The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
112
|
structure length |
112
|
Chain Sequence |
GSVVGGLGGYMLGSAMSRPVMHFGNEYEDRYYRENQYRYPNQVMYRPIDQYGSQNSFVHDCVNITVKQHTTTTTTKGENFTETDIKIMERVVEQMCITQYQNEYQAAQRYYN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Unknown function
|
| molecule keywords |
Major prion protein
|
| publication title |
Prion Protein NMR Structure from Tammar Wallaby (Macropus eugenii) Shows that the beta2-alpha2 Loop Is Modulated by Long-Range Sequence Effects.
pubmed doi rcsb |
| source organism |
Macropus eugenii
|
| total genus |
36
|
| structure length |
112
|
| sequence length |
112
|
| ec nomenclature | |
| pdb deposition date | 2009-02-24 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Major Prion Protein | Prion/Doppel protein, beta-ribbon domain |
#chains in the Genus database with same CATH superfamily 2KTM A; 1QM0 A; 1U5L A; 1HJN A; 1E1U A; 2L1K A; 1I4M A; 1E1P A; 2KFL A; 3HEQ A; 1Y16 A; 2LH8 A; 1UW3 A; 1FKC A; 1U3M A; 2FJ3 A; 1QLZ A; 1TQC A; 1DX1 A; 4DGI A; 2KU4 A; 3O79 A; 2L40 A; 1QM3 A; 2LFT A; 3HJX A; 2KU5 A; 1Y15 A; 1I17 A; 1XYX A; 1E1S A; 2K5O A; 1DX0 A; 2KU6 A; 1TPX A; 2LEJ A; 1XYK A; 1E1G A; 1QM1 A; 2L1H A; 1DWZ A; 3HES A; 1LG4 A; 1E1J A; 1QM2 A; 2JOH A; 2KFM A; 1HJM A; 3HAK A; 2L39 A; 1TQB A; 2L1E A; 2JOM A; 3HER A; 1XYQ A; 1AG2 A; 1QLX A; 1FO7 A; 2K56 A; 2K1D A; 2W9E A; 3HAF A; 1H0L A; 2LSB A; 1B10 A; 1DWY A; 1XYW A; 3HJ5 A; 2L1D A; 1E1W A; 2KUN A; 1XYJ A; 1XYU A; 1Y2S A; 1XU0 A; 2MV8 A; 2KFO A; #chains in the Genus database with same CATH topology 2KTM A; 1QM0 A; 1U5L A; 1HJN A; 1E1U A; 2L1K A; 1I4M A; 1E1P A; 2KFL A; 3HEQ A; 1Y16 A; 2LH8 A; 1UW3 A; 1FKC A; 1U3M A; 2FJ3 A; 1QLZ A; 1TQC A; 1DX1 A; 4DGI A; 2KU4 A; 3O79 A; 2L40 A; 1QM3 A; 2LFT A; 3HJX A; 2KU5 A; 1Y15 A; 1I17 A; 1XYX A; 1E1S A; 2K5O A; 1DX0 A; 2KU6 A; 1TPX A; 2LEJ A; 1XYK A; 2KZC A; 1E1G A; 1QM1 A; 2L1H A; 1DWZ A; 3HES A; 1LG4 A; 1E1J A; 1QM2 A; 2JOH A; 2KFM A; 1HJM A; 3HAK A; 2L39 A; 1TQB A; 2L1E A; 2JOM A; 3HER A; 1XYQ A; 1AG2 A; 1QLX A; 1FO7 A; 2K56 A; 2K1D A; 2W9E A; 3HAF A; 1H0L A; 2LSB A; 1B10 A; 2LL0 A; 2MDZ A; 1DWY A; 1XYW A; 3HJ5 A; 2L1D A; 1E1W A; 2KUN A; 1XYJ A; 1XYU A; 1Y2S A; 1XU0 A; 2MV8 A; 2KFO A; #chains in the Genus database with same CATH homology 2KTM A; 1QM0 A; 1U5L A; 1HJN A; 1E1U A; 2L1K A; 1I4M A; 1E1P A; 2KFL A; 3HEQ A; 1Y16 A; 2LH8 A; 1UW3 A; 1FKC A; 1U3M A; 2FJ3 A; 1QLZ A; 1TQC A; 1DX1 A; 4DGI A; 2KU4 A; 3O79 A; 2L40 A; 1QM3 A; 2LFT A; 3HJX A; 2KU5 A; 1Y15 A; 1I17 A; 1XYX A; 1E1S A; 2K5O A; 1DX0 A; 2KU6 A; 1TPX A; 2LEJ A; 1XYK A; 1E1G A; 1QM1 A; 2L1H A; 1DWZ A; 3HES A; 1LG4 A; 1E1J A; 1QM2 A; 2JOH A; 2KFM A; 1HJM A; 3HAK A; 2L39 A; 1TQB A; 2L1E A; 2JOM A; 3HER A; 1XYQ A; 1AG2 A; 1QLX A; 1FO7 A; 2K56 A; 2K1D A; 2W9E A; 3HAF A; 1H0L A; 2LSB A; 1B10 A; 1DWY A; 1XYW A; 3HJ5 A; 2L1D A; 1E1W A; 2KUN A; 1XYJ A; 1XYU A; 1Y2S A; 1XU0 A; 2MV8 A; 2KFO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
