1E0UA

Structure r271l mutant of e. coli pyruvate kinase
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
470
structure length
461
Chain Sequence
b'MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PYRUVATE KINASE
publication title The Allosteric Regulation of Pyruvate Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 166
structure length 461
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.33.10 Mainly Beta Beta Barrel M1 Pyruvate Kinase; Domain 3 PK beta-barrel domain-like 1e0uA03
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1e0uA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 1e0uA01
4B5SA 3GQYA 5TAOA 3ME3A 4KCVA 4WJ8A 1A49A 1PKNA 1ZJHA 3EOEA 2XZ9A 4DRSA 4KCTA 4FXJA 4ROQA 3VAVA 3OQ8A 4IQEA 4QG9A 3SRFA 1M1BA 3HQNA 4IQDA 3QQWA 1JDEA 1XG4A 3QV6A 4KRZA 3P0XA 1VP8A 4B5XA 1ZLPA 2X0SA 3HQPA 2VWTA 4B5WA 2ZE3A 1T5AA 1IZCA 4MF4A 4KCWA 4B5UA 2QIWA 1A3XA 3B8IA 4KS0A 4L9YA 3OYXA 4TV5A 4QG8A 1VBHA 4HYVA 2R82A 3QLLA 4L9ZA 3HQOA 4B2DA 3SRKA 1E0UA 3FA4A 3LYEA 2E28A 5JVLA 1KBLA 3T0TA 1U5HA 3BJFA 3N25A 3KHDA 1DXEA 3OYZA 4L80A 1Z6KA 3FA3A 3LG3A 1F61A 2DIKA 1A3WA 4TV6A 4HYWA 4KCUA 1SGJA 2L5HA 1OY0A 4YJ5A 1O66A 1S2TA 1PYMA 1E0TA 3T07A 3I4EA 2VGGA 2OLSA 4JPGA 3U2ZA 2HJPA 1MUMA 1KC7A 3R4IA 1F8MA 4B5TA 1S2WA 2G50A 4LSBA 1XG3A 3GR4A 4B2DD 2V5JA 2XDFA 1PKLA 1PKMA 4MG4A 1F3WA 4QG6A 3H6OA 1T57A 1U5VA 1DQUA 2BG5A 4RPPA 3BJTA 2WQDA 1DIKA 2DUAA 3M0KA 4G1NA 1IGWA 2KX9A 3QZ6A 3QV9A 2VWSA 1O68A 1F3XA 1UJQA 4IP7A 2HWGA 3MA8A 2HROA 1OQFA 1S2VA 3GG8A 3QV7A 3T05A 2VGIA 4YNGA 2XZ7A 1O5QA 3E0VA 3G2GA 3EZ4A 3EOLA 3E0WA 1S2UA 2HRWA 2V5KA 1VBGA 1F8IA 3QV8A 2VGBA 1AQFA 3PP7A 4L7ZA 3E5BA 1A5UA 3QTGA 1M3UA 3SRDA 1PKYA 3KTXA 3IS4A 3EOOA 1DXFA 3M0JA 3PUGA 4FXFA 2VGFA 4B5VA 1GGOA 4IMAA 4QGCA 3SRHA
chains in the Genus database with same CATH superfamily
4H8HA 2W3ZA 4D6GA 1WYIA 3MDWA 4F0HA 3UZJA 1GVRA 1JRCA 5CPNA 2XZ9A 4TX8A 4IMDA 2PDGA 1FDJA 1DE6A 2B4GA 4J28A 2JIWA 1JF6A 2BP1A 2WSQA 4HU4A 4PTVA 1NWUA 2GJNA 2EGZA 5DBUA 2X16A 4JN7A 4PMYA 4AAJA 1Z6KA 2OWCA 2XH0A 2DSVA 3EKGA 3MKKA 4A8NA 4ZO9A 3XINA 3NXLA 3QMRA 4IT1A 4S38A 4LS2A 1GKRA 3I4EA 2VFFA 3LA4A 4XZBA 4Z2IA 4YLWA 3WK2A 1F07A 3WDHA 4G5DA 2V5JA 4Z1MG 1QATA 4MB5A 1HO1A 4LQ1A 1L0PA 1JFXA 3P93A 5A69A 2H9AA 3UWYA 5FF7A 3TH6A 1KFWA 4XWUA 3C8NA 1S3TC 5E70A 4LS1A 4CD5A 3AU2A 3B9EA 3L7RA 2EHHA 3PZUA 3FXYA 3T08A 3U5UA 4CEUC 5SWUA 2PWHA 1EJXC 5A8MA 3RIKA 1XHGA 3ZSTA 3E3HA 1UCWA 1FP9A 4R7WA 3O6YX 3KDOA 3E0IA 2BX7A 3S3GA 1NSJA 2AOSA 1O1ZA 2XIMA 1V3LA 3LQLA 3QY7A 4C6BA 3PJXA 3QW4B 3DESA 3MZNA 2J47A 5H1WA 2J7FA 2YXXA 3AHZA 1T5AA 1GVEA 2FH6A 4CU7A 3MJMA 1RVKA 4L9YA 5XIMA 5A3HA 2YR1A 3C2FA 3CAQA 3S2JA 2AKZA 1TPH1 2D0GA 3ARZA 3TTQA 4CLMA 1UUMA 5CC3A 2IKIA 4KWOA 4HYRA 2CBVA 3N11A 4LH8A 2ZWZA 3LRLA 2OG9A 3GNOA 1S2TA 4PB4A 2WSKA 1E0TA 1GVOA 4E8DA 1JD9A 5KEZA 3WUGA 3AUJA 1W5MA 1WDDA 4IP4A 2VM8A 4TQTA 5FA5A 3DYPA 4FX8A 5A6MA 4DI8A 1JCJA 3T0BA 4O11A 1BVNP 2OZ8A 4ATDA 4GWEA 1L2QA 5CLTA 2Y5SA 2VZTA 2YXOA 3WQCA 3KBVA 3MI3A 3WFLA 1LORA 1EP2A 2HTMA 1P7TA 3OZMA 3PBUA 3V5OA 2FZBA 3WG6A 3TZNA 1E4LA 8A3HA 5CG7A 3RM4A 4LUTA 1T7LA 2XN2A 4JKLA 4K3ZA 2YX0A 4S3GA 4HZ6A 2X30A 2FMOA 3F4NA 3VD9A 1A5AA 1FCVA 3GXNA 2CHRA 4MNJA 3AOFA 3TCSA 1GGOA 2FIQA 1ZBKA 3P62A 4LEQA 4E38A 1CCWB 3IWPA 3TX9A 1Z9AA 2VX6A 1TWSA 1H7OA 4JZ5A 4UMCA 1EGMA 4RR4A 4ROQA 4UB9A 3A4JA 1JG9A 4LJ3A 3PPHA 1RP8A 2NSXA 4K39A 1YDOA 3BGJA 3AXHA 4F2BA 4POCA 3M41A 1LQ2A 3UXDA 4Y90A 2ZZ1A 3CMJA 4OTKA 3C2RA 2HV5A 2OQYA 3ARVA 1V51A 1EX1A 3LENA 4BHYA 5TF0A 5LZLA 1IXPA 4MY1A 3WL1A 2VD9A 2W0UA 3RUBL 4YL2A 1EUAA 3JS3A 4S3KA 2PDXA 2ZUVA 1C7SA 2E6FA 1BYDA 1TA3A 3ABOA 3KLKA 3T2PA 3CS2A 3WLKX 1ISVA 4U3AA 1ECQA 4FAMA 3THAA 2A3CA 4O0KA 2YPIA 1JXJA 2G5WA 3KOYA 4LCQA 2J62A 4KEMA 2WWCA 2PDFA 4IP7A 3NCOA 1S2VA 1CIUA 4QNEA 5XINA 1PVNA 2XN1A 2F61A 1YTKA 1GWJA 4TUFA 1PUDA 3LPOA 3P0WA 1TELA 2R1NA 4CD6A 2YYTA 1YW1A 1KCXA 3M0XA 4E2DA 1RPKA 5I06A 4B4HA 1R87A 2ACSA 2B31A 4J3UA 3W84A 5C7HA 4RNJA 4XBKA 4DNHA 5TD4A 1GYLA 4ERGA 1NFBA 2CW6A 3VC5A 2IMRA 4F0SA 1UKSA 4GK8A 3P80A 4RZ4A 3WZ0E 2AQWA 3IPWA 1X97A 3LXAA 3PFRA 2IPJA 3L0KA 2VEGA 1NDZA 4PUJA 4XO7A 2PP0A 2Z1XA 2D20A 4CVUA 4S39A 3M47A 3SQMA 3GFZA 2AKMA 2JQXA 3O1NA 1T40A 3PWIA 3W7DA 4YJ5A 1EA0A 1N2VA 1BG9A 3W76A 3MPGA 5CEWA 4CN4A 3WUFA 4E4PA 3PY2A 5FD0A 4B5TA 1IWPA 1MNSA 1MNZA 5IBXC 1XLCA 1Y5WA 4ROPA 1Q7ZA 3UVAA 2YZ5A 2BWGA 4J3ZA 3PR2A 2JEQA 3M7SA 1MQQA 1BHGA 9CGTA 3CLWA 3H23A 4A3UA 4A3RA 4LRSA 3NA8A 1BRLB 3KWSA 3K46A 3W1TA 1EXBA 4LCRA 1UD3A 1X7FA 5CGTA 1WB0A 3LMZA 1S39A 5I3KA 3KP0A 2CLEA 3UJ2A 3UR7A 1NFPA 4FX6M 1VFUA 3G1YA 3TYBA 1K8YA 4LAOA 4JEJA 3DCPA 4A4AA 3QQWA 3S2LA 4KEVA 3DHUA 2O9OA 1XRFA 3WBYA 3OODA 1KR0A 1M01A 1XW8A 4V27A 3AIRA 4U4MA 4A21A 2C1GA 4CQDA 3LTPA 1HKJA 1U33A 2EPLX 3S4TA 4QCEA 4AVOA 3H4GA 1YE4A 4QDWA 3AYRA 1VFMA 4DXVA 4GNVA 3G1FA 1M9HA 4QS5A 3WNNA 3LGGA 4QE5A 3F7JA 3GZ3A 3N04A 5KZ6A 4XD3A 1CZ1A 4GVFA 4UFKA 2FPVA 2C18A 2NXHA 1ZFJA 4M5PA 2G97A 3NQCA 3PB2A 4C1NB 2WNZA 5LNRA 5CGMA 2WANA 2AL1A 1S1RA 3NM3A 3GG0A 3GH7A 1XF0A 4YXGA 3OE7G 3NSNA 3WY1A 1PZ0A 3I68A 4DHGA 4H41A 2HNEA 2D23A 4LFYA 2QJMA 5I24A 3D3FA 4B5VA 3Q94A 4GRSA 1KFKA 1KV5A 5TAOA 1GPWA 2V9DA 3U7BA 1XL9A 2YYUA 3GC4A 1JDAA 5CBIA 3S6TA 5A8NA 3QFWA 2PAJA 1OABA 1JZ6A 4UZUA 2WVUA 3UWEA 4PMOA 5MF5A 1UUOA 3W73A 2C0AA 5FF0A 3NO3A 2BASA 3O7UA 1P1MA 3RHGA 1ENUA 4MJ4A 2DIEA 4FK9A 3UPBA 4H7VA 4U5IA 1T0OA 3VCCA 2V63A 1KFLA 3V0SA 4WVXA 4E3TA 1R8LA 4D9PA 1FWAC 1V7AA 4UOJA 3TW9A 4P8WA 4HNLA 3CB3A 1AW2A 2QGYA 4RUBA 4Y9OA 3C56A 3LSBA 1XYAA 4HU3A 3A24A 1U1JA 2J24A 4H3DA 1DKWA 1NU5A 1LG1A 1AD4A 2C15A 3H2FA 1MEWA 4ICMA 4HPGA 3WF4A 1YPXA 1MUCA 5D33A 4NAFA 4C5ZA 4QJ3B 4A3QA 2QYGA 3BICA 1JDDA 1IWAA 2P50A 3NQ8A 4PB5A 3KTCA 4DRSA 4K7VA 3S83A 3AS2A 3M5ZA 4X60A 4ATLA 4DI9A 1LZOA 3Q65A 1QJWA 4LUSA 1S5VA 1UZ1A 3VD3A 1VCFA 1XKJA 4G1KA 2Y24A 1W2PA 3W85A 1E6XM 3WLRA 4IIFA 3UR2A 1EJRC 1OINA 4GYPC 3TMLA 5BOFA 3W9ZA 3LGEA 1TR9A 3ECQA 3NZPA 1BWVA 4WXZA 3KRBA 1HTIA 1JGMA 4GI4A 4PFMA 3QBUA 5I5RA 2P0IA 5CC5A 1Q2RA 4PTXA 1DWAM 2X40A 3FJ4A 3A6OA 2PFHA 1R9XA 4J40A 4K8GA 4Z1AA 4RNIA 3N6QA 3GD6A 4CKQA 2WQDA 3KEHA 2ZXDA 2WCGA 3LLFA 4AZ6A 3VNMA 5HNTA 4BQ4A 3R94A 5FJOA 4PUDA 4UTTA 3TQVA 1WUFA 1ICSA 6XIAA 3TNBA 1MVYA 1MMFA 1MQRA 7XIMA 3W22A 1G1YA 2QCDA 3RLGA 3W25A 2BB0A 3WNLA 2QE7G 4AIEA 3JZEA 2BGSA 4QFUA 3P8JA 3SIMA 1V03A 4PTWA 3MC5A 4BK9A 1R3YA 5BYWA 4JKMA 1VPYA 2WJZA 3WIJA 3THDA 4NZ1A 1WXJA 1PYFA 3RLVA 1EZ2A 3OZYA 3AIVA 2DORA 2EEXA 3AXIA 4PYSA 3MMWA 2AQVA 3LCGA 4WUIA 1W1IE 3P5ZA 3DZ1A 3BQ5A 4CCCA 3UZZA 1VGAA 2QEZA 4O0ZA 3WBEA 5M03A 2GVYA 1GHRA 4R53A 3PM6A 3PZVA 5DMNA 3USBA 2J74A 2ZA3A 4RE4A 2GJRA 4B3ZA 1WXZA 2FJKA 1QAPA 2YW3A 3IJ9A 4RZ5A 5CPQA 1V6XA 2ZC1A 5AYBA 5BNKA 4M7SA 3HGRA 3GK0A 3T42A 4AVNA 5CZ0A 4DUWA 1EL3A 5EMKA 1ZNNA 3PG8A 3T9PA 4IFKA 1S46A 1KXHA 4W4QA 4UTLA 1OQFA 3QV7A 2PWEA 3EMZA 2XM2A 1QHOA 2DVTA 5DN6G 2HK1A 2ZX5A 4J7RA 1DWGM 1QI2A 3THQA 1ZGDA 3UXAA 4AD2A 3W7KA 4KWVA 3G1DA 4NAEA 1TTQA 2EAWA 3WLTA 3KBMA 2FGZA 3RDKA 3UG4A 3FAXA 2P8BA 3N14A 4QQUA 5CBJA 2RKXA 3W38A 3DFOA 2HK0A 3HFTA 3MHGA 3Q4DA 4UNIA 1P0KA 3STPA 4DEFA 2ZZ3A 4Q8TA 4LYQA 1JCYA 3R0KA 5BOEA 3WUEA 3UPWA 1A0DA 4TTUA 3QW3A 2VRQA 1I1XA 1RPXA 3M0IA 1LOSA 1V0LA 4F0RA 2FDSA 4BKNA 1QOQA 4J1OA 2XSBA 3MV01 2J6VA 1XV8A 3FVDA 1EJWC 3GYEA 4IPLA 1M7PA 3AYSA 4GIRA 1WZKA 3ZT6A 4YVVA 4EACA 1ZCOA 1ZP3A 1EWEA 1XYCA 4BI5A 4IMCA 4NU7A 5I3DA 1RV8A 3O0KA 4GIAA 4KMQA 4UTWA 5HULA 3GBEA 4L6OA 5TBOA 3OA5A 2VUNA 1TV2A 1EB3A 3ITOA 2VZUA 4F9JA 4UQ9A 3QOKA 2QJGA 2I5GA 2DZUA 2ZUUA 1T41A 1JCMP 4CNOA 4XTIA 3KL3A 2QCGA 1RP9A 3LLXA 1NDWA 1RJRA 2REQB 1UP0A 1DORA 2VC9A 1A80A 1CLKA 1JCLA 2OX1A 2VENA 2VOTA 2XINA 2CLPA 2DY3A 2FZ8A 3GXTA 3TMQA 2WJEA 1KWKA 2X1UA 5T9CE 2AGTA 1H1ZA 4BFAA 5ABHA 1O65A 1SW0A 2PGWA 4JTTA 1EO7A 3A23A 3CWOX 2J9ZA 1W5QA 3BV4A 3Q45A 1OB0A 2FTPA 1KM6A 1ZHAA 2CKRA 3TKFA 4RW3A 1OADA 2CLOA 5CZSA 3BLDA 3QH2A 4JTQA 1VS1A 3CZGA 4FNPA 4MFDA 1WZAA 1Q7MA 2P53A 1BGAA 3UBPC 2YJQA 1QNRA 4KIEA 4IL2A 3GKFA 1TKKA 3VXGA 4K1WA 1JXKA 2DJLA 4J3VA 4OT7A 3VIJA 4GUIA 5HJXA 3FCPA 1O95A 1RH9A 4L65A 2JE8A 4R27A 3UF9A 3L9CA 1UR3M 3EWZA 4BQ5A 2YGYA 1J96A 3VU2A 1KNWA 1J0YA 3AXXA 5DXXA 3V16A 2WNNA 4AISA 3V75A 2CLMA 2X7VA 1SPQA 2KX9A 3AALA 1WNOA 3WLLA 3T0DA 2PP3A 1JYNA 1OK4A 3MA8A 1WUEA 5JU6A 2JGYA 1OX5A 1ZSXA 4NNAA 5F4SA 4OV9A 1B1YA 4KWUA 3N9SA 3QXBA 2ATSA 2DSKA 4O12A 1TR1A 1A49A 5L9FA 4HZ8A 1MEIA 1RCOB 1VIWA 5G2IA 3G3MA 2W61A 3NQFA 1ADDA 1EH9A 3B3DA 5AYIA 6PTDA 3WQFA 3VE9A 2ZE3A 1M41A 3M0MA 4GGBA 2HXTA 3VTRA 2Z2BA 5AZ0A 4JIHA 4ZOAA 2EPHA 5I3IA 1GK8A 4AHPA 1YQ2A 3A47A 1V3IA 1HO4A 4DJED 5D32A 1BQCA 3NDYA 1E0UA 3M16A 3P67A 1OEPA 4H6KA 3W86A 1POKA 2PTWA 2OLAA 2MNRA 3DHDA 5G1YA 2V38A 1W1B1 4ZE5A 2JALA 4E8GA 3WEOA 3T07A 1EHAA 3IJQA 4J3TA 3HG4A 1E6PA 4NHVA 3UU0A 1X6NA 1Q6FA 3HV8A 3Q67A 1SW3A 3GC5A 2O9PA 3CEPA 3RPMA 3C3NA 3TYCA 3W87A 4WF7A 2YXGA 1CGTA 1WZLA 4NZ3A 4WXYA 4JICA 5FJJA 3HOJA 4YU1A 5F4XA 3PBGA 3GU2A 5IXEA 4YNGA 2CNCA 2A21A 2FFCA 3VABA 1H2JA 4KPLA 3C3UA 4OBRA 3BSGA 1OJXA 4JCLA 5HPCA 2BODX 4RXFA 4HSHA 3CUFA 4MB1A 3KL5A 3SCPA 3BMXA 1Q6GA 4FX7A 3QV6A 2BVTA 1RBLA 4L6DA 5HMSA 5KZMA 2GQ3A 4WZHA 3PBVA 1LUCA 1H5YA 3LBCA 1CGVA 4LYKA 2NQJA 4LAMA 2V0TA 1U5JA 5BZAA 5JIWA 3H24A 1XFBA 2FGBA 2ISFA 5JBFA 1IIGA 2BVDA 3V4BA 2VZVA 2X1TA 1UH2A 2CLKA 4HJWA 4IUOA 5BW6A 1DHKA 3RNDA 1R30A 1XKYA 1UPPA 4WOQA 2QF7A 4O52A 4M56A 4FOJA 1BXCA 3BCFA 4V1XA 2CHOA 1ONXA 3N17A 4Y6GA 2FQIA 3CTLA 1KBIA 3HG3A 2O56A 3LPPA 3W07A 1IE7C 2QF8A 2Z27A 1VD6A 4QITA 1LLWA 4Z17A 1E40A 5F1VA 3ZVIA 5EPDA 3TTYA 2PBGA 4N9DA 4NASA 1D8WA 5JMUA 1N82A 3HTWA 4OQVA 3BLOA 1OC5A 1T8XA 2GVJA 1W9DM 3T8QA 2V5KA 1VBGA 5AC7A 4FO4A 1AQFA 1OFPA 4S3FA 5A6AA 1Y65A 5E1QA 5I77A 1C7TA 1XH2A 3A22A 2BTMA 1XRSA 3HG5A 2FJUB 3IGHX 1I1WA 3A5FA 4TTGA 3VGBA 2DZPA 4ORIA 3VUPA 2XNDG 5CPLA 4NP7A 3MKVA 3N29A 3LCXA 4LALA 2MUCA 3N4AA 4Y7EA 3S46A 3QZAA 1UWQA 2J13A 1I2NA 1PB0A 4CUCA 4CCDA 4J9JA 3QMTA 3BMVA 2GZXA 3RLHA 3LCFA 2GGIA 4V2XA 2PC8A 2WNQA 1CDGA 4TOQA 1WDQA 1X8FA 4URIA 3MMTA 1EP3A 5I2UA 1WKDA 1K3UA 1SSGA 1A5OC 4M82A 1QCWA 3QJAA 1NARA 1TTIA 5HJLA 4N9BA 1P6BA 3QGVA 1VIZA 2QXWA 2XIOA 3VNJA 5KZEA 3RM8A 4D2JA 3T44A 3CIWA 4MJZA 5HNUA 1JEZA 1XLBA 1FWHC 1HVXA 4BCEA 4DJFD 2A7NA 2W6JG 2ODOA 4L64A 3EZ4A 3LZ3A 4ZZ9A 3PUOA 2E25A 4A2SA 1ZPTA 1FH8A 1PWLA 1XIFA 3NJ3A 1H11A 4Y9AA 4JYFA 1PDZA 5D9NA 3H7VA 3LRKA 3HG2A 4HNTA 3EKZA 3ZJ7A 3UR8A 4LNYA 2J9XA 3SCTA 3QVQA 4KRZA 2GGJA 5HWNA 4YIWA 2DW7A 1LTDA 4DO7A 2CERA 2Y89A 4KCWA 4QR6A 4MZ1A 2Z00A 2EJ1A 4DYKA 3CHVA 1XXXA 2QVNA 3U4FA 5LGXA 3LCLA 2E77A 1BLIA 5I07A 2WMKA 1R7OA 1UOZA 1WV2A 4GY1A 3RK8A 4AYSA 3TFXA 2XM1A 3MUIA 4U3CA 4JX6A 4AIOA 2QZRA 4M6PA 3SN0A 3DI1A 1JI1A 3M0LA 4EANA 1TE6A 1SU5A 3APTA 4B15A 3W83A 4AZGA 3MW7A 3SURA 3WEZA 2XYLA 3TNOA 3RCNA 5A8QA 3WLOA 1LLZA 4ZB2A 3W71A 2Q01A 2V30A 1GZGA 1UWSA 3E2RA 1E15A 2GSHA 1TCMA 3T0CA 3R89A 3EGJA 3FIGA 1EPVA 4HK5A 5GQBA 1RVGA 4QROA 4FNSA 1FRBA 2ZUNA 2DH2A 3CT7A 4FNRA 2XZ7A 3V0TA 4DF0A 1LRNA 1E4IA 3ITXA 3SFWA 1F8IA 3QV8A 2YCJA 1UP2A 3G3DA 4JN6A 2HVOA 1B9ZA 4ZQPA 3O16A 4DYJA 3W7NA 3T81A 3OO2A 4WKAA 3CL6A 4AG0A 1FUYA 3TONA 3CL7A 1KM3A 4L6HA 4IQDA 1KW1A 4M3PA 4AD0A 4B5WA 3D0CA 3AFBA 4W89A 5E0FA 3A3XA 3DC8A 1XYFA 2IKHA 2NSOA 1NWTA 1GOMA 1OCBA 2NLYA 3GG7A 4TXEA 1B4KA 2HISA 5A8OA 1W9XA 1E6NA 4H7ZA 1O12A 4NJKA 3CAKA 3PZGA 4N4PA 3ZIAG 1DOSA 4O14A 1P43A 1FWWA 5E9AA 2XVNA 3LV6A 1PWMA 4CU8A 3K8KA 5D38A 1UA7A 1B3XA 2OFJA 4LT9A 3U6WA 3ZLHA 3U48A 4HN4A 2XWEA 2V3FA 3W01A 4C60A 3O6DA 2R94A 1DIKA 4ILSA 3CHDA 2BS9A 3WD4A 4ZTXA 3ID7A 4HMDA 1OGBA 1JQVA 1AODA 2NQLA 2ZXQA 5MKGA 3G0UA 4RV3A 4HU0A 3WD1A 9XIMA 2ZZ2A 3RF9A 2PRHA 3EWCA 3MS8A 2ZX6A 4I9TA 2H6RA 2OB3A 5D2TA 3MO4A 1RY8A 3GTXA 3T0AA 4YTTA 4GYPA 3UYCA 2VGFA 1XLKA 3OBEA 1V0NA 1WKFA 2E8ZA 2HPIA 2XSXA 3GU9A 5FESA 5DMYA 1NQ6A 3VGHA 3T4CA 4AWSA 4ZOBA 5IFPA 3WQDA 1HXJA 1JL8A 3EX4A 2GDVA 4CD7A 3WX7A 3BANA 2G3NA 3WH5A 1KBKA 4J5NA 4NRSA 1G5AA 1XIMA 1E70M 3H70A 3LOTA 1MEHA 3ZZ1A 5JBEA 5F2IA 1Q65A 1HFBA 2HLDG 2UBPC 4AF0B 3IRDA 4LAKA 6A3HA 1XH0A 1ZUAX 1RLDA 1TYGA 4GFSA 2PCEA 2CWXA 5D03A 3WNKA 3KLLA 4DXKA 1IWBA 1RA0A 3C4UA 4U5KA 4BWLA 2ZUSA 5D2YA 1KGWA 1XD0A 2VURA 1QPRA 1JZ4A 4BJHA 1H61A 4AD5A 1WKEA 1AJZA 3ONCA 2NT0A 1KV8A 4ZTYA 1TE1A 3WLQA 4MM1A 5LNVA 1H5VA 4NI8A 3NOEA 4NZJA 2NQ9A 1TRIA 4IIBA 2YDSA 1HGYA 4XKMA 4A29A 2XGZA 3GR7A 3PHAA 4DO5A 3PANA 2BHZA 2VQTA 3WF2A 1GTEA 3KTXA 1E1CA 3G18A 4H00A 3HZ3A 4EXBA 4QE1A 5K4ZA 5G2WA 4LAUA 5A6TC 4UQEA 2QUTA 4MOZA 3OHMB 2QUMA 3NNTA 3VMNA 4MMWA 2WKJA 1WX0A 4J2PA 1W3HA 2VX5A 3L4XA 3ENLA 3AMCA 2TRSA 3MKCA 2A79A 3VNDA 3SRKA 1GQKA 4C6KA 4PRTA 1OD8A 3EX1A 4GI6A 1F61A 3IARA 3F4WA 1P48A 1BYAA 2OQHA 4DLFA 3TWAA 1VJZA 3V0UA 4S3BA 5FL7G 5HR6A 1JZ8A 1LYXA 1I2PA 4HMEA 2QV4A 1DIDA 2C91A 4US5D 3VO0A 1QBAA 3HJEA 2C3ZA 4EE9A 1D3CA 1U5VA 3B4YA 1OT1A 1ZJAA 4O18A 1KM1A 4DZHA 3NDZA 4HZMA 4IISA 4HSNA 4EF8A 2RJHA 1O68A 2VC6A 5EKYA 3LRMA 2WMIA 4PCNA 1JULA 4JXCA 2A4AA 3WCZA 4UTHA 2NQZA 1LOQA 3W81A 3HF3A 1W9VA 1YADA 1F5ZA 1Z7AA 4RK8A 3N1AA 2J27A 2PWFA 3UXIA 1NOUA 1UQZA 4GYKA 3BAIA 1W6TA 3SRDA 3KS5A 2O7SA 3WLSA 2I14A 4IF2A 2V67A 1DVJA 4W86A 3GQYA 4IPIA 3LM3A 1YE6A 4MNMA 1E1FA 4UR8A 1PDYA 3UYIA 1UC5A 4WGHA 5GNZA 3EB3A 2RFGA 3WDRA 2VWTA 1LM1A 2JJ2G 3C5QA 2Y6ZA 3ONBA 4FOKA 4C6PA 1DP0A 1MZHA 4EOUA 3ABZA 4L5ZA 4WX2A 1MW2A 1EZWA 1UR1A 3LY0A 5I78A 1UIPA 3EXTA 4YVPA 1POJA 3SJ3A 3A21A 4M8UA 4H2HA 4ZQCA 1BFNA 4O16A 1U2YA 1LRQA 2PF8A 5EGRA 3GY1A 2YBVA 3VDGA 3SCUA 3L0NA 4J4KA 4PMVA 5KZDA 3CAVA 3MSDA 1JPKA 3ZXWA 4I5RA 3TDFA 1TTPA 4HSOA 1P6CA 1PKMA 1ICQA 1QPOA 3LMYA 1R85A 4GNKB 5FAGA 1ZBWA 3HURA 4WDXA 3VYLA 2A5HA 4P8XA 5A6BD 5FL0A 4Z0JA 1FWTA 3K2GA 2C7FA 4GQQA 5GJNA 5CJNA 4JS3A 2VL4A 2CLIA 4HNOA 1PS9A 1BQGA 4DYEA 4RX0A 4FZIA 1KM4A 2YBUA 3MSYA 1EDGA 4O13A 1T96A 1R9YA 4W88A 4JOMA 3P3BA 4F3HA 1KRAC 4JIIX 4N2YA 2NW0A 3TYZA 3L12A 3F2DA 4LBRA 2IQDA 3LD5A 3KL0A 2X42A 4Q8WA 1XC4A 1TPUA 3HO8A 1HP5A 3SSZA 2D0HA 2ZIDA 4AW7A 1KLYA 2DU2A 2QCHA 2VEFA 3E74A 3VINA 2D69A 3QR1A 3DU0A 3R11A 4QXIA 4PGLA 1J0JA 1FHVA 1GZJA 1VBHA 4HCDA 1JDFA 3LHTA 1ZU8A 3WQOA 1GTHA 2PZ0A 4GACA 2J75A 1A47A 2R1KA 4XKYA 2BHUA 6ENLA 5BXSA 3GM8A 1JYWA 4UTJA 1HW6A 4LRTA 4HT3A 2GUBA 2L5HA 3NQDA 5FJUA 3C8FA 1LWHA 1BTMA 4UFMA 3UETA 3F4DA 1J0IA 4KQNA 4F2TA 5BMXA 4ZQOA 3E0LA 1P7TB 4HCLA 5GPRA 2REQA 4YTQA 1V77A 3KOWA 4AZIA 2CK3G 1ZJBA 2Z7GA 2D24A 3GNRA 4JKKA 1E6QM 3KFTA 1QWGA 3LHUA 1SMAA 4Q6XA 4DUVA 3EOLA 5DELA 1KO0A 1V02A 5G1MA 3MP5A 4PTMA 4DJDD 4UC5A 3SRHA 1OFAA 3VD5A 3BWWA 1R2SA 1RK5A 2OZ3A 3IJ6A 5TQLA 1PKNA 3H22A 3OGRA 3VDCA 1FVPA 1UH3A 3B9AA 4DZIA 1MDRA 5BRPA 3JRKA 2SFPA 3GSMA 3DFYA 4GPNA 2VX7A 2Y63A 2Q8ZA 2WM0A 4LVAA 4O8AA 4B5UA 5HR7A 4LF1A 4OUIA 5IFTA 3U2EA 1JJKA 4YTSA 1XLFA 1TCDA 3BLPX 3IUHA 3VZZA 1TA3B 1ISWA 2ZUMA 1QW7A 2A3EA 1QHPA 3AAGA 4MWAE 1XX1A 3LSCA 1ZALA 4GX9A 1X98A 2XISA 1SQ7A 1X96A 4D8ZA 1F8MA 4M6UA 4S2CA 4HK7A 1UMLA 3AMDA 1DJQA 1NDVA 1H1NA 4AYGA 3LN3A 3LLDA 4Y9MA 3MUAA 1TG7A 3F1QA 2BLEA 3VGDA 3IGSA 3ICJA 4UUIA 4ZA0A 4IJRA 1H60A 4UMBA 1TZ9A 1UWTA 2CKSA 4PH6A 4B16A 2A3BA 4HTYA 1CB2A 3TYAA 4BR1A 3VKDA 4I9MA 1WKYA 1LWIA 2ACRA 3R6IA 3U4AA 1OK6A 2E4TA 2QPXA 4B5SA 1Z41A 2LLEA 1MXDA 4RJEA 1GONA 3TR9A 3TK7A 1US3A 3KOZA 3SBFA 3WDQA 3G1VA 2P76A 3WJWA 2QUNA 1OFEA 2PDWA 1E3ZA 2VDIA 4MZYA 3MYPA 4WCJA 5F2LA 1ADOA 3TN6A 2WLYA 4GX8A 5A8PA 4MFEA 2E28A 1KCZA 1L6GA 1Y5VA 3M4HA 1DJYA 1OFRA 4M81A 5H2ZA 4LVFA 4QX4A 2RH9A 1I0DA 4AMAA 3THUA 5B80A 4TO8A 1PYMA 3PZIA 1G4TA 1T6MA 1QHZA 3VNZA 2G41A 1YLVA 3M43A 2IUZA 3CQIA 1DWJM 2ZYFA 1U83A 4LSBA 5E0CA 1E55A 1MUWA 1AG1O 4W9TA 4MJMA 1RCQA 2PGEA 2RGMA 3OBAA 5DO8A 3DFHA 5A6BA 3RGTA 1ZY9A 1VFFA 4XISA 1OIFA 2GVLA 3QPEA 4JEQA 3OLIA 1MXSA 3W7IA 3P2VA 1YRRA 5AYYA 4HJFA 2ATMA 5IRPA 4ZBCA 5FSEC 3A64A 1HP4A 4Y8FA 3SZ8A 4O28A 4AY7A 4DY1A 4HCHA 4CNPA 5AHIA 1YNYA 3GIQA 3G1RA 1XPGA 5D9MA 3OG2A 3EOUA 5LA1A 1S2AA 3V5FA 1DXIA 4R85A 4K8HA 5BOOA 4W7WA 3CH0A 2VMFA 4IIGA 1XRTA 1QMLA 3SN1A 2QMKA 3B8VA 1AD1A 3M6YA 4JTLA 1GORA 3H2EA 3GNNA 3CU2A 3P14A 2OKTA 4MPQA 4BZYA 1UYQA 3QY8A 4ACZA 4CEXC 1J5TA 4HZ7A 3AO0A 1OFQA 3FA3A 3WUBA 3J7HA 4ZL1A 3P5YA 4ALDA 2ZXBA 5DCBA 2R6OA 3VIGA 2PDHA 5A2BA 3I7RA 4XB3A 1UR4A 3NURA 3C52A 2PD5A 5D2WA 4XUGA 4ZQMA 4P7OA 1MZRA 2X0HA 2ZWYA 1MUMA 3BL3A 4K8EA 6XIMA 2GFTA 4AMCA 3FYYA 3AWNA 1EEPA 1XG3A 1G67A 3W29A 4GLEA 3RMEA 3AWOA 1Q13A 1MQPA 1GPFA 1W5PA 3W1NA 1TWDA 2OU4A 3WD3A 4EIVA 1R46A 4N6EA 3H4XA 5HK4A 4OBSA 3AHTA 1Z3NA 2JKEA 2X2GA 4S3JA 5J5DA 3MCMA 2QDGA 4ZE4A 4PMQA 4KFPA 1MXGA 3ZLFA 1XIIA 1ITCA 4W93A 2QMJA 3KM8A 4H9TA 3II1A 3WF3A 3K4AA 3U5YA 2OJPA 3MU7A 1TX2A 4O17A 2RJGA 4JTKA 1HL9A 1OCNA 3DGRA 1B3YA 1UMYA 3W26A 4IG2A 3K1DA 1IXOA 5GNXA 5AB3A 3B9OA 3APGA 3N19B 1P6WA 2QIWA 4LNCA 3SW6A 3AIUA 3LB0A 3WH9A 4ICCX 5I02A 4FLRA 2X1IA 4HB7A 2OZTA 5CPOA 3IVTA 3DECA 5LXXA 2ASHA 3IAQA 3MB9A 1I8JA 4W5ZA 1VPXA 4KWSA 7PTDA 4M0XA 4TX9A 2BV9A 3F4CA 1DBTA 2P0OA 3OLGA 2OR2A 4WY0F 2F9RA 5A95A 1W0MA 4KGLA 3BLKA 5JH1A 3W53A 1CGYA 4O57A 4IXHA 3FS2A 3VOCA 2DDXA 5IHRA 1S5MA 3GVQA 4B9YA 2OEJA 3AZRA 3GH4A 1J4EA 4J35A 1E71M 5LNWA 3ZQ9A 3MBDA 1OC7A 1DJGA 3NL3A 2VUYA 4FR1A 2FVLA 3W1AA 2DT3A 2VGIA 1G4EA 2I9UA 4Q8MA 1ODZA 2QT3A 4NL1A 4ML4A 3W7RA 1EJUC 2GGGA 5AYXA 2GQAA 1H8EG 1AMYA 5LKYA 2CBIA 4YYCA 1I6NA 5I79A 4TMBA 5DT5A 1Q6CA 2Y8UA 4WRHA 2EBNA 3E96A 3STCA 4LUSB 4C5YA 3V5CA 5LGZA 3KTSA 1V5XA 3I7QA 2W67A 1X39A 4ZXLA 2V5CA 1FWGC 2PS2A 1LQ0A 4JTGA 3KRSA 4OU1A 2FHFA 2Y62A 1RJPA 3GVRA 1V8EA 1H09A 3W2JA 1JZ7A 5DF0A 4MJ2A 3K5XA 1EJ7L 2FHBA 5C5YA 4D6HA 2VVNA 4BQ2A 3LCWA 1DJNA 1GEQA 1Q6LA 3B0XA 3O63A 4OFCA 3FSUA 4QHRA 3WMSA 1D3GA 3HGJA 3S6DA 1WO2A 3MV11 1TSIA 2PURA 2POTA 4JX5A 3VM7A 1TFVA 1QR7A 1LQAA 5TIMA 4J3SA 2ZTKA 2ACUA 3N2BA 3H54A 3JU2A 1XBXA 4K37A 4LPCA 1F4HA 1PX4A 1UJQA 2R9RA 4AZHA 4J3WA 2ZBTA 2VP8A 4LVBA 2PTZA 3VOJA 3WNMA 4FXSA 4UQDA 4R7JA 1R0MA 3IIXA 2PDYA 1TUXA 4ONVA 3SDOA 4BI7A 1K8XA 4WDUA 1E6SM 1WOBA 1ZCCA 3HPZA 3VOGA 1QO5A 1MI3A 4B91A 5IHSA 3F2BA 3QGAC 2GOKA 4X2PA 4J2MA 3EXRA 2IPFA 5CZTA 3VDAA 3NQ7A 1VFOA 2V3EA 1R6WA 1SJAA 2Y5EA 4JHOA 4H1ZA 3MUXA 4DBEA 5J5RA 5F2MA 1HKKA 1XC6A 1JVNA 1GG0A 3NGFA 2ZA2A 3ITYA 2FYMA 4LGXA 2OT0A 3WQEA 3OEHG 2CU0A 2RUSA 3WDIA 2JF6A 4GKTA 1CLXA 3ZT5A 2CHNA 3GXIA 3KCJA 3STEA 4KCUA 2JGQA 3TUUA 5FIPA 3CV6A 2H8ZA 5FSDC 2UY4A 3B40A 4OWGA 1NAL1 4Z2KA 1ODUA 1EF3A 1E73M 1CXHA 4Z2GA 4B2DD 3GTIA 1DQUA 5KITA 2ACQA 1Z48A 4NX5A 1WE5A 4YVXA 3UFYA 4JQ2A 3OVGA 4PUMA 3UJSA 4IP5A 4DUXA 3VNIA 1OM0A 1HJSA 1FWIC 3LEPA 3GIPA 5E09A 3GNDA 1CNVA 3OU8A 4ZQRA 1J12A 5CPMA 1S2UA 4S23A 3CHCA 1EYEA 4P8UA 2VELA 4Z1YA 3S9ZA 2IQTA 4KETA 3VOIA 4UTTC 4ZCWA 5CCZA 4GY0A 4GJIA 3SO7A 5I6SA 1F73A 3LXBA 1HG3A 2X2YA 4N6FA 5IDIA 1VBUA 3GKAA 3IIZA 2JF7A 1E4NA 3AYVA 3IIOA 4AF0A 1TRDA 2ZVRA 1SJBA 4FNUA 1FTXA 3MZ2A 1PCKA 1SFJA 3VZYA 3GR8A 2I1OA 1XR2A 4JQ4A 3CH9A 2VR2A 1SZEA 5EFFA 3YPIA 5C2XA 3QGKC 3T09A 3N25A 5T9BG 2XH7A 4P7NA 3BH4A 1T99A 1TMQA 2C6QA 3VMPA 5G4EA 1J0ZA 3TOYA 1IZJA 1R38A 2PLJA 3CQHA 4Q32A 2VDHA 3PBYA 4D8AA 1RQBA 2P8CA 2XJ7A 4Q8PA 2V5DA 2QDHA 1KC7A 1LP6A 4H6RA 3N6JA 3UWVA 5EMUA 1GOIA 1VR6A 4JX4A 1TUFA 2PB1A 1DTUA 1L8NA 1W1VA 3WSUA 4AEEA 1XCFA 5HJYA 3CZ8A 3EKLA 5J8LA 4FEZA 1PX3A 4BS0A 2E1WA 4W84A 3NM1A 3BAWA 2XIQA 1AA1B 4ICNA 4P8VA 4UTIA 1FWCC 1Z44A 1H41A 1SZRA 4IX0A 1LRTA 1XLHA 4PCTA 5H8PA 2Q3OA 1M7OA 3THCA 1D8CA 3C61A 3VNYA 1AFSA 3B9DA 3TR2A 1GHSA 3TQKA 4WR3A 1Q66A 5HINA 1PO9A 5DN1A 1EO5A 4FMVA 4GCAA 1ME9A 3CZEA 4RE3A 3LI0A 2Y8KA 4HA4A 1XS2A 3W70A 3B97A 3OYXA 3W72A 1A5CA 3N73A 4X63A 1V3MA 1BXBA 2P3ZA 1WXYA 1FDYA 3EMQA 5CC7A 3K30A 3LU2A 2A0NA 4O1BA 1K03A 1OX4A 1ZBVA 1WQ5A 3W28A 2XIJA 4NVTA 2INEA 1UR8A 1H50A 4ZXOA 1AUSL 3WLNA 2NV9A 2QUUA 2Y7FA 3HMCA 3T2OA 5FJRA 4XIAA 3TQ0A 2QV5A 2F6XA 3I10A 4GO9A 1PTGA 4NYUA 2W79A 4MGGA 4PCFA 2VO5A 3S2CA 4JNMA 4UTWC 1CXEA 1H63A 4XZNX 4L61A 4OVXA 5DLCA 1XDJA 1SMDA 3W7LA 4O50A 2PLCA 3RRAA 3VI2A 2Y70A 1UHVA 2QUVA 4REQA 4U2YA 3TTEA 3LHZA 5M1TA 2Z1SA 4QAWA 3N4EA 4F79A 3E38A 2A3LA 3O6AA 3AS3A 3CHFA 2VHLA 2ZFAA 1KXTA 3M0JA 1JZ3A 3N13A 3BTNA 1M7XA 1KA9F 1IR2A 2YB4A 4ORMA 1J2WA 1AH0A 3CZKA 5A6SA 1NY1A 1ONEA 3DXIA 4U2ZA 1FHDA 1DWHM 3WKZA 2A3AA 1KM2A 1QU4A 4FB7A 5BRQA 4QG8A 8CGTA 2X1SA 1LOLA 1KXQA 5I7GA 1WOAA 1TPVA 3PF3A 3PZQA 4Q7BA 1VRXA 3RXZA 3CQJA 1ECEA 1EA9C 1ZAIA 3OLEA 3VCRA 5AVHA 1OY0A 3KAOA 4IGSA 5FAJA 1Q7QA 8XIAA 1OVDA 1FH7A 8TIMA 4KFNA 6TIMA 4GVHA 2P3EA 3URQA 3R4IA 3W7HA 2YL6A 1EKOA 1K9FA 1R7AA 3LERA 2PA6A 1PAMA 5DRCA 3E2QA 2EJAA 3BOXA 4BF5A 2BG5A 2QCFA 3UCCA 1VBRA 3G0SA 5CC6A 1PL9A 1I45A 1QWKA 1V6YA 2AGKA 2HROA 3MWCA 3NO1A 2YLAA 4IL0A 4CN1A 2HE5A 1EGZA 1ESWA 3NTYA 3GVGA 3URAA 3D3AA 4GYFA 1SM9A 2WQPA 5DRIA 4HMNA 3CWNA 1CENA 1A5UA 3WBAA 1C90A 2GJLA 2VXNA 1LL6A 4AZCA 1EX5A 3JW7A 1Z32X 4JTJA 4AXNA 3S2MA 2BMBA 4XSMA 1EPXA 5HQLA 2B81A 3DFNA 3BG3A 1LUCB 3EDKA 2HPMA 3H2OA 3C86A 1UUQA 2ZKMX 4EPEC 2WMGA 3Q58A 3G22A 4KW2A 2J7HA 2NWRA 1TMHA 3QY6A 3MVIA 4TV5A 1K02A 2D2OA 1O60A 4MTVA 4R33A 4F66A 3UGVA 4MNLA 3FEQA 2OSWA 3PTMA 1ZQ5A 1DWIM 2PDIA 4WOZA 3U0HA 2E09A 1F6PA 1UA3A 4OECA 1W3IA 1RR2A 3FKRA 1TPDA 4F0KA 4JNYA 4I7VA 4YS1A 1X38A 1C8VA 3N12A 1HNYA 5LIYX 5LA0A 1PX8A 4UQBA 3SUVA 3PVFA 3L66A 1SR0A 1AK5A 5EMMA 3C6CA 3NIYA 1I9CB 4AEOA 3R13A 4A3YA 4UNKA 3UCQA 3DKLA 2V82A 2VFGA 4AFYA 2ISWA 2OWWA 4AB4A 3TFCA 2CYGA 1LBFA 3OP2A 3NZ1A 5D2XA 1JUKA 1XCXA 4PRWA 1VHNA 2H90A 2XIIA 2FZMA 5HQMA 3S0CA 3RN6A 3B03A 2A3HA 2INFA 4I9JA 2BHYA 1JUEA 3ABQA 2DZXA 1UR2A 3EX2A 1M68A 1VCGA 2OELA 1K4HA 1XCWA 3EWUA 5HMEA 3BO9A 5H91A 3D6NA 3BV7A 2W5FA 4LY8A 5FF2A 4F2UA 3VD7A 1X6UA 4JFUA 5C55A 4Q4SA 1EC8A 1E9ZB 5D4YA 2R91A 4PMZA 1SW7A 4O15A 4XAPA 1TVLA 2BY1A 2QCCA 1QNPA 3HFYA 3VM5A 2O4QA 3LZ5A 1TV7A 1BD0A 2E1DA 2B7QA 3AXMA 1DIEA 1XD1A 1JI2A 4XIMA 4LV4A 4QLJA 4NZ5A 1XQLA 2X41A 2VR4A 4W87A 4B90A 3TWBA 1J01A 1OX6A 4RDYA 4EAMA 3URBA 3T8LA 3WLMA 3UVIA 4LXFA 2ZZ6A 4J3XA 1AL8A 2DZAA 1E5NA 2ONEA 4Q4QA 2WSYA 4JYDA 3ERPA 5M17A 3M1ZA 1KTCA 1CXKA 3NFUA 1P5BA 2PWUA 7ODCA 3G1AA 5C9ZA 3E02A 2ZRVA 4AHOA 1PEZA 1FFRA 2QPUA 1IF2A 2Z6JA 1DQWA 1VJSA 2V7QG 1OFOA 2A2IA 1EP1A 2HXUA 4IFOA 3R1ZA 2XGIA 4M80A 4N9CA 4U33A 4L9XA 2WXDM 1V6WA 4CD8A 3WDJA 3K13A 1B31A 3WJYA 4JIQA 2ABAA 1BWLA 2ZRWA 1W9UA 4QIUA 3QOMA 1XLJA 3NL5A 1YX1A 2J7EA 4I8YA 2XH4A 2V2HA 3EPMA 3VA8A 1Z8AA 2NWSA 2V3GA 5I3JA 4PC8A 1EWDA 2ANUA 2OYLA 5HANA 5JXQA 1Q5MA 2E40A 3GW0A 3BLEA 4F48A 4LEFA 3OTRA 5KETA 1U1UA 3UNTA 1IGSA 1GKQA 2VEKA 3FSTA 3DH7A 1E5JA 3NQVA 4H9UA 2ZRUA 1QK2A 2Q8LA 4FS9A 1E6ZA 3TSMA 3PZ9A 2PD9A 4Z1DA 5A94A 3SR7A 4RXGA 4D72A 3CBWA 5CAKA 3UW6A 2E6DA 3OG3A 4QG6A 3GFXA 1BF6A 5CH9A 3WMBA 2XFRA 4C7DA 1KCLA 5K3VA 4IUGA 7TIMA 2W63A 1C3FA 3LI1A 3B0YA 3AIQA 1KGXA 4XTDA 3NQMA 3GDTA 3LHYA 3RU8X 1XUZA 2EPMX 2HBXA 2QIIA 4DWDA 1GJWA 1OSEA 5HUPA 1QPQA 4EXQA 4HA1A 4OOZA 3MCNA 1ADSA 1HJQA 5D8ZA 4XSLA 4EF9A 3L2LA 2WC7A 1S1PA 2XUCA 3QSTA 5M3WA 1RD6A 1IZCA 3IJ8A 4PA8A 3SQLA 4MHBA 1GUVA 3MHFA 1SVDA 2CZEA 5HWMA 4O19A 3W2UA 3QHNA 1B3OA 1EIXA 1DV7A 4GIEA 3NZGA 5F1UA 5C9XA 1ZAJA 3GFYA 4KEUA 1Z69A 3M07A 1J93A 2H8XA 1E6RA 3ZJ6A 1C9WA 1TX0A 3NSMA 4GCXA 1F76A 1J10A 3NUKA 5F4WA 4YWIA 4JL2A 4ZB5A 4C6NA 5ECUA 2XDFA 2CC0A 1YBQB 4UFLA 4PEEA 3PBWA 4LB4A 2GWNA 3W7PA 4WHBA 2OOFA 1KLZA 4M19A 3RJXA 3AS0A 5MKGB 3LNMA 1UWIA 3UZXA 1IT0A 1E72M 3QC0A 3QZEA 4E2OA 3WQVA 5T26A 1EC9A 1KQZA 1O5QA 3OZPA 4MNKA 1IHIA 3AJXA 5D9PA 3OJGA 1EXPA 2WYSA 1WDSA 4YWSA 5AY7A 4XZHA 4IX2A 3G1HA 3F4VA 3W7JA 4LX4A 4C6DA 1YPFA 4ADUA 3HM7A 4C1KA 1W1PA 2WNWA 1GOXA 2J8GA 4IOTA 5BRBA 4ZENA 1B3ZA 2C8NA 9XIAA 1QK0A 3IJDA 6TAAA 1CYGA 4JR5A 3WH6A 3C2YA 1TPFA 2EKGA 3F03K 3XIMA 3IJIA 1TZZA 2NZLA 5AHNA 5PTDA 3KRZA 3LCHA 1XIHA 1FXPA 4Q8UA 3SY5A 4KRTA 2RAGA 2P1FA 3WF0A 1ITXA 1S5WA 1EBGA 5E6YA 4Q4MA 3OB8A 1CXIA 2BXYA 1PHQA 2GQ8A 1W32A 3NGJA 5C9UA 4JAWA 1US0A 3RX2A 3S1VA 5B7YA 1AJ0A 3SCNA 3LXCA 1B30A 1Z89A 1F05A 3C0QA 3S2NA 1BF2A 2VD8A 3RPDA 4MG4A 1NFGA 4FF5A 4MKVA 1R3VA 1G01A 3SGZA 4E2BA 1QFEA 2YL8A 1Y7VA 4PBGA 4G6CA 1E1EA 4Q4PA 3QEZA 2OT1A 4Z1BA 3KVJA 5M5DA 3G2GA 1E1CB 2P5NA 3T7VA 1UB3A 2J7GA 4B92A 3CK5A 4ES4A 4RDZA 3E5BA 4PSPA 1VENA 5F7UA 4Q7NA 3L5LA 4QGCA 1O5RA 3TEVA 3CV7A 1DPMA 3ES8A 1RY0A 2XFYA 4LC8A 4H9XA 2PDQA 4P7RA 2BFGA 5A8GA 4PSRA 3VZXA 2WJFA 4M6QA 3QKEA 3RM9A 3B8IA 3S8HA 3F5LA 4QS6A 4AIUA 4O4WA 1PBGA 2YBTA 3EWYA 3OIHA 1C9DA 4AUBA 1DXEA 3ORWA 4RDVA 4GUHA 5BXRA 5I3GA 1XSIA 3TJXA 1RCXB 4Y8EA 3MHUA 1XYZA 1RHCA 1WAWA 4QTGA 3CMGA 4XX6A 3VKKA 1U22A 2GJPA 3W2MA 1K7XA 4XAZA 3OVRA 3D5HA 2UV8G 1L6YA 1ME8A 1UG6A 1BVWA 4BWLC 1TWIA 3T6CA 2YCLA 2Y7DA 2WMIB 3OGSA 3KWXA 3VMOA 3WENA 1OT2A 3WL0A 2O9TA 4RL3A 1K6WA 4XZ9A 6REQA 3Q37A 1BYCA 5JH2A 4QDPA 2W62A 2ON3A 3AIWA 2EKCA 4TT3G 3W6MA 3JVAA 1JD7A 1H51A 3FLUA 4JCMA 4DF1A 4H8NA 3URNA 4K1GA 1BKHA 4OJYA 5AHLA 1A5KC 4FPSA 5I09A 2WPGA 3PUGA 3GC2A 2F6KA 4UQCA 4WJ8A 3BCJA 3USZA 3DAQA 2DUZA 3T40A 3ZO9A 5K9DA 3TV8A 2OX4A 1LT7A 3LS9A 5I00A 4MF4A 5F2GA 2YDQA 2RGLA 2B7OA 2DZVA 3SEPA 1VPQA 3A3HA 1ZS2A 2OYKA 3REQA 2C0HA 1JDCA 2XFFA 1K9TA 3ELFA 1J9YA 4TV6A 4QCFA 4KWWA 5CAHA 3WF1A 4EWND 1DJWA 1JPMA 1GYNA 4C6LA 1SO6A 3ZSSA 3NO5A 1CB7B 1TPB1 4NSBA 1VB9A 3PAOA 1KFEA 3NVTA 5B7ZA 1SFSA 3WO8A 4LCSA 3NVDA 2OCZA 3DFTA 3IANA 4H6QA 1A5BA 3CXOA 5HBFA 3V18A 4K68A 5EBUA 3GIYA 3R2GA 3M0YA 4IICA 2V2CA 2X1RA 2WWDA 5BWAA 4W7UA 3GH5A 1OC6A 1B9BA 3PN8A 3TC3A 2I7GA 2GGEA 1OZMA 3V1PA 2W4XA 3SY1A 3UT0A 1VLWA 3PWGA 3A5VA 2F2HA 3NEHA 1KR1A 4QJ5B 1B2YA 1NVMA 3KVMA 3A13A 4E2VA 3PP7A 2JDIG 4C6FA 4IGHA 1V6VA 1OYCA 4MKSA 1MDLA 3H53A 2VX4A 1KM0A 7REQA 4UFHA 5G1TA 5RUBA 4FXJA 3L4UA 3JR2A 3V36A 1TTJA 4OKDA 3RRXA 3PK7A 3HQPA 1G4PA 1K8CA 1CPUA 3GHRA 3H7RA 4ZSUA 1P0DA 4CGTA 4XKYB 3PJTA 2YA0A 4XZLX 5GJMA 1KFJA 1KM5A 1NWRA 3DBNA 3NZQA 3GZAA 3H2CA 3N2TA 1U5HA 4HKPA 1FKXA 1F7BA 1FBAA 2XWDA 4W5UA 4PUKA 4K38A 3UNDA 1E4MM 1MW0A 1PZ2A 1I4NA 3ZFHA 1YDVA 3IUDA 3O2LA 2QHAA 2BOGX 4YTRA 3CO4A 2Z1BA 1O5KA 1IT7A 1OF8A 1XFCA 4C6JA 3DFSA 1JNEA 1FWRA 3T4WA 3ZLGA 3GG1A 2QR6A 4U28A 1FXQA 2PDNA 5KTLA 2NT1A 2ZDSA 2A7PA 2PDCA 3I6TA 1W8SA 2YFOA 1D2KA 5CJ5A 1KKOA 1CWYA 4A05A 4X0VA 3G24A 3N9RA 5GJPA 3QTGA 4L1XA 3ARQA 2QKFA 2GYIA 3EOOA 4JTHA 4PTDA 3W7EA 3I6RA 1S38A 2PGRA 2AMGA 5HATA 1UR0A 1JGIA 1XP3A 1PZ1A 3OQ8A 3GU1A 4QSHA 4QG9A 2C79A 5CQ1A 4NZ4A 3KOXA 1SO3A 3CEUA 3P81A 4NZFA 4E6MA 3ZS4A 2QNEA 5AHMA 3S1XA 3ANVA 3M0VA 5L6UA 1SSDA 4AHQA 4GA8A 1W1ZA 3VOHA 3GTFA 3IACA 4CQBA 5JVLA 2O55A 1NELA 4FLSA 1WDPA 4XBJA 5EA9A 4GC3A 1Q8AA 3DFPA 3ZWTA 4FHAA 4G9PA 1L6FA 1JPIA 2GJXA 2X09A 3BAXA 3FGCA 1A3WA 4NUWA 2XG9A 3GWQA 2PC4A 4BF9A 1EYWA 5KINA 1BSLA 2CZ5A 4C7GA 2V5LA 3VIPA 4KEZA 3OGVA 4DWSD 2OLSA 3F2CA 1PIIA 1C8XA 4H9YA 4PTNA 4IWWA 3CMFA 2J79A 2VQUA 5EBAA 3FAWA 3TROA 1S2WA 3M0ZA 4MY9A 2J6XA 3NZRA 4GD0A 1HL8A 3LHVA 1UD8A 3CUZA 2ZDRA 4DO6A 1XPYA 5DEZA 3BUVA 1ISYA 1J0HA 4WQ6A 2OVLA 3TAOA 3W7GA 3T2QA 2J7DA 3T05A 1FWDC 5AECA 3AU6A 2WHMA 3MSGA 4GUJA 3V7PA 1JRBA 2W6RA 1F9CA 1JIBA 3IVSA 1Q63A 4BI6A 3VUSA 4LVDA 1TJ1A 4KKXA 3IS4A 1E9IA 3HB9A 3BZJA 4JL1A 4FALA 1XLAA 5BMWA 5IM51 1K70A 4IJBA 1WBJA 3ZYZA 4ASTA 4FNTA 1RK6A 2DVXA 2OEMA 3GNXA 4MUPA 5FACA 3ARWA 3KE0A 4Q8QA 1WP6A 1VFHA 3KZSA 4M29A 2TYSA 1QI4A 3MP3A 5HDRA 3NEVA 2FLIA 2WCSA 2WHKA 1FP8A 7A3HA 2E67A 1QPKA 2I16A 5ABFA 1EOKA 3FFSA 1ONRA 2C13A 4C90A 3R0DA 3ZVHB 4B4FA 3K1GA 1NEYA 1N55A 4G56A 2G3FA 4HOXA 3WQ8A 3S9IA 3WJSA 3TC6A 1OWQA 3IK2A 3I3BA 4IIEA 2NV1A 3L4YA 4YCPA 2V6AA 2VEMA 3EOSA 1C92A 1XYLA 4GBDA 3S1UA 1L8PA 2D2JA 3DKJA 4KIRA 1YKWA 3CUIA 3DIPA 3P61A 3HGSA 2DQWA 3AUOA 1V08A 4IH3A 3AMGA 3CPRA 1U1HA 1DJZA 1US2A 4Q4RA 4IGNA 1MRAA 2WOQA 2VEIA 3U2OA 3QV9A 2VWSA 3CASA 2DEPA 1KXVA 5HMFA 1I2RA 1B54A 3FDKA 1LL4A 3CT2A 4QEHA 4XVEA 3S1GA 4X22A 1Y8BA 2OO0A 1ALDA 3SCOA 3VIMA 1LF1A 3ATZA 4MUZA 2DZTA 2J4GA 2VZOA 3JZUA 3KBWA 1BVZA 1L6SA 3NPVA 4FXFA 1MFUA 3P74A 3R25A 4W8LA 3ZR6A 2OEKA 5C0QA 1VEOA 4CQAA 1TIMA 5BROA 1J6PA 2FVKA 4IFRA 4FOUA 1SZFA 5EFDA 4W85A 4GUGA 4TMCA 3W1UA 1J79A 4WEVX 1ZLPA 4ACZB 2WO5A 4ZMGA 2QJJA 3DEQA 4GZJA 3MP4A 4MIMA 3NAVA 3GAYA 1IQ8A 4IXXA 2CZDA 2BBFA 3I3EA 5DCDA 3CUGA 2YDRA 1XUUA 5HOSA 4H04A 2TPSA 3R8RA 3W74A 2VRKA 2ICSA 3GE7A 3SUTA 3W1PA 1G7VA 3VX1A 4P5UA 3TJ4A 1E9YB 2FB3A 4NJHA 5DMMA 4IHCA 3R7MA 3IGXA 5D2VA 3LBOA 4AU0A 3DC0A 3QR0A 3L0GA 4GXWA 1A4LA 1GOQA 3ZM8A 4EWJA 2E6AA 2VRJA 4J27A 3DUGA 4F8XA 1C8YA 2F7FA 1EJSC 3K4DA 1WZMA 1TV5A 2I5QA 2UY5A 2CBUA 1XIGA 3O3RA 1T8QA 3EDEA 3H12A 1E0XA 1HQTA 2ZOXA 1N8IA 3M5YA 2A7RA 3RO8A 2VDGA 4NQ1A 3I4KA 2CITA 3TSBA 1BGGA 4DAFA 1PIFA 1SUXA 1GJUA 1V79A 4HOZA 1JFHA 3FX4A 4GC4A 4IG2B 2VEPA 2HS6A 3E0FA 4R9XA 3BARA 3KX6A 2W6IG 3N2XA 1XBVA 3ZJ8A 4ATWA 2DIJA 3LNPA 4US6A 3CV1A 8RUCA 1GQNA 2E9MA 2BVWA 1GQIA 4EPBC 1OYAA 3UQNA 2Q3RA 4TVDA 3UERA 3MCOA 2ZTJA 3WK0A 4N7QA 1JNDA 3DN5A 3TE9A 1EJTC 4EPDC 1FHUA 2RDUA 3OIXA 1EJVC 2DIKA 1YDYA 2WKGA 4S3AA 5FJTA 1UZHA 4ZGYA 1VEPA 3MQTA 2PU1A 2ZA1A 5E6ZA 4DWSA 1TVNA 1D7KA 2CXGA 2PTXA 3WNPA 2NXGA 1W5OA 1HJWA 4WKHA 2BGNE 3AS1A 5BCAA 5EMLA 1HZYA 3C2OA 4UFJA 1EOMA 1GT8A 4FI4A 3H6OA 3LTYA 5CSRA 4JQ3A 1F6YA 2BY0A 3E49A 1PXGA 3EWWA 1FKWA 2QAPA 3DYMA 2BOEX 4D6CA 3OVPA 2XFWA 1I60A 2Y7GA 3UA3A 5I3HA 1J0KA 2ZX8A 4PCSA 1XLLA 4OOUA 1XICA 2G96A 1B57A 4C65A 1RD5A 3INPA 2B0MA 4QISA 4HQVA 4G7FA 3BURA 3GDKA 4V1YA 3LGDA 4DJEA 1GOWA 2YW4A 4IMAA 3BLFA 4KCVA 3NQBA 4H9VA 1S3HA 4DJDC 4DZ5A 4JFVA 1CI1A 2Z1WA 1UIOA 1KWGA 2P10A 1E3XA 4UTUA 1GW9A 1O94A 3AHXA 2ALRA 3WNOA 4KS0A 5AYZA 4N4QA 4WSKA 3TLLA 4ECLA 2O0TA 2WC4A 3WBWA 2KAUC 4LWWA 2X7WA 3STFA 4V33A 4MDOA 1XH1A 4HPXA 2V69A 1SZNA 4HYWA 2NVDA 3NSXA 3PB0A 1QNSA 1XGZA 1ZZMA 2NX1A 3PJUA 1TB3A 5CSUA 3CIVA 4IMFA 4DXXA 4UIOA 1IR1A 4F9DA 4A6GA 1WBHA 1O6IA 2D22A 3SN4A 2AAAA 1WDWA 1O1HA 3V1HA 3NL2A 1UZ4A 2I5IA 4O1EA 2W91A 1VAHA 1VKFA 1HUVA 2VR5A 4O1AA 2O4MA 4AX6A 1G94A 1GVIA 1V0KA 1YTDA 3EB4A 4Q4OA 3CZLA 3B8SA 1JZ2A 5T91A 4PE8A 1X1NA 1Q6QA 3TP4A 1CW2A 2VC7A 3T78A 4C7FA 4H83A 3H2MA 4F4RA 3FXGA 3PJWA 1A53A 2PTDA 3FJNA 5LXEA 2PTYA 3CC1A 4Z2LA 2PRMA 6CGTA 3L2MA 4MWAD 2UZ9A 3VFLA 3BAKA 1W3TA 4HPNA 4OUEA 1FFQA 3KVLA 3W7MA 4K2SA 3GXPA 4JTFA 3WLIA 5FCZA 2J7CA 1FWEC 4DPPA 3PZTA 3OPSA 1OCJA 1LT8A 3NYDA 4HHMA 3UJEA 3BJFA 1VJIA 4H9ZA 4MB3A 3UD6A 3PZNA 2Y2WA 4HA3A 3F5JA 2V5BA 3COTA 1BSIA 1YBQA 3HN3A 4XD4A 1UZDA 2ZQ0A 2GQ9A 1RAKA 5ABGA 3CLMA 2NUXA 1DYSA 4CQCA 3SFKA 4JN8A 1IEIA 3C2EA 3EWBX 1XINA 3MBFA 4DELA 1SJCA 1H7RA 4RDWA 3UR5A 1GOOA 2X8RA 3KRUA 3PAJA 2WCAA 2FPYA 4PBFA 3RO6A 1TQXA 3TJLA 4DVOA 4KERA 3AXKA 3VPLA 4Z2HA 1KKRA 1QOPA 2FVMA 2ESCA 5CPSA 1OF6A 3NWRA 2XU2A 2FDMA 3WJXA 3VKJA 5IDZA 2RDXA 4LBSA 3VGFA 3O8AA 4S3CA 4Y9PA 4O1FA 2E8YA 3ZMRA 1MW1A 1KFCA 4KCTA 4LOCA 2OKOA 4RCXA 4GABA 1GG1A 3P0XA 3UXKA 1GQLA 1VEMA 1J11A 5AZ1A 4IGMA 2XHYA 2Z4GA 3TVAA 1B3VA 2BSLA 2WZIA 1MFVA 4UCFA 3HIJA 1XBZA 2GK1A 8XIMA 4R34A 5AC4A 3W7CA 2RHGA 1KBLA 3LYEA 1R47A 4P61A 4ZO7A 3LCIA 9RUBA 3G5EA 3FDGA 5HUOA 2YL5A 2INZA 4PUNA 4A3HA 4GQBA 1QO2A 4XQ6A 2WVTA 4GINA 4HNCA 2IKJA 2JJ1G 3L23A 3W0KA 3MYOA 4H19A 4DJFA 4UTMA 1F74A 4LAZA 2DZBA 1LROA 3ITCA 2H3BA 4FF7A 3OLDA 3LUTA 1HX0A 3CPGA 2JKAA 3KHJA 5HPOA 4GE8A 1ISZA 3BAJA 5LIUX 1NP2A 3VOFA 1QUMA 4JHMA 4CCEA 3N2OA 5D05A 3R12A 3ZWSA 3BMWA 2Z0IA 1ZENA 1Q6RA 4NXKA 2R8WA 3LHWA 4WY0A 5I0DA 4QJ4B 1XDLA 2CXEA 1WAUA 3VNKA 1UD4A 2YZRA 3BOLA 5C2CA 2WC3A 3FVMA 1B4EA 1PTAA 3PUDA 1MW3A 3WQWA 3KUMA 3V35A 3QYQA 2BZNA 1EHNA 1H7NA 3IK4A 2C14A 1H7WA 1EDTA 3MANA 1XIJA 1OX4B 1OHLA 2OGJA 2G37A 3QF0A 3HQOA 3POCA 4AX7A 3TYEA 4U31A 3B8UA 4DZAA 1KD0A 4FLOA 3WQ5A 4N9EA 2VI0A 3VKCA 1VBJA 4NI3A 4INFA 3FJLA 1V93A 4DBDA 1ZP4A 4DBWA 4E8CA 2PDMA 2QGHA 2HDJA 1ELSA 4L1WA 4AC1X 3ES7A 4JBRA 5BWFA 5BU9A 3GVWA 4P7LA 3RX4A 5LHFA 1PSCA 2OXNA 4REQB 3UXLA 2CPUA 4LUYA 3NL6A 1O5XA 1QI5A 1MRQA 3W3OA 4OV4A 3LBMA 3ABSA 5KSWA 3VE7A 5FEWA 3CHEA 3V3WA 5ENLA 4XZIA 4XO6A 2ZX7A 2QAFA 2PLMA 1JZ5A 1H4PA 1VFTA 1NF7A 2HQAA 2XOKG 4NG3A 1D3HA 1E0WA 4MWAA 3EDJA 1TPC1 1KRCC 3I3DA 3R58A 4OZOA 3O9NA 4BY3A 4NF7A 4QDMA 2IXVA 5G5IA 1YNPA 1NF0A 3IVUA 3TXZA 3CUHA 4LANA 1E51A 2PRLA 4YPJA 4ZFCA 2B7NA 4GO8A 3CV2A 1RXOB 1AL7A 3W6LA 2BY2A 5CSSA 7CGTA 3U57A 1OGGA 3RFAA 2XVKA 3PNUA 4S3DA 3TJIA 1X7IA 1TWWA 4RV8A 2VGGA 1ML1A 4DQWA 1IXNA 1JR1A 2BOFX 3KOFA 3W1MA 1QW9A 4EK7A 4W7VA 3S5NA 3SUUA 1PJ9A 1CGUA 1W5NA 2WVVB 3UGRA 2OODA 3CL8A 3UY7A 1W1TA 3WQPA 4BF7A 1B3WA 2GSEA 1Y0EA 3AZSA 3W27A 3E0VA 3WFAA 3W75A 3G8EA 2DVUA 4AZCB 3STGA 4AD4A 2C71A 3R10A 3UWQA 3EEGA 2JBMA 1P4CA 4EVZA 4GKLA 4UR7A 4XD6A 3A12A 1H0GA 1GW1A 1GNXA 1CEOA 4S2BA 4IQEA 1M1BA 4A35A 4C6MA 4L4LA 1JDEA 3W4RA 2EO7A 1PCWA 1E79G 5GNYA 5EYWA 3LTSA 1LWJA 2JFEX 3R0UA 1W9PA 1AW5A 4M1BA 2AQOA 2CIPA 3MDUA 2PDKA 4XAGA 1ZJIA 3P60A 2WJDA 4GZEA 4PFHA 4UZSA 3DFQA 3GTNA 4V28A 2C1IA 2PU0A 1IEXA 1EIBA 3CTTA 2J7BA 2QCMA 2GLKA 3QFEA 1SO5A 3U2ZA 1GVSA 4Q8VA 2ZZ5A 3U9IA 3ITLA 1ITUA 2IQ0A 3SAZA 1HF6A 5K7JA 3R79A 2G50A 5CZKA 4LY4A 1T57A 4UXDA 4FA3A 4GXMA 5TNVA 1JCXA 2DFAA 3P82A 1HKVA 3BSHA 3B8DA 2E9BA 3AYTA 3HV9A 3A9BA 4E4UA 3U2CA 1MWOA 3DHPA 2D3NA 4GVGA 3H2AA 2TSYA 4G7EA 2F6UA 2W66A 4O4VA 1YIXA 4S1FA 4AWEA 2KZHA 3H2NA 2HZGA 1CXLA 5E0KA 3SJNA 2OYMA 4IPPA 4RW5A 3CQKA 1OGSA 4DIAA 2WSSG 1VRDA 1D9EA 1Q6DA 2EQDA 2Z24A 2EG7A 1Q6OA 4TIMA 2IS7A 2QJNA 3SGUA 1P1XA 4B5XA 3MY9A 4GISA 1W91A 2DT1A 3BGAA 1FWSA 3BE7A 4MYAA 4WJXA 4US5A 5FEZA 2WBKA 1YXCA 3HPFA 3S42A 2AL2A 3VIOA 1Q2SA 4GMEA 1VHCA 3QM3A 3EA2A 4EAYA 4XD5A 3W88A 2HVNA 1J2BA 4I6VA 4UOQA 4LB3A 1TMLA 1EQPA 3VCNA 3EDDA 1OIMA 1M6JA 5CBBA 1Q3NA 2ALDA 4P7QA 3W6YA 1PTDA 2ZUWA 4EXAA 2DW6A 2NLIA 4I8DA 1WCGA 4BEUA 3AQUA 4B3LA 1A4MA 2B7PA 2Y61A 4FNQA 4X61A 1OYBA 2FH8A 3PPFA 1A0CA 3W1XA 4YHGA 3WEMA 3IIPA 1M03A 3M0KA 3WQ6A 1THFD 5LIXX 2OQLA 4JTDA 3BAYA 1EBHA 1YHTA 3ABRA 4FIRA 3O07A 3ZIZA 2YA1A 1IXQA 4CD4A 3VDBA 3O06A 1NJJA 1K8ZA 3HPSA 1PHWA 2YB1A 1QI0A 2IW0A 4A22A 3VVGA 1RQEA 3ITTA 4M6VA 3TA6A 1PPIA 1BPLB 3FOKA 4H8UA 4PBEA 3UEQA 5EU9A 1QOXA 1AMKA 2X0SA 3OQEA 3TZFA 1HKIA 3ZVHA 2QJIA 4C1LA 5EL1A 2J78A 1HVQA 2PLKA 1C29A 4G8TA 4Q8NA 2WMJA 2ZRXA 3AMLA 1RJQA 1JYXA 2FZDA 5C54A 5A1AA 2YLLA 3TU9A 2WMHA 3E9AA 1NIUA 2ISDA 5AC6A 5LHEA 4PRRA 3BJSA 4OGZA 4D6DA 3BOFA 1K77A 3W1RA 1VLIA 4GOAA 3MSRA 3WFZA 2XVGA 1M5WA 1GVFA 3KDNA 2QDDA 1Q45A 1XLIA 3FYPA 1FH9A 2PE4A 3FN9A 3WH7A 4ENLA 2PF0A 3AMKA 3GX9A 1EF2A 3A3WA 2F8QA 3EX6A 4QQ3A 1CT5A 1YXYA 3MWAA 3K8MA 3UESA 1XLEA 4TU1A 1KRMA 4H7CA 2VFEA 1PZ3A 2PDLA 2Z7KA 5A2CA 3PZMA 2A6LA 4GYJA 4TVUA 1L6WA 1XIDA 4N42A 3RILA 1H7PA 3GW3A 2EG6A 4GY7A 5AHEA 3BC9A 3F5KA 2I17A 1M3UA 3CQ0A 4PMDA 1UROA 3TSDA 5CG0A 4AQLA 3EWXA 2HVMA 1H1YA 3BGGA 3LV5A 2D3LA 5K9XA 5AKQA 1JQXA 4D6JA 2YA2A 4EX4A 2PGFA 3NQGA 4WKFA 1HJVA 3BG9A 4E5TA 3CWHA 2E9LA 3GLCA 4JQ1A 2DZSA 1V4YA 3TLQA 2YDAA 2D2HA 1V3JA 4L80A 2BY3A 2FZNA 3G1XA 5I3FA 5HA7A 2QLYA 4IIHA 1TJRA 5C70A 1FS0G 3BXWA 2Z26A 3KBSA 2HBVA 1UR9A 3QHMA 3RITA 3MT1A 4MSSA 4QSFA 4HMCA 3RCYA 3KZPA 1QI3A 5D04C 4LVGA 4V15A 3DDMA 3IUIA 3QRHA 2Z1KA 2G3JA 2A6NA 1M65A 1JPHA 3MI6A 2PCQA 5BU6A 3I65A 4DJDA 5M2FX 3H4WA 4G1NA 3W1LA 1S2CA 4QM1A 3AROA 5DXYA 1ITQA 1UKTA 3RAOA 3ARUA 3HA1A 5FI8A 1VH7A 4HIBA 3TYUA 1EEXA 3N9KA 1X1OA 4XZWA 1JPDX 4WSJA 1JAKA 5A2AA 4ZODA 2HRWA 5C71A 4XK2A 3C0JA 3FA5A 2QS8A 1QVBA 1W3KA 1ORUA 3QMSA 5LA2A 1CGXA 1K9DA 4ZR8A 1KQYA 2PWVA 1XG4A 1FHLA 4Q6JA 4KT2A 3UJFA 3QSRA 2ZICA 4XAYA 3SCQA 3EDFA 4KGJA 3TXVA 1EDQA 2NQHA 2R82A 4GG9A 3G1SA 3GHSA 4MADA 1AZ2A 3PTDA 2DQXA 2HSAA 2BGQA 3W2LA 1V6UA 3GNPA 4R88A 1Y5XA 4K6AA 1TZ7A 2DGAA 2OLHA 4JDYA 2QCNA 4PMNA 3ABXA 2Z1VA 1W54A 5IBXA 4IPJA 2EF9A 1JF5A 4D6IA 3L4TA 2WHLA 4GXPA 2J88A 5LYRA 3S5SA 5BXTA 3MTWA 1XQKA 1XLDA 4XZMX 5LSMA 5ABTA 2C16A 2JKPA 4I90A 3WJZA 5JUVA 4GJ1A 2GL5A 1YPIA 3E1F1 2OTDA 5C2GA 1G4SA 2OZ0A 2IPWA 1J5SA 3GBDA 3ZR4A 1DJIA 4JY8A 2DT2A 3OOQA 1IEVA 1NQKA 1XIEA 3K8LA 4ACYA 3TN4A 5HXMA 3MUCA 4NJJA 3N3TA 1BYBA 2NX9A 3EYPA 3SY8A 4JTRA 4D1IA 1DXFA 3WBXA 3RCMA 3CNYA 2DUXA 2GDQA 4NKCA 3BVJA 3WDPP 3M0HA 3TTOA 5HWJA 1UP3A 3UG8A 4Z42C 2V8ZA 4TSFG 4JIRA 3LQGA 3UCDA 1AH4A 3SI9A 4Y96A 2WLZA 1LBMA 4HPHA 3WMLA 1TJ2A 1N8FA 2PDUA 2WZEA 1FCBA 4HYVA 5DY3A 3FA4A 4D6EA 3IGUA 2OMAA 1GOKA 1ISXA 4HVXA 4A8IA 1REQB 3DENA 1LG2A 3A4XA 1AVAA 4Z0SA 5DBTA 3R8GA 2J77A 1B5TA 4JTEA 3SCWA 2Q6ZA 4W8BA 2YCLB 3NQ6A 3O15A 1Q85A 4JIPA 3FYOA 4PODA 4LYPA 2BNJA 1E9LA 2D73A 6REQB 2ZUTA 4DF2A 1KBBA 5XIAA 1XGEA 2E6YA 4PL1A 2WHJA 3QN3A 3UA4A 2W9MA 2FZ9A 4UBPC 2HWGA 5CZJA 4M51A 3EA3A 2PP1A 1XM3A 3EMCA 3AICA 3BCDA 5H6HA 2J8FA 3QYSA 3ITVA 5A6LA 1DIOA 3ZT7A 2NUWA 1BRLA 3O0FA 4XVDA 1BAGA 1C91A 3SUSA 4DUOA 1SYTA 2PUZA 3H8AA 4FP1A 2NX3A 3DG3A 1XRVA 1UASA 4QP0A 4LBUA 1RBOB 3UWUA 4IZGA 3REQB 1M7JA 1UJPA 3NDOA 3PWAA 1GVQA 1UKQA 1H3GA 1B0IA 1TJ0A 2TMDA 3VC6A 3ARYA 2OWXA 1QW8A 3FK4A 4CVWA 2VCCA 1K6AA 2GPTA 2Y8VA 3E2VA 5DFAA 3APYA 2VYOA 3GXMA 3PC0A 1W3JA 3POHA 1CTNA 5I23A 3LPFA 3H26A 1NM9A 3W82A 2PWGA 4JPGA 1EC7A 4I3GA 4Q4KA 2ZVIA 4AEFA 1E0VA 1W1YA 1VF8A 2ZRYA 4LV9A 3HJZA 4LUIA 3CB8A 3QC3A 4H8VA 1XSKA 4RPPA 4X2RA 4HNUA 4WIWA 1XLMA 4I5UA 2PODA 2YCKX 3L5AA 2GWGA 4C1NA 3EEZA 1GZ1A 4D1JA 3BK0A 3AHVA 1GVYA 4TVCA 3VK5A 5D9OA 4O53A 4QE4A 2G3IA 3E0WA 1HGWA 3FJ6A 4GQ0A 7REQB 4XG1A 4F40A 2OSYA 2PBOA 1RSCA 1YNQA 3N18A 1UBPC 3PG9A 4P2VA 3SUWA 1FA2A 2VOMA 2OGYA 5D37A 1H7XA 3VIIA 3B0VC 5A5WA 1CX9A 4GHRA 2QPSA 3WQ4A 1TV3A 4LU0A 1VP8A 5H8MA 3QQ0A 2HMCA 1DE5A 1ZBCA 4AD1A 5AC5A 2WK2A 1W1A1 4E0CA 1HIZA 1SFTA 4MAZA 5DY2A 3S5ZA 4H4IA 4LYRA 1UD5A 5REQB 2J9YA 1LBLA 4FR6A 3OVQA 4YCOA 4PR4A 3WH8A 4NXSA 3LX9A 2E5DA 4WK9A 1VYRA 3W02A 3GRIA 5FEPA 5JBDA 2J66A 2ZX9A 1EQCA 5EMYA 5LNUA 4PCPA 2EG8A 4HNNA 3WK3A 5D09A 1NOFA 4FIQA 3RYSA 2GUYA 4GH3A 2BVYA 3OFNG 2WM1A 1KTNA 3PPGA 3N2MA 3QZ6A 5K9CA 1N7KA 1VFSA 4H01A 1DHPA 2V2DA 4AIBA 4JY9A 3W23A 1ZB5A 1UWUA 5AN7A 3W00A 2GOUA 3VGGA 3G6MA 1PKYA 1LJYA 3VIHA 3U7VA 3ATYA 3BG5A 3KP1A 2J25A 3EOEA 1MSSA 4L56A 5J04A 5D30A 4AVFA 3SADA 2CWNA 4ADSA 3AZTA 3FW6A 3P8IA 4CU6A 2Z28A 2BDQA 3L68A 1YMYA 1DWFM 1UWAA 2UWFA 3KW3A 2UY3A 3B04A 4X9YA 2WSPA 1E43A 4Z1CA 3FGCB 2GJXB 5H8UA 3VD4A 3RR4A 1DEDA 2DT0A 1OFBA 4IPNB 3OAAG 3ALGA 3LDVA 2WAGA 4JHZA 3P6LA 3S5OA 2UY2A 3ARTA 3B9NA 4O10A 3GTHA 3TW6A 4TR9A 2TAAA 3SSJA 4B9ZA 1TV4A 7TAAA 1A5MC 2YKKA 3AC0A 1HJUA 2XPKA 5CKSA 4H6EA 3IIVA 2NXIA 1XIBA 4NRRA 2PWDA 2HJPA 3IJ7A 2Y1HA 2E5CA 4RPQA 3ANUA 4AWTA 1W0JG 2FB2A 2C1HA 4IIDA 3IV3A 3BZGA 4JQAA 3KVKA 3S9YA 3IV8A 2O7QA 4GQRA 4PN2A 3CUXA 1H62A 2CFFA 1HKWA 1F3XA 1X6LA 1O4UA 2DP3A 4GZIA 1S5NA 5C8BB 1TV8A 4ASUG 3M6DA 4M24A 1IT8A 3CUJA 3IJLA 5FF3A 2CCRA 2HS8A 4JFTA 4ZVJA 1K1DA 4R3UA 2VVSA 1YYAA 3L5MA 3XISA 4UTKA 5C9RA 1MO0A 3H55A 3TC7A 5E5CA 4AY1A 1K4GA 3L4ZA 2WVSA 3DHFA 1R3TA 5EMJA 2VCBA 4ERAA 3PS7A 3CZJA 1JUBA 1GYMA 3W1QA 1M04A 4RNHA 2R14A 5AC8A 4S3EA 4A8LA 4HPJA 2FTYA 3IRSA 4AZBA 4K7YA 3CYJA 2FKPA 5ABFB 4WDWA 1V3KA 1YXDA 2Z2AA 3BPWA 3SCRA 3VIFA 1F3EA 2XSAA 3EBVA 1I2QA 3G8RA 4XBSA 1QXLA 5AHFA 4HA0A 2E68A 4HN8A 3QHOA 1BWKA 2FPTA 4Q8OA 2ZADA 4B2DA 3ARPA 4F0LA 3T0TA 5CJMA 3VX0A 2WSRA 1ONWA 3WLPA 3L21A 3MO7A 2E5BA 4D8LA 2F2KA 1PIGA 3CM4A 3L65A 3M64A 4O8RA 2NUYA 4EKJA 2Z29A 4M1RA 2FTWA 5FEXA 2CETA 4H9MA 3K4WA 2WVVA 4GI9A 3ITGA 2ISVA 5D8WA 4IQLA 3AI0A 1IZKA 2VNCA 4NIRA 1DJXA 2J8TA 3DYOA 3PTKA 3KCLA 1IGWA 2AAMA 5EY5A 4AZ7A 1K7FA 3EXSA 2V81A 1TWZA 3LK6A 2YSWA 3N6HA 3L4VA 3VGEA 3DG7A 1NP0A 2H9AB 1L2UA 3SM0A 1WPCA 3BQ6A 1OG6A 3G0XA 3GDRA 2VJXA 1ZAHA 4MLRA 5DMLA 3TIMA 5HNNA 4WJEA 2ABBA 1GEHA 1AW1A 3HMJG 2JEPA 3CAWA 3HGOA 1FOBA 4FSAA 1XWYA 2WV8A 2WW5A 3VNLA 1FY6A 2OOGA 5C7VA 3HQNA 2WB5A 1PV8A 3D47A 4EPKA 4AWUA 2G0WA 4N02A 3FHAA 2CZVA 2WBGA 1KGUA 3DERA 4AXKA 1WDRA 1CGWA 4GI8A 5HMDA 1K9EA 3MUY1 1NH6A 3OEXA 3KS6A 3S1WA 1SGJA 3RJYA 1Q8JA 2Z2UA 5CLWA 1W8GA 3DOPA 1DL3A 4WSHA 3OA3A 3QPZA 1XISA 3AIEA 1KTBA 3MVTA 4D6FA 4NZCA 3O6CA 4Q3MA 1VCVA 3AIBA 3VKAA 3PZOA 2JIEA 4C6IA 4N0RA 3UWZA 3HBLA 2GVEA 2G4FA 3IAPA 3GG8A 3ZR5A 4AD3A 4GJJA 1VQTA 1VYSX 4DX3A 5FL1A 2DSWA 2E7FA 1KRBC 3A9IA 5ABEA 4L7ZA 2A1YA 4A8RA 4HHHA 4NX0A 1A3HA 4LUTB 4QEEA 1DQXA 3GUWA 1KCKA 5CGQA 3SIZA 5G2HA 4CNTA 1AQMA 4PULA 1B90A 5DQPA 1TPEA 5BXPA 4DPQA 1TIWA 1UH4A 4RZ6A 2G95A 1IV8A 3QKZA 1OD0A 5A6JA 3E5PA 3EA1A 1CECA 1J18A 3UG5A 3M5XA 2FFIA 2NV2A 1OG0A 2YFNA 4Q22A 1OCQA 1QTWA 3E12A 1R9ZA 3KCOA 3KBJA 4NNBA 2IKGA 1I75A 1XDMA 2X0YA 3PFMA 3OYZA 3KBNA 4DWSB 4YTUA 4JFWA 4DLMA 4X9SA 2QCEA 3RLUA 2GUUA 1O7AA 3RU6A 2FMNA 4NT0A 1AJ2A 4XAFA 4LF2A 2P88A 2XN0A 4PEKA 4DM1A 1N8WA 2QW5A 4B5NA 4MDPA 4IJCA 1TVPA 4Z2JA 2IXUA 1UWRA 1F6KA 2I57A 3M46A 1M53A 3B0UX 2GGHA 4DBSA 4OIFA 2DUAA 3DG6A 2PDJA 3IEBA 3TYDA 1OFDA 2Z6IA 2PI6A 1ZTVA 1JAEA 2BXVA 2D0FA 1RZMA 4KBXA 3NPXA 4HHPA 1FCUA 1Q4NX 3M5VA 4Y9NA 1XI3A 4MAVA 2GVGA 3BDKA 2WKLA 5U7SA 3T1GA 1UD2A 1F4AA 5KMYA 2GDUA 2QVHA 4LW7A 1YTEA 1P0NA 2HEJA 3GB6A 1Z42A 4RNFA 1W37A 4Q33A 1W9BM 2F38A 2I9EA 5EB8A 2R1LA 5A6KA 1KBJA 2NVCA 3CPUA 4ZEPA 2WPDG 3QLDA 3PTQA 4GUFA 1A3XA 4JGDA 3FKSG 4CQ9A 1L9WA 3WQGA 1YEYA 4R9OA 3SECA 3AJ7A 3WD0A 5FOOA 3EPOA 4LS0A 3M7WA 4WD0A 1OBAA 2G8ZA 2V3DA 4AH7A 2EPOA 4E3VA 2Y0FA 4L4OA 3W7OA