OA 3WF1A 1XYCA 3HQPA 3B9EA 3FY1A 1JEZA 1XSIA 3LLDA 1XLDA 4GVGA 1XPYA 1PS9A 3W07A 5DFAA 5KITA 2WKJA 1H2JA 3KFTA 1REQA 1Y5VA 5A8OA 4F66A 5DEZA 5EY5A 3S1UA 5BROA 2DSVA 2DZBA 3D46A 3TR9A 3T08A 1XIGA 1OFRA 5FL7G 4ML4A 1E56A 3SCUA 2W6RA 1KTCA 2E8ZA 2NQHA 2DQXA 4E2BA 1R85A 1J0ZA 1AL8A 3GG7A 4Q4QA 1O95A 3PPGA 3ABXA 5D04C 5IM51 4ZQPA 1NOUA 3COTA 4AU0A 2VEMA 3ABQA 2XISA 2C14A 4D8AA 2CLFA 3A22A 2WVUA 4Q3MA 2A6LA 4MB4A 1FKXA 5CGQA 4Z0SA 3PB0A 2H3DA 1AMKA 4M7SA 3OPSA 4YHGA 3GG8A 3TNOA 2TRSA 2ASHA 1X7IA 1JXKA 3FJLA 4LVFA 1FWCC 1ICQA 5A95A 4JY9A 5GJPA 1J93A 3UP8A 4CQCA 2QAFA 2WJDA 1F07A 4Q8QA 3SFKA 1W31A 4UQDA 1EWDA 3FEQA 3AC0A 3AROA 1XKYA 1SZGA 3FYYA 1XRSA 1BF2A 3IPWA 1SJBA 3ITVA 3VCNA 1V93A 4KKXA 4B4FA 2FH8A 4UR7A 4W7WA 2V5JA 4FNRA 1XLKA 1OCBA 4PB5A 3SECA 3HO8A 1P5BA 2NQ5A 1XLFA 3IUIA 2XVNA 2QUTA 3V1HA 2DUZA 4H3DA 2NUYA 1BXCA 1IWPA 3B06A 2H90A 3CWHA 5DN1A 2CLOA 4NAFA 1EDTA 1IT7A 3F4NA 2VOTA 1UUQA 4GMEA 4L4MA 1P0KA 3PTDA 1PE1A 1JZ2A 1SJAA 4MFDA 1QATA 1FCUA 1GJPA 1SW3A 4WRHA 3PBVA 1ISVA 4V27A 1GOKA 4E6MA 5E5CA 1H7XA 5REQA 3QV7A 5EL1A 3FA4A 1OCQA 2XVLA 3KRBA 5T9BG 1FH8A 3WBXA 1DWFM 3ZQ9A 3V5OA 2PDQA 4OUIA 5B80A 4NJGA 3MU7A 4HMEA 3CZJA 5HDRA 3WDJA 3M7WA 3EB3A 3H7RA 1MEWA 1Q7ZA 3P5YA 4GXPA 2GWGA 3G1HA 1N2VA 3PNZA 1NFGA 4E8GA 2DZUA 2ZA3A 3WLIA 3VC5A 4RX0A 2QPXA 1OG6A 1WXZA 4Z2JA 1P0EA 3LQGA 2Y2WA 2QDDA 5LA1A 4GKLA 1VYSX 4BEQA 1PKMA 1VEMA 1KCLA 2ZZ6A 4DEFA 2P88A 4UUIA 3PTKA 1OF6A 3KL3A 2VX6A 2VP8A 4DPPA 1VJSA 4UXDA 2FDSA 4MJ2A 3LDVA 1LJYA 4GZIA 3DYOA 3LG3A 3G77A 3VNDA 3GR4A 1I9CB 3HBLA 3TXVA 1TIMA 1OX6A 3IGHX 5D2VA 3TLQA 2Y7FA 3LXBA 4LBRA 4F0RA 4TMCA 1HTIA 5KINA 3NOYA 4Y8EA 1H4PA 4YIWA 1H7NA 4DJEC 4MPQA 3OZPA 1EJUC 3UESA 4HHHA 2BY1A 1AJ0A 4JTUA 4WD0A 2QJNA 4W89A 5C9XA 1KXTA 4JYDA 1TV4A 3JZUA 5U7SA 1M53A 4H2CA 5C5YA 1ZFJA 2NUXA 3NUKA 3E0WA 4L1GA 3RHGA 4GJIA 5GJNA 2DZAA 5JU6A 1P6BA 4GH1A 4PRWA 2Q3OA 3VMNA 3VOGA 1VH7A 4H8VA 1W1IE 1YNQA 1VIWA 4ZOCA 1GG1A 3L4XA 1TV7A 3VE7A 1ADDA 1Q66A 1W1PA 3URNA 3KVJA 3BV4A 3C2YA 4K37A 4KETA 3V36A 3P67A 4PTWA 1TX0A 2BOFX 5HXMA 1IXQA 1HO4A 3L21A 3E0VA 3FVMA 1XLEA 3BQ5A 3K1DA 4CCCA 1J0YA 5CZSA 4GYJA 4JN8A 4MAZA 3HG5A 4ILSA 3TYZA 4G1KA 3VZZA 1BRLB 3HPXA 3UCCA 2X1TA 1UG6A 3M5VA 2P3ZA 5BW6A 3PSWA 4OBSA 1UWQA 1RJRA 3PN8A 3LCWA 1DWJM 5CKSA 1PIFA 4Q4SA 3B05A 2OX1A 3W1MA 4H9MA 4IJCA 3P60A 5G4WA 3V0SA 1LBLA 1E71M 1IXPA 1ZNNA 4N0RA 1UQZA 2HK0A 3DENA 3VD9A 1J79A 3QEZA 3QGVA 3NG3A 4GINA 4HN4A 3ARSA 2D24A 4JDYA 4LUYA 1R5YA 3TYAA 5E0FA 2YB1A 3NZGA 2J8GA 3ZO9A 5HA7A 3T44A 4B5NA 4QIUA 1VFFA 1MQPA 3OIHA 2FPVA 1EJXC 3RN6A 1XHGA 4AHPA 1WXJA 3APTA 1VBUA 4F3HA 2PWFA 1MSSA 1YE6A 4JFTA 1JCJA 1C7SA 2BGQA 4LTSA 5AYYA 1ZAHA 1YX1A 2VZUA 2E7FA 3VAVA 2OG9A 1C8QA 4MKVA 5A8QA 1KRAC 3QW4B 1OEPA 2QKFA 1VBRA 4YU1A 3AXXA 4CN4A 1R47A 5CSRA 3KOFA 3DUGA 2OO6A 3BARA 1I2NA 4R7JA 1T57A 5E0CA 3U2ZA 1W3TA 1HIZA 1U22A 3ZM8A 3QRHA 2AMXA 4UOQA 2EPMX 3BCJA 1XCXA 4KEUA 1TELA 4ZENA 2HRWA 1RALA 2QULA 4UQEA 2UZ9A 2OO0A 4IQDA 2Z00A 4J9JA 3W2MA 3DG6A 2WQDA 3CT7A 5JBEA 2I56A 1B3YA 3CUJA 2R1KA 2VZTA 2ZX6A 4XBSA 3P7YA 4R7WA 3IAPA 4V28A 3OZMA 2X2YA 3V0TA 4NL1A 4U5KA 2OWXA 1G94A 4JGDA 1VLWA 4M5PA 1YKWA 4RV3A 4LQ1A 1W3JA 3OO2A 1AD1A 4TX9A 3WY1A 1UR3M 4FF5A 4JNMA 3ARXA 4HOXA 1W2PA 2Z1SA 2XGIA 1QTWA 3KBSA 2ALDA 1BSLA 1H61A 1RJPA 3E0IA 4WSJA 5A2CA 1XLIA 3POCA 5J5DA 2IQ0A 2A3BA 1ISWA 4UZUA 3UU0A 4QISA 3TW7A 3CB3A 2YL5A 4K36A 9RUBA 3QPYA 4S3AA 3EXRA 3AMKA 4GO9A 1GQLA 3CO4A 1XG3A 3LHWA 4UQBA 1PZ1A 2E1DA 4D6GA 3IARA 3QOMA 4ML9A 4HA4A 1OFPA 3EEGA 5L6UA 4Z2LA 4PBGA 5EMYA 3UA4A 2BV9A 5CG7A 1UR1A 1I2PA 1KM3A 3H54A 5EBUA 1EO5A 1MNZA 1SZRA 2ZZ7A 1DXIA 2B7PA 5ABFA 5LIUX 3ZLGA 4KESA 1JDDA 3A3WA 3W37A 2E5BA 1K1DA 3A21A 5TD4A 2FLIA 3LHTA 2PZNA 2P50A 2Z7KA 2OSWA 3S5OA 4ACZB 4LYKA 2YZRA 2CESA 2CETA 3O2LA 4NT0A 2TYSA 2VGIA 2V3GA 4L5ZA 3N17A 3S83A 2NXIA 2PA6A 5H8PA 4ORMA 2FVKA 1LOQA 3R7MA 4N9CA 3OOQA 3VK5A 3W70A 1K8CA 4IIDA 3VFLA 5JBFA 5LXEA 4S3JA 3AALA 3KZPA 1D3CA 1JQVA 5AC6A 1W6TA 3USBA 5CZKA 3VOIA 1GEHA 1FHUA 1ZHAA 4O4WA 3G1AA 1DQXA 2IQDA 3T2PA 3BW4A 4NZCA 3CHEA 4OTKA 1AH0A 1G9HA 3FLUA 4LAOA 1L6WA 2XGBA 3RX3A 2FHBA 1V8EA 1GZJA 1OY0A 3L2LA 4QG6A 1HKMA 4NKCA 1OFBA 2PBOA 1YPIA 4UTMA 1DJYA 3VUPA 4PSRA 4WY0A 1EZ2A 4LX4A 1ZCCA 4LS0A 4NZ1A 3WJWA 3GW0A 1TX2A 2OJPA 1QNSA 2YB4A 4Q7IA 1G7UA 5C6MA 3VKKA 1JZ6A 5EFFA 2G95A 3EKGA 2E6FA 3ME3A 4GIRA 1AUSL 1LWIA 4IQLA 3WJYA 4G8TA 4B5XA 2JIEA 3QY7A 2QF7A 5AHEA 3PBMA 3KLKA 1UD4A 1DV7A 2F9HA 5CLTA 5A2AA 3W7NA 3MBDA 1TPDA 5LNWA 4AD3A 1QI4A 1XFCA 5DCBA 2PU0A 2AKMA 3MSGA 4DX3A 3SCNA 3T0TA 1W17A 2F6UA 1HP4A 1OJXA 3PG8A 1IZJA 1FWTA 4CU8A 5AYBA 3LBCA 4IL0A 3LZ5A 3TJ4A 1T40A 1HF6A 2AMGA 3UG8A 3SCTA 1FWEC 4RNFA 4XZIA 2PS2A 1G5AA 3VCRA 3LXCA 3E2QA 4S3EA 1KLZA 1XSJA 3P3BA 3QQ1A 1LUCB 4HCDA 2NV9A 1UWIA 2CZFA 3EDJA 3RM8A 3ZFHA 3LOTA 3UD6A 4ZO9A 4K68A 4HNCA 3XIMA 1CGUA 1OIMA 2CLHA 4B90A 1A4MA 2WM0A 1ZS2A 3WLJA 3L23A 1R3VA 5CJNA 1XQLA 4NRSA 2O92A 3MJMA 1W5PA 4US5A 2HTMA 1GJUA 5J8LA 2HDJA 1UUMA 3VD5A 3CUFA 1GONA 2XFWA 3AZTA 3Q94A 1UH2A 4G7EB 3T0CA 3H4WA 2C19A 5D8WA 5K9XA 4CVUA 3UWUA 5DXXA 2E68A 3AQUA 1W3NA 4KWWA 1CCWB 3HGJA 3WUFA 1WYIA 2VZSA 1L6GA 5I02A 3C2FA 2UBPC 4WQ6A 3CYJA 2D2GA 3MI6A 4GBDA 2PRHA 1TIWA 4EAMA 3QYQA 1JUBA 5AY7A 4UC5A 4RDYA 2QDEA 3VA8A 1N8WA 4WDTA 5CPTA 3S0CA 3TMQA 4O1FA 3CTTA 3ANUA 3MYOA 1I1WA 3S1WA 3MMUA 2VC7A 3CU2A 3NSMA 5I77A 3WBEA 1U2YA 3ERPA 1EHNA 2FVLA 2ZX9A 4I8YA 1ONXA 1QO2A 3OLDA 5HANA 1IXNA 1XX1A 4UTLA 4PZVA 4LS1A 4ENLA 3B0XA 3FS2A 3NO3A 3FJ6A 3SRFA 3IRSA 1RK6A 2YCJA 4GG9A 4YPJA 3XINA 1WB0A 2NLIA 3TP4A 2D0HA 4US5D 3BAKA 3LHZA 4N4PA 4O0ZA 4DJEA 3S9ZA 3I7SA 1DBTA 2GYIA 2WCGA 3ES8A 2HQAA 4OWGA 1IWAA 3KUMA 4Z1DA 3BLIA 1LBMA 3IIXA 1Q4WA 4WHBA 1A0CA 4I90A 2J6XA 3A12A 4RW5A 4B16A 1K7XA 4RXGA 1R9ZA 3AIEA 4KERA 4A29A 1H1ZA 2YCLA 3TFCA 2BP1A 1PX3A 1WUEA 3BCFA 1FP8A 4WJXA 1RV8A 2ADAA 2Y7EA 3W82A 1ZAJA 4Q8MA 3RCNA 2NZLA 3LNMA 3MHUA 1R3TA 3PZVA 2ZXAA 3DFOA 2CBUA 3BO9A 4E8DA 3OZYA 4K8GA 3IGXA 3OHIA 4NZ3A 2YKKA 4YVPA 3S9YA 1XJBA 4RUBA 3GHTA 4D8LA 3GU9A 3P2VA 4FALA 3SCWA 4QGCA 5M3WA 3UR5A 4IG2B 3AS3A 1H8EG 4UCGA 2ZX5A 4W7VA 1XIMA 4L1WA 5I3JA 5KEZA 4DXXA 1FUYA 2GGJA 4BY3A 2G3NA 4XBKA 3W7QA 2OKTA 2BX7A 3I6EA 4TX6A 1UW9A 2E9LA 2VDGA 3W85A 1PZ0A 3ITTA 4LCQA 1E0UA 1G01A 2WMIB 3UPMA 5RUBA 1QCWA 1UD5A 4XKYB 4I6VA 4WEVX 4FXRA 1B1YA 3HPAA 3L2MA 4BQ3A 4PH6A 4LW7A 1T8QA 2J27A 3O3RA 1H63A 4XZ9A 2WSYA 4DJED 3B0VC 4LYRA 1ZCOA 2OYKA 5IDIA 2Y8VA 3ARWA 4AZGA 3M0XA 2WVTA 4FXFA 2ZA2A 3L4UA 1KBLA 4TUFA 3P0WA 1TJ2A 1AK5A 1XINA 3URBA 3R12A 4YTRA 3ZZ1A 2QMKA 3NCOA 1ZU8A 1E0VA 1CI1A 3WUEA 2FB3A 5EMJA 4BCEA 3EWCA 2E25A 4IIGA 3LMZA 1JDFA 4C7GA 5A6LA 4ZTYA 4OVXA 5A5WA 5IBXC 5MKGA 2VGBA 1JRBA 1JR1A 1F4HA 3CNYA 1UMYA 2QUMA 1ZY9A 1AW1A 3U0HA 2PC8A 1US2A 3PC0A 5FSEC 2PDLA 1A5OC 3NDOA 2NXHA 4K7VA 2NW0A 3ZVHB 4NJIA 4A2RA 1IT8A 3IEBA 4ICCX 4FNSA 2NQ9A 4L9XA 3IIVA 2ATSA 2DFAA 1M68A 5CJ5A 2HS8A 2A7PA 3BH4A 3R43A 1FWBC 1KRMA 2SFPA 2WK2A 1CX9A 2QV5A 5CPMA 4Z08A 3ONBA 1LQ0A 4HA1A 1OK4A 2W0UA 1J2WA 1QUMA 2VFIA 1LF1A 2HBVA 4JIIX 5AVNA 2VGFA 3S5SA 2PWVA 2W4XA 5I07A 4JDBA 1YDOA 2FMOA 3E2SA 1OFEA 3AXIA 4IUGA 2Z2UA 3VGDA 5EB8A 1AQFA 2V3EA 4Y90A 3CV7A 3QLLA 1UZDA 1XBXA 4MNKA 5HQEA 3CV1A 4EPEC 1IEQA 4N9DA 4RPPA 3E5PA 3THQA 4L4OA 1KWKA 3HB9A 1ZL1A 3W1XA 4HMDA 3TDFA 1MXSA 2HCVA 5CBJA 3F4DA 2A5HA 1JYNA 1SJCA 3WQVA 1REQB 4JIRA 3RUBL 4JTFA 5AC4A 5KZDA 2YFOA 3N19B 3A4JA 3SZ8A 3CQ0A 3KRZA 4MTVA 4KRUA 3WQFA 4AYSA 3LI0A 3CV6A 1NDVA 3ZJ6A 3H7UA 5I3DA 3GTIA 3QV9A 4NU7A 4GNJA 3VIJA 5CSSA 3U2EA 2PDIA 1ML1A 1JUKA 2XFRA 3WG6A 1E1CA 1K8ZA 2HBXA 4X60A 4LVDA 4LXFA 1YIXA 5FESA 3A5FA 3LSCA 4UB9A 3GB6A 1F73A 2HZGA 3R13A 3G8EA 3BSHA 3DI1A 4S39A 1PXGA 3UVAA 4AISA 4W4QA 1FDJA 3ELFA 2V5LA 1P43A 4IXHA 3W7OA 2WYSA 1OZMA 3BOFA 1TTPA 3DKLA 1XLGA 1EJ7L 4N02A 4IGNA 4EXBA 1CXKA 1W1VA 4YWSA 3P62A 3VDHA 4Q33A 3JR2A 3WCZA 2GUYA 2REQA 2FHFA 1I0DA 3BSMA 2CXEA 4GGHA 1BGGA 2DORA 3CK5A 2DIEA 4PMNA 3WMLA 3EOLA 4CNUA 4RKAA 1AQMA 4ZTXA 2PLKA 4A3UA 3NWRA 2PPGA 3HQOA 4AZIA 3BW3A 3W2NA 1ZALA 3OEXA 4CD6A 4AH7A 3TTQA 1SO5A 4ASTA 2I7GA 1RQEA 2ODOA 2FZBA 1SYTA 1S2VA 1LLZA 1P6CA 2IPJA 1W1ZA 2YXOA 3I68A 4OE7A 4C90A 1W54A 4QLLA 3T9PA 4LRSA 1JZ7A 1UZHA 3GDMA 3PZ9A 4AD4A 3W01A 3BGGA 4QNEA 1ZP4A 3M0KA 3N25A 2Z7GA 3OHMB 5EBAA 2QLYA 2HV5A 5H91A 4AD1A 4DF0A 2I14A 3GC4A 4GBUA 1K9TA 4M82A 1K6WA 3H6OA 2R91A 3PZQA 5BXPA 3EKLA 4LEFA 3VIKA 4R3UA 3CH9A 2INFA 2OGJA 1GQKA 3CB8A 5REQB 3W87A 5LNSA 1BVNP 2YL9A 1KKRA 1V0LA 2ZTKA 1EJVC 1GTEA 1V51A 3ITXA 4FLQA 2OCZA 3DGRA 2DSKA 2INZA 4Q8WA 4O53A 1O67A 4IISA 2F9RA 3AYSA 3BMXA 4BI6A 3NA8A 2QCNA 4ZR8A 5A6BA 2WW5A 1FWJC 1Q2SA 1FDYA 3MCOA 2HS6A 4HU4A 4U2ZA 4GO8A 1X7FA 4JEJA 3P84A 3I4EA 1M5WA 3RCYA 4DO7A 4PMDA 1L6SA 1EB3A 1S5TA 3VPLA 2CKSA 1F6YA 3WH7A 1PBGA 1EXBA 4MFEA 2ZADA 1MZRA 3T2OA 4NQ1A 3NJ3A 2GVEA 5HMSA 2QCGA 3SUSA 4E3VA 1X98A 1E4IA 1HQTA 3E02A 4TVCA 3BXWA 2YW4A 3T4CA 2Q6ZA 1UASA 1VQTA 1SO6A 1GTHA 3QW3A 4TOQA 3RO6A 1UBPC 3WFAA 4IM4A 4CU6A 4CNNA 2ZXBA 4JTLA 3CQKA 1CEOA 3UWQA 5AB3A 4N6FA 4NJKA 5DLCA 3G1DA 3L0KA 4F0MA 4P5UA 3W7KA 4HU0A 1PKLA 4C6OA 3HPSA 2G50A 3USZA 3SEPA 4XAYA 3DHUA 1GK8A 1JUEA 4MUPA 1BWLA 5I3HA 4LU0A 1UJQA 4AZCA 1EO7A 3D5HA 3BAWA 3DAQA 1WZLA 4DJDC 1ZUAX 1EBHA 2X7VA 4DWSC 4A21A 3SUTA 1O12A 2R82A 4GISA 3SN0A 5I3KA 2CW6A 3F4WA 3RM4A 1B30A 4Y6GA 2PTWA 3DI0A 3VD7A 2BLEA 2C15A 2VX5A 3FDGA 4GXMA 4TIMA 4KIRA 3NQ8A 4MM1A 1HG3A 1F6PA 1J18A 2XFYA 1R46A 3H26A 1RPXA 3TQKA 3PHAA 4F48A 1ISYA 2UY4A 1TPUA 1A5BA 1H0IA 3R89A 5D9OA 4EIVA 3II1A 5AN7A 8TIMA 1TWWA 1KC7A 1O1ZA 1F9CA 4BEUA 2WHJA 3P6LA 1JZ3A 4GIYA 3MPGA 1TPB1 1O4UA 3LU2A 4WK9A 1H5VA 2YIHA 2RGLA 3MKKA 1RCQA 2OFJA 2OU4A 3W74A 1IEVA 1WZKA 2YLAA 4FI4A 1WUFA 1EIBA 2C0AA 4Y9MA 2F84A 1LT7A 2ACRA 3A6OA 4QE4A 3GTFA 5C9UA 2ZBTA 3LSBA 4QSFA 1IEIA 3M44A 5CXPA 2GGIA 1C29A 1QJWA 2EQDA 1R3RA 4AY7A 4Q8OA 2ZWYA 2C91A 2HPMA 3OIXA 4IQEA 3PTMA 4GI8A 2V9DA 1Z42A 1H7RA 2H9AB 1DL3A 3NZ1A 4KFOA 3TTOA 5C55A 2ZFAA 5G4HC 3WNKA 3FGCA 4IFKA 3VMOA 4BQ5A 4GYFA 1KM0A 1Y0EA 1NWUA 2AL2A 3TZFA 3LGEA 4JIHA 1TPEA 3H2CA 4YNGA 4LAKA 2OT0A 4PR4A 1O6IA 4MUZA 3EX4A 1D3HA 1XL9A 2QF8A 2ZXDA 1F3XA 3VKBA 3UZ5A 1HX0A 2VYOA 4F8XA 5AHNA 3N2XA 3UZXA 3MP3A 4M19A 3N13A 1P1XA 2IXUA 3CUXA 3VC6A 5ABHA 1UPPA 4YHEA 4D1IA 1QHPA 3A3HA 3TKFA 3LHYA 1OK6A 1QPKA 3WLHA 3WQCA 3EDEA 1LWJA 1JI2A 3G1FA 3QYSA 4ERAA 4U33A 1OZQA 2ZVIA 3EMZA 2PWDA 2YDRA 3VKDA 3WK0A 4GKTA 4DYJA 1SO4A 3K4DA 3O9NA 2XH2A 3AAMA 3AHZA 1TQXA 3G1VA 2A21A 4S3DA 1UCWA 3FXYA 1N7KA 3LTYA 4X0NA 1K9EA 1R38A 3R8HA 4MB5A 5LIYX 2VENA 1CXHA 3HGSA 3V18A 3H2FA 3TJLA 4F2UA 4D6FA 3W6YA 3I7RA 1K6AA 4TV5A 2WPBA 5FAGA 1V3IA 3L4WA 4R9XA 2G4JA 3AXKA 1TA3A 2CWXA 3O15A 4AIOA 4D1JA 4ERGA 1HT6A 3IV8A 3WQPA 1QAPA 4FK9A 1PX4A 3QHNA 2GJRA 1QNVA 3C0SA 3GG1A 1WNOA 3ARTA 1HKKA 3PTQA 3AMLA 5CC6A 1XDJA 5DMYA 4KEVA 1FCVA 4DBWA 1GVOA 3EOOA 1UKPA 3KRUA 4MWAA 3DG7A 2XINA 6TIMA 3GH7A 1A5LC 5FF0A 1A5NC 1B31A 1GVEA 1U5JA 3MT1A 3C2VA 2JKAA 5D2TA 1JNDA 3C0JA 1Q6DA 2BVDA 4G9PA 2J75A 1Q5MA 1MUWA 1UD6A 5IBXA 3AS0A 4DB7A 2IS7A 3HZ3A 3GBDA 5F2GA 2DZXA 3F03K 1EWEA 3A47A 4K1WA 1EYEA 1JYVA 5BNKA 4YTSA 3MVIA 2PU1A 3G1SA 3I3EA 1LL4A 1XLCA 5D2YA 4DUOA 2D0GA 1DIDA 1GVFA 3GU1A 2J9XA 4NVTA 3GNOA 5HULA 2VUYA 4KCVA 1V6YA 1PHQA 3GUWA 3WNMA 1MW1A 2BXZA 1NY1A 3RF9A 2ZUMA 4AIBA 3XISA 2BHYA 3INPA 4JL1A 1EKOA 4PE8A 5LZLA 4DXVA 2VRQA 2C18A 2WJFA 3N04A 2VQUA 4HKPA 4LUJA 1F3WA 1LRTA 4M24A 3T0DA 1ZTVA 3QR1A 3AAGA 4UFKA 3NQ7A 1WBJA 1T0OA 3UY7A 5GJMA 3OVRA 1J9YA 4DBDA 3TW9A 2B7QA 3KRSA 4XG1A 2YYUA 2X40A 4GVFA 1M7XA 3P80A 4QFUA 3KCJA 4AFYA 1E9LA 1JPKA 3MANA 5HWJA 1VFTA 2GQ9A 2PDUA 2ZZ2A 8XIMA 4WY0B 2XSXA 1P0NA 1RXOB 3PF3A 4CNOA 4TVUA 5T9CE 3TTYA 3DFHA 3IJQA 1GOIA 1QNQA 1E70M 2R1LA 2UV8G 3O06A 3WQ4A 3L4TA 2GVYA 3VGGA 4BF9A 1CGWA 1G69A 4ZZ9A 5I09A 2XYLA 2JJ1G 3GTXA 3BAJA 1TWDA 4MWAE 5AZ1A 4JN6A 1GKPA 3BVJA 3WF0A 1SW0A 3GC2A 1HJQA 3UZWA 2E0PA 3T4WA 4CQAA 3REQA 3A4AA 3ZWSA 4DI9A 4EK7A 4N6EA 5BXSA 4PB4A 4I8DA 4UTKA 1V7AA 4UR8A 2BGNE 2ZIDA 3QTPA 3WBYA 2PZ0A 4H9UA 3AXMA 1BYAA 1J0JA 1O7AA 2XIMA 2OOGA 4E4FA 4LCRA 4JS3A 4GCXA 1FCBA 4H7ZA 3UR8A 3UETA 3T7VA 3S4TA 2X2GA 1W3LA 4IMCA 3O07A 2OSXA 3RPMA 3EB4A 4G5DA 2VT0A 4XTDA 2ZC1A 3SN1A 1POKA 1QI3A 4BS0A 3BLPX 3C0QA 1OYBA 2QHAA 5FJUA 3P74A 4AC7C 1NDZA 1O5RA 3TXZA 5D02A 1QPNA 1NF0A 2H3BA 4MDOA 3LPGA 3CMJA 2D73A 1T8XA 3ZLFA 2CHOA 4DAFA 3WMSA 3MUAA 3A4WA 1M04A 4UFMA 4PRRA 1E4MM 1Q8AA 2A3EA 1FWGC 5TIMA 3MVTA 3DECA 1UB3A 4C1NB 1E0WA 3WQ6A 1MXDA 2QGYA 4CKQA 3GY1A 3SURA 3R10A 4OFCA 4PMXA 4R7OA 4AG0A 1RQHA 1AQ0A 1GVIA 2A0NA 1DXFA 1NP0A 3V35A 3AUJA 1ONEA 4PUEA 4YYCA 3W75A 2CZVA 3WD2A 2B31A 1EA0A 1DWAM 1OWQA 3AFBA 3CASA 2Q71A 3W72A 2OZ8A 1K70A 3TEVA 2C7FA 3VIOA 4A8LA 4POCA 1A4LA 3Q67A 3WNOA 4RE4A 3OQEA 2V69A 4GY1A 5HQLA 1O94A 4RE3A 2DIKA 3OE7G 5FF7A 4C6DA 4BJHA 1DE6A 3RITA 2E5CA 4PMRA 3O6CA 1EC7A 4Z1MG 1P7TB 1T96A 2WOQA 2CZDA 1I2RA 4IH3A 3OTRA 1J0IA 3ZR6A 3AWNA 1FH9A 5DRIA 5D2WA 4OIFA 3W7DA 3TCEA 5LYRA 1VFSA 1XIFA 4LJ3A 2R24A 1BTCA 3QGKC 1BYDA 1PO9A 3V0UA 1EC9A 3HG3A 3T6CA 4LSBA 4LYPA 1V02A 3QMTA 3A3XA 5HBFA 3VI2A 2DT0A 3AIRA 1QPQA 1D8WA 2GQ8A 4P8WA 3TYUA 1EQCA 2VCAA 3UGRA 4RLIA 3TA6A 1S3HA 4XISA 4NZFA 3BC9A 4MYXA 5DELA 3B3DA 1NM9A 3SCQA 1F8IA 4KRZA 2A7NA 1Z89A 5FF4A 3I4KA 3STCA 4XAZA 4DJDA 3V7PA 2ZTJA 1G7VA 2YCLB 4N9EA 2VR4A 2PEVA 4QX4A 1SMAA 1J5TA 1KV5A 5CBBA 5HOSA 4IGHA 1TE1A 2PP1A 5F4WA 3GLCA 4M81A 6CGTA 2AQVA 4K3ZA 4MG4A 2IKJA 2V5KA 3W6MA 1CECA 2E77A 2WKLA 3MSDA 1VAHA 4HTYA 3CL6A 1X8FA 2E6YA 2QIWA 3U7VA 5D37A 4EKJA 2GGGA 2XH7A 4O19A 5AHFA 1PIIA 4K1GA 2LLEA 2PDPA 5CJMA 2FGLA 3LRMA 4ZMGA 3DHDA 1UR0A 4FNTA 1JYXA 3GWQA 1YNPA 3AOFA 5MF5A 3DKJA 4WY0F 1J8VA 3R94A 2O0TA 4JNZA 3H21A 3RR4A 3TK7A 3ARPA 1G4TA 5F4SA 4WJ8A 4WCJA 3FXGA 5CZ0A 3DERA 2FDMA 5BXTA 1LL6A 3K8KA 1XPGA 3GDLA 4DBEA 1FWFC 2JK2A 1A5UA 3NPWA 4FEZA 1GKQA 3GFXA 4A6GA 3M43A 3ZOAA 3ZR5A 4IX2A 3W38A 5HPCA 2E67A 1P0BA 4B4HA 3GSMA 1MMFA 1JG9A 3ZVIA 4GC4A 4Q8PA 4JTGA 3SM0A 1U5HA 2XWDA 3MSYA 4ZXOA 4DWSD 3A9IA 2VEIA 1KQZA 2BDQA 4LNYA 4Z1AA 2ZRZA 1XRFA 4ALDA 1A47A 1A50A 2VFDA 1TJRA 2XPKA 2XN1A 5BU6A 1R2SA 3CMGA 2YPIA 1UH4A 3HIJA 2PDXA 1V02E 1KCXA 1HJVA 5E9AA 2J7DA 3CQIA 1RR2A 1QNOA 2PDCA 4H9VA 4ZL1A 5AHIA 3E3HA 2PTDA 4Q8VA 4HHPA 1Q6CA 4F0HA 3FX4A 2C6QA 2VZVA 5IXEA 2C8NA 2YX0A 4JTEA 2GJXB 2WVSA 1W3HA 2Z1KA 3VIIA 2ZRWA 3TWAA 4M56A 2VEGA 1WKEA 4C1LA 2GOKA 3JS3A 1U33A 1UKOA 1UIOA 3EPNA 3LX9A 3LBMA 5C2CA 1AA1B 1FCQA 1V0MA 5D9PA 3BAIA 1QK2A 1CLVA 1D9EA 2A7RA 3H22A 3H8AA 3GTHA 3FW6A 1D7KA 4N9BA 3L0GA 1OGBA 3SBFA 1P6WA 2QZRA 3VNIA 5KMYA 4KGLA 4QLKA 2OWCA 3DFYA 3RDKA 4HOWA 4NI3A 3FKRA 1AH4A 3KW3A 4KS0A 4WSHA 1TWZA 1SZFA 3PZTA 4RZBA 2JE8A 3SJNA 4C60A 2CNCA 1ME8A 1I0BA 1B9ZA 1YXYA 4KH2A 3F2BA 2WMGA 4J40A 2VX4A 4WX2A 1LL7A 1V6VA 2QE7G 3GNNA 1OX4A 1X1ZA 3P82A 3S2JA 3WH5A 2CXGA 1WP6A 3NXLA 2A3HA 1E1CB 1E5NA 7A3HA 3GVGA 4BHYA 2FKPA 3IGSA 3ORWA 2DH2A 4M51A 2G3MA 4DUVA 3ZR4A 2FMNA 4D6DA 1TPH1 3CBWA 3R8GA 3C8NA 1UA7A 1NOWA 3KTCA 3SRKA 4W88A 2Y89A 1QXLA 1WXYA 4CD7A 3W7MA 4GUIA 4XAGA 3CT2A 3SCOA 2O56A 1S5WA 1D3GA 5I3FA 4CQBA 3NYDA 3GXFA 1V0KA 3OBEA 2IQTA 2OEMA 3SQLA 2CZEA 2WO5A 2XM1A 4I5UA 2DV0A 1DJHA 1DQWA 4LF1A 5HJYA 1Q65A 4I6KA 2IPFA 1IGWA 1QASA 3IUHA 3IK4A 2WZTA 1WKFA 3T0BA 1VFLA 2GLKA 3WENA 3KTXA 5I2UA 3TOYA 1TWSA 1JD9A 1U5VA 2QCCA 3N1AA 3W1RA 1EOMA 1PZ2A 4DM1A 2Z2AA 2D2HA 3LENA 3KOWA 1EQPA 2CLPA 2CU0A 3EDKA 3TC6A 1XH0A 4QEHA 1X8CA 4F2BA 1W91A 2BFGA 3D0CA 3LCXA 2NQZA 3VIGA 2AGTA 5JUVA 4D6EA 4I9JA 4ZB2A 1W9DM 3ANYA 1H1YA 2GJNA 2VTFA 1AG1O 5A8MA 1UD8A 2Y5JA 4UFIA 3H7VA 3MI3A 1LQAA 3RGTA 2BBFA 2EHHA 4K6AA 3EB2A 3VDBA 4XVEA 3CIVA 3IJLA 3LTPA 3L65A 3OW1A 2ZRVA 4JKMA 5EMKA 1BKHA 2DPEA 1V3LA 3VINA 3W1UA 5L9FA 6REQA 1M03A 2FB2A 1AZ1A 2CFFA 3VGHA 5A94A 3BJSA 1V6TA 1QOPA 5GNXA 4S23A 4L9YA 2YR1A 4HB7A 4NRRA 3TZNA 3UBPC 4IPPA 4Y9NA 3LM3A 4DHGA 1QW8A 4IFRA 4CU7A 4R85A 4ERIA 2A4AA 2JQXA 3WQ8A 5HMDA 1MO0A 2E8YA 3TAKA 3CAKA 3SQSA 4Q4MA 3OFNG 4H6KA 1RH9A 2Y1HA 1J4EA 1HXJA 2XGZA 2PP3A 3AS1A 2JIWA 4MKSA 3M46A 2Z1VA 1LLWA 3TQ0A 1NFPA 2YXXA 1AQHA 2X0YA 3C8FA 4GY0A 5HNTA 3B8VA 3TE9A 3EOEA 5H1WA 3BZGA 4DNMA 4GI6A 3V16A 4ZQCA 4CD4A 1KKOA 4H19A 1UROA 3W1PA 1EEPA 3WQGA 3B8WA 4AIEA 3B03A 1ZBCA 3VDGA 1R7OA 2XHYA 2PF8A 4KBXA 4HYWA 4QNWA 3IGUA 3E12A 5JH2A 4ONVA 1JCYA 2PAJA 1JRCA 1XIEA 3NGJA 4IPJA 1EZWA 2CITA 2WBKA 3FCPA 3QKZA 3CUHA 2XN0A 5HNNA 1DJXA 5LNUA 3DFNA 5A6JA 4O10A 4NZ5A 1TJ0A 4HNLA 3TX9A 3U7BA 5CQ1A 4AZCB 3N14A 3TH6A 5KZMA 4YJ5A 3QF0A 1ZJAA 3L9CA 2O4MA 4AB4A 4NAEA 1DIOA 4B5WA 4TR9A 2Y0FA 2DGAA 4OHQA 1TYGA 3BK0A 4QITA 5KZ6A 1ITXA 4UTTC 1TTIA 2YJQA 1OGGA 2XN2A 2FH6A 1YBQA 1JAEA 3MMWA 3HMJG 1VJIA 3JRKA 3EMQA 2UY5A 1PTGA 4H7CA 2PF0A 1UR4A 4YN5A 4E8CA 1F61A 1K03A 4PCFA 1TJPA 4WSKA 2F8QA 2I17A 4URIA 3T81A 4JN7A 2ESCA 2C1GA 1IE7C 4RV8A 3QZEA 1CENA 1ICSA 3C52A 3B9OA 3L12A 1X97A 1GZ1A 3SY5A 4FNQA 5XINA 2O4QA 4TTUA 2BY2A 2H6RA 5EA9A 2IKGA 1VRXA 1SSGA 3UXIA 4JX4A 2J74A 3TYDA 2W62A 2V38A 4UQ9A 4FNPA 4RE2A 1OBAA 2WHKA 4HN8A 1KV8A 2WNQA 1KRCC 4GACA 4JX5A 5I23A 4LNCA 2GSHA 3B8UA 4XV0A 3GDBA 1PV8A 2NVAA 3GVWA 3FGCB 2VZOA 1BKSA 2FIQA 1GW9A 1Q13A 1OABA 4AZ5A 3W3OA 4C5ZA 4M29A 3CZ8A 4KF1A 2OTDA 4XD5A 3WNNA 2QJMA 4PMZA 5HR7A 5DBTA 3QZ6A 1L2UA 4J1OA 3KL5A 2BXYA 1FQ0A 4C7FA 5XIAA 1Y5XA 1KA9F 3LK6A 1ONRA 2O9RA 2WMFA 2Z27A 4JTCA 2PWHA 4NSBA 3ENLA 2PBGA 3FVDA 1DXEA 3I3BA 3UYIA 1KM4A 3S8HA 3WDPP 1E6ZA 5JMUA 2GZXA 4LPCA 3VCCA 5ECUA 2CLEA 4HBKA 4B15A 1NSJA 3GS6A 4GIEA 2IUZA 3VXGA 3NYZA 2Y63A 3WH9A 1XIBA 4J5NA 2VO5A 4GZEA 1M3UA 3NQFA 2JKEA 2QIIA 1CGXA 4AW7A 1THFD 5AC5A 4HNNA 2R14A 1RVKA 3TSMA 2XIQA 4IXXA 1GOWA 2TPSA 3GXPA 2JDIG 2PB1A 2ISFA 5KETA 1L2QA 3SN4A 1UD3A 4OBTA 3STFA 5CEWA 1MI3A 1EGMA 2J66A 2I9UA 2X7WA 3N29A 4A4AA 3M6DA 5D33A 2GQ3A 4HK6A 1Q6FA 2XVGA 3S1VA 2X30A 3AO0A 5DF0A 3MA8A 3F2DA 3S2NA 1YTKA 1DIEA 1U1UA 4MB1A 4PUUA 4G56A 1OD8A 3IAQA 4S3FA 5FEWA 5IHRA 4GC3A 4DYEA 2W66A 3M0MA 5E0KA 5LGXA 3ZIAG 5KSWA 2G8ZA 3CO8A 5JQ9A 4GI9A 3WLLA 2Z1BA 3VIMA 3EXTA 4WF7A 5JXQA 3NOEA 6ENLA 4Z2KA 1TPVA 3KP1A 1G67A 1AODA 1UOZA 4NYUA 4QBXA 3NL2A 3P5ZA 3OVGA 5A6TC 1KO0A 3IVTA 1K77A 1WDWA 1Q3NA 3RAOA 4ES4A 3WD4A 2QJIA 4O12A 1YADA 4DJFD 1U30A 1LYXA 1N8FA 4GX9A 1VFHA 3GG0A 5DT7A 5TNVA 2AQWA 3WUGA 5GPRA 5CPNA 2I5IA 2YBTA 4DO4A 1QK0A 1NQKA 3TJIA 3PFRA 1TMHA 1SGJA 1CDGA 4J3UA 3TYEA 3WNPA 2V5BA 2Q3RA 2C13A 4I9TA 1IQ8A 3VFCA 2V0TA 3CC1A 1H11A 4IMDA 4FXSA 3ZT5A 3GXIA 1KBJA 3D3AA 4LV9A 4FSAA 1GNXA 2VVSA 4JR5A 1A80A 1Q6OA 3AIUA 3THAA 3WF3A 4FXJA 3R79A 1P48A 1UKQA 2EBNA 1PSCA 1KCKA 3VILA 4Z2IA 3H53A 1CTNA 1B3OA 1ZJBA 4O17A 1V3JA 4IIHA 4TT3G 2TMDA 1Q6GA 2OWWA 4ZQRA 4EPBC 3UZZA 3UQNA 2VCCA 4R27A 2YBVA 2J9ZA 3NGFA 5E6ZA 3O7UA 2FGBA 1UOKA 4M6QA 4XIMA 4DBSA 2YCIX 3SIMA 1VJZA 1ITCA 4Y9PA 3E0FA 3QQWA 4LB4A 5CAHA 1E9YB 1ISXA 3KWSA 2XDFA 1DYSA 2PDKA 4X9SA 1FFQA 2DP3A 2R94A 4O1CA 3MUZ1 2WKGA 3MSRA 4PUNA 1GORA 3A5VA 3HFYA 1YXCA 4HPNA 3TN4A 3IK2A 4U4MA 2ZUNA 3WK2A 4LUTB 1XI3A 3DX5A 3CAQA 4D9PA 3E96A 2X0HA 1B54A 2EG8A 3ZT7A 3HG4A 4WDUA 3WDRA 4UTWC 3KEHA 2ISDA 3WEZA 4YYFA 2WQPA 3EWDA 3L66A 2WXDM 5D2XA 1WZMA 3L0NA 4UTUA 3MKCA 2YA2A 4UIOA 3NQ6A 2FZ9A 5FEXA 3BLDA 3N6QA 3UJEA 4KMQA 3UG5A 2ZUSA 1GPWA 4FAMA 2E3ZA 2EO7A 4AF0B 4ZE4A 3QV8A 3OGVA 2EEXA 1Q63A 2ZRXA 3W29A 3SB0A 2EPKX 8A3HA 3W7CA 1EFZA 1KTBA 3ZJ7A 4CNTA 2OX4A 2HE5A 3TR2A 5BRPA 3E2RA 3GAYA 3VOJA 4NASA 2EPNA 1UYQA 1XLMA 3C86A 9XIAA 5TF0A 5LHFA 3LGGA 3K4AA 4LT9A 4GZ7A 3RCMA 4LAMA 1XRVA 1SU5A 1JGIA 4CD8A 3AXHA 5IFTA 1R8LA 3KL0A 4C7DA 4Q32A 4J27A 3QPZA 8XIAA 1KM5A 1VIZA 2BY3A 4V1YA 2QJHA 3QMRA 1NIUA 1Y8BA 2J47A 2OVLA 3NURA 3WF2A 4EWND 3CHDA 2QAPA 2CHNA 1WX0A 4NI8A 4C6KA 1CB2A 5BYWA 4F0LA 4HNVA 2WMJA 4QLJA 1VHCA 1XIHA 3ALGA 4W8AA 3RFAA 2RDXA 3QY8A 4O16A 3S9IA 4QDPA 3WFLA 1S2UA 1XP3A 1KFCA 4LF2A 1NU5A 1VS1A 3NO5A 1ODUA 3G8RA 3SY1A 1NQ6A 1RY0A 1S39A 4PSPA 2WM1A 3MUXA 1FVPA 2J13A 3K1GA 3GK0A 1GQJA 1E55A 3JUGA 1F05A 2NX1A 1B90A 1YQ2A 1GWJA 2PTXA 4JQ3A 1VYPX 2D0FA 3R2GA 3B9NA 1NP2A 4QDMA 2ZYFA 1VFMA 3IS4A 2QV4A 3MUIA 1SJDA 3CIWA 2QJGA 3EOUA 3B4YA 1S3TC 3ARVA 5C2XA 1EEXA 1K7EA 3IJ6A 4DRSA 3UR7A 3QM3A 2E28A 4LVGA 2VR2A 3EMCA 4KWUA 1HP5A 4MJMA 4E4PA 2POZA 1RCOB 4AEFA 1JDEA 1E9ZB 3C5QA 4H9ZA 4RNHA 3LEPA 3HTWA 3LB0A 3E49A 4M6VA 3TN5A 1UWTA 2NUWA 5FL0A 1YLVA 5HPOA 3W53A 3QJAA 1B4EA 1L0PA 3IIPA 4Z2GA 3M1ZA 2JF6A 4JAWA 4CLMA 4GPNA 2QVNA 1V4YA 5F4XA 1FWAC 4IJBA 4GZJA 1GGOA 4JEQA 1Y7VA 1CB7B 5M1TA 3LCLA 4AVNA 3KVLA 4IHCA 4LWWA 3U3HA 4PCNA 1W9BM 1PJ9A 1QHOA 5FSDC 3GYCA 4KQNA 4MF4A 4S3KA 1IXOA 4AD5A 1QI5A 5BOEA 3KOYA 5C7VA 3VUSA 4REQB 1UUOA 3SGZA 5C9ZA 1E6QM 5FJOA 1S2WA 1OC5A 2V81A 1AFSA 1J5SA 2WC3A 1W56A 5JH1A 1BRLA 2I16A 4EF9A 4IP7A 1M41A 1SZEA 3KDOA 4GK8A 3FJNA 3UCQA 3AZRA 4LBSA 5K2ZA 1WDPA 1XIDA 3SRHA 3W2UA 3RILA 3QV6A 1C91A 4IPIA 2F2HA 3ZYZA 5HMEA 1J2BA 2HROA 4O1EA 3UWYA 3KBVA 1SUXA 4A3YA 4IT1A 3PBGA 4EAYA 2A6NA 2PP0A 3V3WA 2W61A 2GWNA 2E40A 4GD0A 4HYVA 1EGZA 2Y62A 1Z41A 1UIPA 4GE8A 2RH9A 4F0KA 1EJWC 4DWSB 4QAWA 2VWSA 4RR4A 2J7GA 2FJKA 3MP4A 3DESA 2G0WA 4EPDC 1UD2A 3SAZA 2WSKA 1FDZA 4O1DA 4MZ1A 4QCFA 3ARZA 2P8CA 4HNOA 2CC0A 2ZE0A 4UTTA 2E4TA 4LC6A 4HZ6A 2P10A 4GGBA 4JIQA 3FEMA 1LG1A 1OM0A 1EJRC 4J3ZA 2HISA 4HPXA 2VFFA 3D47A 2DQWA 2P8BA 4AZHA 4RDWA 3V1PA 4OJYA 1K8YA 1RP9A 2ZUVA 2X42A 2VWTA 4LBUA 2PC4A 1W5QA 2ACUA 4DXKA 1ITQA 2Y85A 1FKWA 3A13A 4AVOA 4CCEA 5BMWA 1OFDA 3W7PA 5A1AA 4H00A 3CPUA 1Q6LA 5HWMA 4HPGA 3TCSA 4DELA 3GKFA 2FPTA 4KGJA 1VR6A 5I6SA 2IPGA 1LLOA 2VURA 2FTPA 3FV9A 1A0DA 1E40A 3GZ3A 3G3MA 4Q4KA 5AYIA 2WBGA 1O65A 3AHVA 1DWGM 1XBZA 2ZICA 5K9DA 2F6KA 4MSSA 4IOTA 3TAOA 2CLIA 7REQA 1SR0A 4MOZA 2XZ7A 3GUGA 3ATZA 4Q4PA 1M65A 3BLOA 4XK2A 3LV6A 4Z0JA 4YS1A 3VKJA 1KFWA 5ABTA 1YPXA 4UOJA 2Q09A 2BSLA 1WBHA 3CLMA 3R11A 3B8DA 3H4GA 1E79G 2BVYA 4F9DA 1VRDA 3BLEA 5DRCA 4PA8A 1EIXA 3DBNA 2NQLA 1VPXA 2VOMA 1E6RA 4OUEA 4E4UA 3W83A 1XYFA 4QDWA 2E09A 2BGSA 3R1ZA 3L4ZA 2OOFA 1JD7A 2GL5A 5FF3A 5CPLA 5DX7A 3SRDA 3LS9A 4JHZA 4I7UA 3AU6A 4PCPA 3G0XA 3H4XA 2MUCA 1HKIA 4JFWA 3VM7A 4OV9A 4QTGA 4ZFMA 4IGSA 3WF4A 4O4VA 4JPGA 2DSUA 2GSJA 4ZO8A 2DZPA 2DY3A 4ZB5A 3DIPA 3DFPA 1P0DA 4KRTA 4KT2A 1MDLA 4GFSA 1ESWA 2J7FA 3KS6A 4NX0A 3OGRA 3AIBA 3DDMA 5FF2A 2DSWA 5CC5A 2A2IA 1JDCA 1H62A 4AWUA 1CWYA 3MC5A 3N2MA 4ATWA 2CIPA 2VRJA 2R9RA 4Q6JA 2NT0A 2PDWA 2D1ZA 1OD0A 1UHVA 3M5YA 1W2VA 1FWHC 2VHLA 2NX9A 1H41A 1IR1A 1FFRA 2WC7A 3BJTA 3AISA 4CCZA 1E1EA 3QH2A 3GE7A 3MQTA 1ADSA 3NM3A 4J2PA 4Q7BA 1EUAA 1OX4B 3NVTA 4L65A 4GCAA 1V7YA 3OP2A 3TIMA 2A3AA 3WO8A 3VKAA 1C8YA 3KX6A 3LBOA 2ZZ5A 1HL8A 4A8NA 2V2HA 1VF8A 1JFHA 3H2AA 2C0HA 1HL9A 1QPOA 2CWNA 3P81A 1PEZA 4AY8A 2J8FA 1UP3A 1DTUA 4IMEA 1I6NA 2XNDG 2Z4GA 2NSXA 3JVAA 5DT5A 1KGXA 1SZNA 3WMCA 3S2LA 5G2HA 1QI2A 2OZ3A 4UFHA 1EP3A 1Z9AA 1BSIA 8RUCA 3MS8A 3W84A 4PMVA 4W5UA 3NQAA 3UG4A 3UJ2A 3T42A 2ZDSA 2ISWA 4DZIA 3GFYA 4UWMA 1H09A 3NIYA 3UWEA 5CLWA 2BODX 1MW3A 3MV01 3RLVA 2WSQA 4YVXA 3OG2A 4CCDA 1S46A 3L5AA 2OLAA 5CPSA 3UNDA 2EG6A 1V6WA 4B5TA 1PWLA 3LPFA 3UJRA 2WMKA 3ISIX 3N9RA 1J6OA 5D32A 3CV2A 2A3LA 3VIFA 3TN6A 2J7CA 4PB3A 3WN6A 1QNPA 4WOZA 2OSYA 3W76A 1MQRA 4QQUA 2ALRA 1JJKA 1KFKA 1L6YA 2XVPA 4ADUA 5FJIA 1TVPA 3EAUA 2G97A 3TTSA 3UW6A 1LOLA 1OYCA 4DZHA 1NTHA 4BI5A 2YW3A 3M0VA 1XCFA 4PMOA 3GVVA 4H8HA 3W23A 2G5WA 2WSSG 1LUCA 2ABAA 4FLRA 3CUIA 1I8JA 4A35A 1YDNA 4LUSB 4Q4OA 3PM6A 4L6DA 1C90A 3NQVA 2FFCA 4JTTA 5AECA 3OGSA 1T6MA 4UTWA 2G96A 4JHMA 3MDWA 2XTKA 3NNTA 3WQOA 3EX6A 3SUWA 1BTMA 1NAL1 3KHJA 3AYRA 1EH9A 1C9DA 2FHCA 1OC7A 4PMQA 3BLKA 4P7OA 4IMGA 3TYCA 5HJXA 2WSPA 3CM4A 5HWNA 3I3DA 1GHRA 4UNLA 2HVNA 1PX8A 3E9AA 1HN1A 3V75A 1FWSA 4G7EA 2DEPA 2BHUA 3RXZA 1W1TA 3GXMA 2WMHA 1BQCA 4C6BA 4DBUA 4O52A 1O5QA 2VEPA 2G3JA 1MUCA 3GVRA 1ZSXA 1AJ2A 5ENLA 3EBVA 3CHVA 3FNDA 2VMFA 3QVQA 3W27A 3GIYA 4GOAA 3OEEG 4OU1A 2QYGA 2F38A 2CLKA 3ZLHA 1BQGA 4DF2A 2Y6ZA 5EFDA 4D72A 1VP8A 1KNWA 1M6JA 3N3TA 4ZSTA 1RJQA 2DZSA 1MEIA 2V63A 1WA3A 4ZXLA 1FHVA 3ZXWA 1DP0A 3TA9A 4B5SA 1P4CA 2RJHA 4A3HA 1KR0A 1XYZA 4LV4A 1N8IA 1YW1A 4Q7NA 3LY0A 3V5CA 4NAEB 4C6CA 1JNEA 3UEQA 2NQJA 5C2GA 2D20A 5E9XA 3QBUA 3VNYA 4Q8UA 3IJDA 1W37A 2WNWA 4V33A 1GVRA 4NJHA 2W9MA 3EEZA 1ZGDA 2AQOA 4Y9AA 1GYMA 1FWWA 4Z1BA 4B92A 1ZENA 3DOPA 2TAAA 9XIMA 5CZJA 3N2OA 1XDLA 5CGTA 3TFXA 2UY2A 3WEOA 2W92A 2C79A 1UKSA 4IL2A 3BOLA 4HZMA 3OG3A 4AX6A 3CHCA 3NM1A 3QFEA 4RNIA 3PP7A 3SCSA 3BLFA 3RO8A 5C0QA 1W0JG 4DZAA 3W7GA 3S6OA 4GYPC 1K9FA 1GHSA 1PVNA 4UOZA 1V03A 1FWRA 3G6LA 3NQ2A 2B81A 1KW1A 3CZKA 4OBRA 4TQTA 2R6OA 4G2DA 4XUYA 1F6KA 3AUOA 1XM3A 4PUWA 2Q8XA 3P93A 1T41A 3WDQA 1ZBWA 3PBWA 4KWSA 2D3LA 1OT2A 1X96A 2KAUC 3F5KA 1F4AA 3AYVA 4IG2A 2YA1A 1ELSA 1EGVA 4Q6XA 3A23A 3GH5A 1MUMA 1VC4A 4X63A 3W1QA 4OECA 4YTQA 2V3FA 3VOFA 4XKYA 3VU2A 3HM7A 1GVYA 2J7BA 1FX6A 1UP2A 2QGHA 4I7VA 2EPHA 4S1FA 3PPFA 4NIRA 1KBKA 2X41A 3W71A 4PUJA 1LZOA 4I7WA 4FNUA 3D6NA 1XYAA 4PTDA 1DORA 3M07A 4QXIA 3HGRA 2GGHA 4D6CA 3LZ3A 3WJZA 4DLMA 4QHRA 1K02A 3UYCA 4BZYA 2XG9A 4A2SA 4EP8C 3P14A 4MWAC 1H50A 3IWPA 1HL2A 1ZBVA 4DM2A 1LG2A 4E5TA 2HXUA 3DYMA 3T55A 2ACQA 1EC8A 4FA3A 1RBAA 1EHAA 3BOXA 5JBDA 3PB2A 4DN1A 1QO5A 3ITLA 5G5IA 3T2QA 4RZ5A 1OCJA 3B9DA 3TJXA 4WDWA 2TODA 2CLLA 4PMYA 3OVQA 1B5TA 4AEOA 4P7LA 4D8ZA 1JPDX 1A5CA 5LIKX 1DWIM 4FX7A 3AIVA 4AY1A 3B0UX 4UQCA 2NT1A 3N4AA 3RNDA 3UFYA 4AXNA 4YTTA 5I5RA 5FEZA 3UF9A 3PBYA 4RDVA 5LNRA 1M7OA 3WKZA 2PLCA 2YBUA 1SPQA 2PDFA 4UFJA 1WDRA 1YXDA 3AYTA 1PB0A 4R5EA 4BF7A 3STGA 3O63A 3WNLA 1Q2RA 1VD6A 5C54A 3NVDA 1BHGA 4MKNA 2QCFA 1MDRA 1RLCL 4N4QA 4JFSA 3NZRA 1KBIA 3ARYA 2X8RA 1AMYA 5BU9A 3IIOA 2ON3A 1PHWA 1LTDA 3T09A 5C7HA 4ATDA 1BXNA 3UXDA 3Q65A 2DJLA 3GDKA 4NXSA 3F2CA 2DSZA 4PYSA 1VFUA 2I5QA 4AYGA 2BHZA 1XLBA 2P76A 4JTAA 2ZKMX 3G5EA 3SI9A 1BG9A 2GK1A 4LY4A 2W91A 1J10A 2OQLA 1K7FA 2DU2A 1L8NA 1LM1A 3EDDA 1XKJA 1RPKA 1X6UA 1F5ZA 3RJYA 3UXAA 1A0EA 4EPKA 4L64A 2PRLA 2V7QG 5I3GA 4HMNA 4IWWA 3K13A 7PTDA 3WD3A 1GJWA 4ZQNA 1GOMA 3U4FA 4DO6A 2Y8KA 4GNVA 1MQQA 1OINA 4C5YA 1KR1A 3KTSA 1QWKA 5EKYA 3IRDA 3DFTA 3H12A 3W88A 5DCDA 4FO4A 2PD9A 3WBAA 2VEKA 1VBGA 3I7QA 1QU4A 1TPWA 5E09A 3GFZA 2QQ6A 2I5GA 3WLKX 1HJSA 3K8LA 1VGAA 1IR2A 3QHOA 3KBJA 2GDUA 1QDSA 2JGQA 3WLTA 1W8SA 3B0YA 2J7EA 3NSXA 1TV3A 4X61A 1M1BA 1EF2A 3LRKA 1WO2A 2CBJA 1LQ2A 1BVZA 3DFQA 4FR6A 2NV1A 3ABRA 1TB3A 1WKDA 1Z69A 3ZT6A 4EANA 4ZFCA 1Y65A 1H0GA 1MVYA 3N18A 4TU1A 4O28A 1KM2A 4GUJA 1XLJA 2D2JA 4GQ0A 1Z44A 3NFUA 2J24A 4WDXA 2WPDG 4NAFB 4MB3A 1XISA 1JI1A 3ICJA 4JTHA 1DIKA 3N4EA 1JPIA 4NHVA 1E9IA 1ECEA 4P61A 4HD5A 1MYRA 3OBAA 1DJNA 1EJTC 5FIPA 1ZJIA 2DW7A 4M8UA 2F6XA 4W85A 3EYPA 1RA5A 3N15A 4DY1A 2X05A 2WZHA 2Z29A 3E74A 3W7EA 3KVMA 1PKNA 4LGXA 4NY2A 1UR2A 2EGZA 3PJUA 4ZB0A 3ATYA 4JCLA 3W1NA 1SFTA 3LCIA 3QXBA 4UTHA 1EA9C 3RX4A 3IVSA 1WCGA 1I4NA 1VB9A 3GKAA 2IW0A 3C0LA 1MXGA 4ZO6A 4PBEA 2V30A 2VUNA 1K3UA 3LQLA 3O8AA 1CZ1A 2CYGA 4M1RA 4XTIA 4UR9A 3TONA 3O6YX 5HMFA 4O0QA 3GXDA 1NDYA 2QCDA 5DMMA 1UQYA 3KVKA 3NQGA 4ACYA 2A79A 1SR9A 4GH3A 4PULA 4MNLA 4QS6A 1CIUA 3HG2A 4QM1A 2YSWA 1TUFA 4UCFA 2BASA 3SSZA 3SGUA 1R9XA 5LIWX 4NXKA 3H23A 2VC9A 3R5EA 3C56A 4FX8A 4PCTA 2ATMA 4MIMA 2BVWA 3HQNA 3S5NA 3PAJA 3OA5A 1A3WA 2QR6A 2FZ8A 4H2HA 4IQJA 3VGBA 4FIRA 4UTIA 4QE5A 4XD3A 3QLDA 4D6HA 3ITCA 1JDAA 3FFSA 4XKMA 2VXNA 5KZEA 4BFAA 3IANA 5D8ZA 3UXLA 4AUBA 1YYAA 5EPDA 2ZOXA 4MY8A 4S2BA 1BWVA 1QT1A 5CBIA 1BF6A 1JF6A 2C1IA 3R25A 2AOSA 4O8RA 2VM8A 1IEWA 5A6BD 1P1MA 3R0UA 1EJSC 3MY9A 2AKZA 1WDSA 4W87A 1KWGA 1I2QA 1XIIA 4EXQA 1IV8A 3MCMA 4O0KA 1W5OA 4FHAA 3ARQA 4D71A 2QDHA 3MO7A 1V08A 4O11A 3F5JA 1JGMA 3WIJA 4PFMA 4JOMA 4JCMA 4L6HA 4X2PA 4LC8A 1A53A 3IJ7A 4HP5A 1CPUA 4Z42C 4IGMA 4WGHA 5AKQA 4I9MA 1AW2A 4MY9A 3PUGA 4GIAA 3SQMA 4AX7A 3WK3A 2WHMA 7XIMA 3QKEA 1BG4A 2WSRA 2XIBA 8CGTA 1NWSA 3E0LA 1Q4NX 2POTA 1S2TA 1EP1A 4MVAA 1ZB5A 2H9AA 3PVFA 1WKYA 1XH1A 1CNVA 3SCPA 3F1QA 2PCEA 2V68A 3BAYA 1QVBA 5I79A 4S2CA 1IEXA 2FQIA 3URAA 4ZOEA 3C6CA 5G2IA 5I24A 1JYWA 5FD0A 2VGGA 1DJWA 3U2CA 3UZJA 2YGYA 3NSNA 4V2XA 4AZ7A 1XWYA 3CL7A 5K4XA 1FH7A 4ORIA 2ZCGA 1BYCA 3OBKA 1JAKA 5GNYA 4L61A 4WR3A 3W2JA 3ARUA 4BI7A 5JVLA 3B8TA 1XCWA 2ICSA 3NQCA 2TSYA 2HWGA 2D2OA 5LGZA 1TFVA 5C71A 1TPFA 4ECLA 4GYPA 3BJFA 1DOSA 1EP2A 3VZXA 2PD5A 5A2BA 3BG3A 1TQJA 3CL8A 1AL7A 1RZMA 4G7FA 1XXXA 4H41A 4NYYA 2W6IG 1XIJA 4QG9A 3STPA 3MTWA 1PL9A 5H8MA 2A3CA 4LUIA 2GVGA 2ZUUA 2WCSA 4GX8A 3LXAA 3B8SA 1Q7MA 4OOZA 2DVUA 1KXHA 2P5NA 2B7NA 2Z0IA 1SFSA 2OLHA 2YCKX 3V4BA 3HN3A 4QRNA 1ALDA 3QMSA 3ZIZA 7REQB 4E38A 2BS9A 2GJPA 1MWOA 4TO8A 4HCLA 3CWNA 1AZ2A 3DU0A 3N73A 3S42A 4YCOA 2V3DA 4HA0A 3QHMA 2PGFA 4MYAA 3U6WA<