2JOEA

Nmr structure of e. coli yehr protein. northeast structural genomics target er538.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
139
Chain Sequence
MGDKEESKKFSANLNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQGISGINVSAEDAKKGITMAQMELVMKAAGFKEVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of E. Coli YehR Protein
rcsb
molecule keywords Hypothetical lipoprotein yehR
molecule tags Structural genomics, unknown function
source organism Escherichia coli
total genus 35
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06998 DUF1307 Protein of unknown function (DUF1307)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1830.10 Alpha Beta 2-Layer Sandwich YehR-like fold YehR-like 2joeA01
2JOEA
chains in the Genus database with same CATH superfamily
3U2HA 3U2GA 2JOEA
chains in the Genus database with same CATH topology
2JOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOE A; 
#chains in the Genus database with same CATH topology
 3U2H A;  3U2G A;  2JOE A; 
#chains in the Genus database with same CATH homology
 2JOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...