The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
92
|
structure length |
92
|
Chain Sequence |
SPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transcription regulator
|
| molecule keywords |
CREB-binding protein
|
| publication title |
Structural basis for recruitment of CBP/p300 coactivators by STAT1 and STAT2 transactivation domains.
pubmed doi rcsb |
| source organism |
Mus musculus
|
| total genus |
32
|
| structure length |
92
|
| sequence length |
92
|
| ec nomenclature |
ec
2.3.1.48: Histone acetyltransferase. |
| pdb deposition date | 2008-10-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02135 | zf-TAZ | TAZ zinc finger |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | CREB-binding Protein; Chain A | TAZ domain |
#chains in the Genus database with same CATH superfamily 3P57 P; 2KA6 A; 3IO2 A; 1U2N A; 2KA4 A; 1F81 A; 1P4Q B; 5HP0 A; 1L3E B; 1L8C A; 2LWW A; 2MH0 B; 1R8U B; 3T92 A; 2MZD A; 2K8F A; 2KJE A; #chains in the Genus database with same CATH topology 3P57 P; 2KA6 A; 3IO2 A; 1U2N A; 2KA4 A; 1F81 A; 1P4Q B; 5HP0 A; 1L3E B; 1L8C A; 2LWW A; 2MH0 B; 1R8U B; 3T92 A; 2MZD A; 2K8F A; 2KJE A; #chains in the Genus database with same CATH homology 3P57 P; 2KA6 A; 3IO2 A; 1U2N A; 2KA4 A; 1F81 A; 1P4Q B; 5HP0 A; 1L3E B; 1L8C A; 2LWW A; 2MH0 B; 1R8U B; 3T92 A; 2MZD A; 2K8F A; 2KJE A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
