2KO6A

Solution structure of protein sf3929 from shigella flexneri 2a. northeast structural genomics consortium target sfr81/ontario center for structural proteomics target sf3929
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MKCKRLNEVIELLQPAWQKEPDFNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSAKDAVIPGLQKDYEEDFKTALLRARGVIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of protein sf3929 from Shigella flexneri 2a. Northeast Structural Genomics Consortium target SfR81/Ontario Center for Structural Proteomics Target sf3929
rcsb
molecule keywords Uncharacterized protein yihD
molecule tags Structural genomics, unknown function
source organism Shigella flexneri
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1580.20 Mainly Alpha Orthogonal Bundle Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 2ko6A00
2KO6A
chains in the Genus database with same CATH superfamily
3CNNA 3CNLA 3CNOA 2KO6A 1PUJA
chains in the Genus database with same CATH topology
3CNNA 3CNLA 3CNOA 2KO6A 1PUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KO6 A; 
#chains in the Genus database with same CATH topology
 3CNN A;  3CNL A;  3CNO A;  2KO6 A;  1PUJ A; 
#chains in the Genus database with same CATH homology
 3CNN A;  3CNL A;  3CNO A;  2KO6 A;  1PUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...