1PUJA

Structure of b. subtilis ylqf gtpase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
261
Chain Sequence
HMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKNKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSGGLINYDKTTEVIIRDIRTEKFGRLSFEQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords conserved hypothetical protein ylqF
publication title Structure of the YlqF GTPase from B. subtilis
rcsb
source organism Bacillus subtilis
total genus 94
structure length 261
sequence length 273
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1580.10 Mainly Alpha Orthogonal Bundle Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 1pujA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1pujA01
3MAAC 4V0OA 3KKMA 5JECA 4NYJR 1KTVA 5AJWA 2G77B 2W6IA 1K6MA 2QN6A 3UWOA 2V7QD 4B3FX 4NL4H 1L4UA 4RFSB 3RAPR 1E0KA 3HDTA 5L3RA 5HR5A 4MGIR 3EPKA 1T3LA 4P4UA 1ETUA 4JYCA 5FOSA 3E1SA 4OQMA 4URVR 3CX6A 3T34A 3TVTA 4ZKDA 3ADCA 3VKHA 4XJXA 4KAXA 2G6BA 1OXSC 2OLKA 2GZAA 1S3SA 2IXFA 4GBMA 1H8ED 3H86A 5SZKB 3I72A 3THYA 2X2EA 1U90A 1I4LD 2PLRA 5LD2B 4QNRA 2P5SA 3NHBA 2YVUA 2XJ9A 1IY1A 1EXMA 1N6IA 1G4UR 1XZPA 4WA7A 1E1RD 1G3IA 1UJ2A 2FX3A 2XJ4A 1G7CA 2J45A 4Q1EA 1BYUA 2DYKA 1DAEA 3GJ8A 1RIFA 3MJRA 2AWOA 2ORIA 5DLQC 5EXTA 2PL3A 5BN3A 1HEIA 3PUYA 4NYIQ 4JSYA 2XSZA 4B2LA 3MMPA 2PZFA 3H0KA 1M34E 1F48A 1EK0A 1N5KA 3NDBB 2ODEA 2CVFA 1NVWQ 2IBMA 1P61B 3K0FB 2BBSA 3QKSA 2WWYA 2FSFA 4GDFA 1KSHA 1Z29A 3GLFB 4LSGA 1R8SA 5H68A 2GKSA 2Z4RA 1GRRA 3IILA 4DLYA 2IXEA 4DEYA 1II8A 1UADA 2H1LA 4KSCA 4FIDA 4IFBA 1JR3D 5DYIA 2V54A 1HT2E 1P9NA 3K9GA 2WSSA 2ZPTX 3NIBA 5KNBA 3W8RA 2JEOA 3SYKA 3KKPA 1IXSB 4C0JA 2XNSA 1RRGA 1RVDA 1L2TA 1GP2A 3KX2A 4NYJQ 1RW4A 4BFYA 2QROA 5L3QA 1G7RA 2ASEA 3HR8A 2P6RA 2PT5A 2O8CA 2YOFA 4CDGA 1Q1BA 2GEVA 1JAIA 3BFVA 3L0PA 1NMZA 2CNWA 4N1AA 1CU1A 2JJ8A 5CB8A 4QGFA 4E5UA 4B3GA 2IYWA 2P67A 1ZU4A 2LKCA 3L2OB 2F3TA 3QXHA 1FUUA 2VLIA 5AUQA 4OQFA 1E0SA 1FZQA 4GMDA 3AKCA 3DL0A 5D3MA 2ZRDA 3D6TB 3I8SA 2ZJOA 3I73A 3SHWA 2JA1A 3FMIA 4NCKA 3SJZA 2ZTSA 1M6NA 1ZW6A 4A8JA 2WJIA 5FR2A 1BYIA 4LV6A 1R7RA 4HLDA 1KOFA 1F2UA 4L9WA 5EP4A 3U6BA 4CT5A 3GFOA 1QDEA 1P4SA 4LV8B 1OE0A 4QBHA 1R5NA 2DR3A 5J4VA 1TUEA 2IS2A 4HB2A 3OIVA 1VPLA 2V6IA 4JLDA 4DVGA 3K0AA 1O87A 3GEEA 1UKYA 4D4MA 3UMSA 4JSTA 4NP6A 3U3KA 3IQWA 2I1QA 4Q66C 4C30A 2PZEA 2ZJZA 3GPLA 3QKUA 3CPHA 3GJ7A 1SXJD 4L5BA 3RS5A 2NTYC 2BV3A 2F9MA 4AYWA 1ZNZA 3DM9B 1NMYA 2UZ3A 5JHGB 2ZVQX 2VA8A 2CMKA 2KBFA 4ACAA 3NG1A 3FKQA 3OHMA 3SHFA 1E4VA 1N6KA 2W2TA 1EFRD 3GJ4A 3F5FA 4BLPA 1FTNA 5L8VA 1HH4A 2CL7X 2QG6A 1GG2A 3ADDA 3QY0A 2O8FA 4TLCA 2XZOA 3GEIA 1NLYA 4WXRA 3IGFA 3W5IA 4EFMA 1VCMA 2F3RA 8OHMA 3DOFA 1I4DD 3VR2A 4NDZA 4B73A 4KFUA 4LHXA 2JJ2D 3N5CA 3LFUA 2EQBA 4M21A 1W5SA 3T35A 4PAOA 4KFSA 2REXB 2B6HA 4LI0A 2FPLA 4QHTA 3SS8A 1W4AA 2QUZA 2IUTA 1GM5A 1VG0B 1KNXA 5HCIA 2ZRKA 5BN5A 3MG9A 4HI0E 4LDJA 1YZNA 3R8FA 2ZE8A 1YKSA 5BWMA 5KDLA 4QRHA 3MD0A 2VEDA 2IYLD 4Q1CA 4OHVA 2BBWA 2W83A 4TMKA 5EXXA 2XTMA 5M04A 3DM5A 3MRSA 3IHLA 4TYQA 4ZCLA 5DN6A 2R62A 1WBBA 4MRVA 1JEEA 1G6HA 2IYVA 5DH9A 3U3OA 4HZUA 3RSLA 4MYTA 2V9PA 1N6LA 1W0KD 4TL7A 2BMDA 2BC9A 3L0OA 1Z0FA 4YC7A 1NSFA 3W9YA 1MT0A 3KXLA 1XCPA 4TT3A 5JI3E 3KQUA 3AVYA 2Z0MA 3TR0A 2IS6A 3IUYA 3QF4A 3DPUA 2A2ZA 3QKRB 2ZJYA 4FWIB 5LB2A 4DDWA 1E9CA 4FINA 4QFMA 4OQXA 2FFHA 1ZD1A 2WWFA 1OH7A 3P4XA 3FKSD 3N2EA 4RZ2A 2DFLA 5J4YA 1G19A 2CDNA 4PR0A 1YZLA 4DDTA 1LF5A 1FW6A 2MSEB 3VR6A 3ADKA 3CW2A 2NO0A 5FOTA 5ELXA 1OT3A 1AN0A 1P5ZB 2JDIA 4DLRA 1FUKA 2XXAB 1E2IA 3B1WA 2HEIA 1M2OB 3NTUA 4TQUS 3MWYW 1ZP6A 4LHYA 1KGDA 2QSZA 1ZM3A 1E9BA 3EPHA 1N2CE 3HPRA 4URUR 3RRNA 3L0SA 4A0RA 2QAJA 2VYFA 5A0FA 4C0BA 5KTYA 1AJEA 1NN3A 1E99A 1XFAA 2BIFA 3IHWA 4D82A 2QPOA 2CLDX 4TLBA 3A37A 1ZJ6A 3VAAA 2JGNA 2JLQA 2FSIA 1T8TA 2AX4A 2JJ1A 4Q19A 3G5UA 1IBRA 2Z5FA 1I2DA 1G9XA 5JMTA 1DAMA 3DO6A 4U02A 4A82A 2P65A 3REFA 4L9SA 4BFXA 3AVVA 4PX9A 2XOKA 3U6KA 4RKFA 4M22A 4GPTA 3SQWA 2JASA 5K8LA 1IAQA 1XEXA 2J0UB 4OHWA 2O0HA 3HJNA 4EJSB 2CLSA 3CNLA 4O2RA 1IM2A 5JS7A 1KKMA 4EPWA 5K8UA 3GEHA 1ZC4A 3AF2A 5GVSA 5JLJA 621PA 4DWJA 4TLAA 5HZHA 4PO1A 4LBWA 4X8LA 2FEMA 4Q5IA 4AURA 1KK3A 2XB2A 1P72A 4WVFA 3THOA 1EFCA 1RYHA 3P4YA 2GK6A 2PH1A 3B13B 4CRWB 1UEJA 1IXZA 4ITRC 4P32A 4B2PA 4ESVA 1AZSC 3AVXA 4MKIA 1XMJA 2QTHA 4Z1MD 4I81A 1XTKA 2VP4A 4DXAA 4GL2A 4IOKA 3WRYC 1Y3AA 3Q7QA 3D3QA 1G8YA 3A1WA 5AUOB 2CEAA 3BS4A 3O8DA 5EE5B 4JKYA 4JLAA 4OHZA 4BECA 1OKKA 3RDPA 2ZI4A 1WRBA 1L8QA 4ACBA 4KITB 2WMNB 4FN5A 3B1VA 4NYMR 2OBNA 2NPFA 3RS3A 2WJVA 2YWHA 3B1XA 4H1UA 1CIPA 4KFRA 4GP7A 2Q9CA 3ASYA 821PA 3B8HA 1TAGA 2O8DA 3QXXA 2H8KA 4O0MA 2EWVA 2X8AA 4R2HA 1BO6A 1DAGA 2EFEB 2W6ID 4DKXA 2V7QA 2IS1A 4FMDB 4RZ3A 1ZVQA 3EG5A 3M4YA 2AL7A 1XTSA 1GNRA 3CIOA 5GVRA 4EPRA 4A1FA 4U00A 2DPXA 1KI8A 4DEXA 3AV0B 4Z51A 3WYAA 4D26A 1HV8A 3CRRA 3E70C 3IO5A 2CCJA 3BE4A 2CXXA 3MWLA 1Q3TA 2Q3MA 2WJHA 4P4SA 3ZVMA 1VIYA 5FBQB 2ZRBA 4B3DA 5EE0A 2NZ8A 4MDFA 2ZJ2A 4KXFB 1S8FA 1MKYA 2F7SA 4I1VA 2H5EA 3X2SA 1S9HA 5ANRB 3OAAD 2OCBA 4M1OA 4DLVA 4DSUA 3LO5A 1NVVQ 2ODNA 4LYAA 2J7PD 4V0KA 1IY2A 2QBYB 1YQTA 1KMHA 3VHXA 1NG1A 1JALA 1A2KC 5FR1A 4IDPA 1XPRA 4HDQB 4DLXA 2HYDA 1VMAA 4WAUA 5TV2A 5JBQA 1TADA 3PVSA 3QQ5A 4B71A 5JCZA 2UZIR 2AKYA 2QI9C 3CNNA 1NVXQ 2VF8A 5KSOA 3RS2A 3NEYA 5TARA 4DT1B 2PEYA 3A4NA 3KTAB 3X1XA 4OQLA 4C4PA 5CK4A 1E98A 1YZKA 4JIMA 2ZRIA 4NYMQ 3H84A 1P3JA 5KU1A 4B35A 2FZLA 3AGPA 2YHSA 2HT1A 4YMSA 1QHIA 4PQFA 3ZD6A 1R0WA 4Z54A 2Z43A 2ZSFA 3AVQA 1QVAA 2I1VB 4RZUA 1FQJA 1TNDA 4CEHB 3THXA 4TMVA 2AHOA 3AKEA 4IDQA 3ZQ6A 4N0DA 3HYTA 2CNWD 3W8NA 5AUNB 1RE0A 3AVUA 4HUQA 2QGNA 2IF0A 1MABA 1EX6A 3AF4A 4C7OA 5KNDA 2J0SA 2WWHA 2OM2A 2QMEA 4PFSA 3TQFA 2GZDA 5KSYA 1KAGA 5IRCD 1XPOA 2D3WA 4WOPA 4DC9A 3RHFA 2ZITA 1JR6A 4DJTA 3T5GA 2XX3A 1NLFA 4ZKEA 2PJRA 1ZD9A 3GLIA 1DBSA 2OFWA 4Q7LA 3FHCB 3X1YA 4RD3A 1HUQA 1U0JA 1DEKA 4GNKA 1IHUA 1KDTA 2F43A 4Q18A 2E1RA 4LX0A 2QE7D 5F2EA 5SZJA 3CO5A 3T1VA 1Z6XA 4B47A 1ZNWA 1MO3A 5LDDC 4ZDIA 2DY1A 2ZE7A 2I4IA 1Z0JA 2QP9X 2RKOA 4JVLA 1N3BA 3QPUA 3EC1A 3RC3A 3ZIAD 2O8BA 3T1QA 4AC9A 3B2EA 3DHWC 1YVDA 1Q0UA 4K46A 4DDVA 3I61A 1PJRA 4MKGA 3U7GA 5L3VA 1SXJA 2H92A 1ZC3A 1U94A 3WNCA 3I5YA 2P6UA 1W47A 2CL0X 4F4IA 2GEUA 1VCIA 3PV0A 3LQRA 1J99A 3UWKA 2ERYA 4D4JA 2Q21A 4BFWA 5FTKA 3K09C 4A36A 1U9IA 3HU1A 3PR1A 1EFRA 5EE9A 5KOYA 2B21A 4H9GA 1W4CA 4RFSA 1YZTA 2IK8A 2ZAOA 3EX7C 5FBWB 3VFDA 1OH5A 3EA5A 4LHWA 3HYRA 1ZCAA 4TSFA 3QEOA 1NF3A 1TL7C 3A4MA 4MYUA 3VX4A 5JRJA 4CEIB 2LCFA 1LV7A 4MRPA 2IYRA 1W2HA 3EZ2A 1CXZA 2IA5A 5B64A 2BKUA 2JJ2A 1Q21A 3F8TA 1AIPA 3OFNA 3QPVA 4NKRA 4D2IA 4YLGA 2ZSAA 2CHVA 4WZBE 1FPMA 4TYYA 4I1SA 4PO9A 5IK2A 2RGBA 1US8B 3LBIA 3DOEA 4MH0R 5AJXA 2JLSA 5FPTA 4AIIA 1D2EA 3IEVA 1T3HA 1ESMA 3DKPA 5C4GB 2R2AA 2ZS9A 5FI0B 1M7BA 2IUSA 3IIJA 6Q21A 4G5OA 3FFBA 5EXSA 1H8HD 2IHBA 2VSXA 4Z8XA 2YKGA 2UVQA 4JS0A 4B2IA 1JB1A 4TZ0A 1KI2A 1S1MA 3LW7A 1CF4A 4BRWA 3WP0A 3K0FA 2BMJA 2IYXA 2QAGC 5LPNA 1IN4A 4OI2A 3GLFA 2MMCA 1E79A 4Q9HA 1NKSA 2IW3A 1R2QA 3BJIC 3BD9A 3FMOB 4A0HA 1N5IA 2GAOA 1NMXA 4FWTA 2VP5A 1UKZA 1NSTA 5FFMA 3ZGXA 1LY1A 4F7WA 4TT3D 5TB5A 3U7HB 2CLCX 3K1JA 4Q21A 3SNHA 5DGXA 1E3MA 1FNMA 2G1JA 3BH0A 2QMHA 3TSWA 4CF7A 1BS1A 4OI4A 5C2JB 4EFLA 1GL7A 1XD2B 3B9QA 2GXAA 4KLNA 3RRZA 4BGDA 1Z6GA 2XTZA 2IHYA 3BGWA 3H1TA 1LB1B 2H17A 4QXAA 2R6AA 5BW8A 2GXSA 1G8FA 2NO6A 3BC1A 2CL6X 3VR4A 1LTQA 4UXHA 2NO7A 5KUTA 1NNEA 2UKDA 3AP1A 1QBKC 4B44A 2JDID 4TTPA 4JMPA 1Z0KA 3REGA 2XNDA 4NONA 1XU4A 2HXSA 4ASUD 3B82A 1CR2A 2H7VA 1WCV1 2OAQ1 3DZDA 1R6BX 3FVQA 4QG7A 5AJZA 5F9FA 2FZ4A 2HF9A 3KFVA 5FH9A 4K81B 5H8WA 2Y8EA 1XJCA 4JLOA 1S0UA 2C9CA 4HAUA 3U44B 1O3YA 1X1SA 1GRQA 1GNQA 1VG1A 2GZHA 1RC8A 2JJ1D 5UKDA 3EARA 1E0AA 4AI6A 1R8QA 1XCMA 3TIFA 4NCNA 4DHEA 1K5DA 2OG2A 4IXNA 2A5FA 1ZRHA 3K9LA 3PIRA 4QBFA 4Z8YA 1VECA 4RD1A 5CK5A 3PG5A 5KYKA 2CBZA 1BOFA 4TMZA 1UBGA 2R44A 1P62B 2OT3B 2QM8A 2J0VA 4LYHA 1UEIA 2QU8A 2ZUDA 3OZXA 4LGMA 4TTQA 5F98A 1TPZA 3WP1B 2WJGA 3PJRA 1JNYA 1VIAA 3SFZA 1Z22A 3TSOA 1KJWA 4D81A 3SBDA 1W2GA 2HJVA 3NDPA 3B7GA 1E2JA 2HJGA 2GK7A 3FB4A 4P3YA 1XD9A 3LQQA 3K70B 4Z1MA 1CP2A 4HAZA 2IXGA 1W36D 3KUCA 3RWMB 3KQHA 3KKOA 3NC1C 4YMTA 5JJLA 1G5RA 2QPTA 1DVRA 2W2XA 3P27A 1QVRA 1T3SA 5FTJA 2FFQA 2QAGB 2WIAA 3ZZ0A 2J41A 1GVNB 2QL6A 2EVWX 2R8RA 1LFDB 1KDOA 1F3OA 1E2KA 1Q1QA 1COWA 3U3MA 4HYYA 3CB4A 2ZR0A 4LOAA 1OXUA 1B0UA 3CH4B 2BEKA 4IVQA 2HF8A 4PAMA 1XB2A 2RGNC 1LS1A 1ZUNB 2O0KA 3EXAA 3SN6A 1RZ3A 5EP3A 4DRZA 2FA9A 1SVLA 1J8MF 2ZRNA 3BAFA 1KY2A 4HZIA 2L0XA 4LPKA 5C18A 1FP7A 3GD7A 2D2FA 1XZQA 4JLKA 4UXJA 2AK3A 2YWGA 1NL3A 3LAWA 1CJTC 1YR7A 2IL1A 5JFGA 3CPEA 1OF1A 4JLJA 3BH6A 3C14C 1TQ6A 3B6EA 3CLVA 1XBTA 4LJ5A 4A6XA 1GKYA 4NCIA 1MOZA 1RPZA 3QKRA 3WNDA 3IIMA 4D6PA 3OAAA 3MSXA 3NEJA 2J7PA 3ASZA 5BN4A 4GOKA 4L4UA 4M9QA 4IVPA 4TN1A 2PBRA 3JVVA 3AF1A 2XTNA 1CR0A 3WHKA 2NIPA 2ZE6A 4FMBB 2YZ2A 3RVBA 4ABYA 4PHTA 4RKEA 3LX5A 2QPAA 5DIFA 5JS8A 4GFDA 4NZYA 1ZNYA 3NH6A 4DCSA 2XXAA 3AKYA 4LHZA 1G3QA 4ERNA 5FL3A 4XTRA 1NI3A 1E2FA 4NBSA 1G7SA 4TYPA 1ESNA 3SE0A 1S2MA 3W6OA 4FCVA 4UNNA 5TDHA 3VU9B 3SOPA 3P1JA 3NKVA 1SVSA 1XXHE 3SU8A 1G6OA 4CEJB 1E2NA 1II9A 3U2QA 2ZE5A 4PPGA 1E6CA 4TMXA 2IYSA 3VKWA 1DOAA 4N0EA 1GRNA 2K5UA 3C7KA 4JT2A 4BEBA 1XTQA 3TUJC 1EWQA 2OCAA 1W5TA 1VYUA 1YHNA 1RRPA 1Z0DA 5G3YA 2EFHB 3EPLA 2QNRA 1GKUB 5DNYB 3QOFA 4X8MA 4Q4AB 4I4LA 1T0JB 4HB3A 2GDJA 3B5JA 4A15A 4IJMA 2J0UA 3R7WB 5CLQA 1R0YA 1PUIA 5E7IA 1G17A 2CHGA 2ZUBA 3DMNA 4C0HA 2ZJ8A 4C9BA 2J46A 2VSFA 1OHHA 1GOTA 3IBYA 2WWWA 1SHKA 4LBYA 3B1YA 1YZQA 1G4AE 2MMGA 1DELA 2QE7A 1DPFA 3A6PC 2Q0HA 1DG3A 1N25A 2NO9A 1HURA 4ESHA 2IEYA 2VF7A 4ZDWA 2WM9B 1E69A 4JYBA 4URXR 2GCPA 5CLLA 3UIEA 2OFXA 3GJXC 3HR7A 2F1IA 4D80A 1VCNA 4GMXA 3ZIAA 1CR4A 3WMFA 1VG9B 3KXKA 4FCTA 4BEJA 2AN9A 1OIWA 3HP1A 3SQXA 2ZETA 2F1JA 4P0TA 2AK2A 3LBHA 3EPJA 2ZSBA 4O25A 3SJBA 1CS4C 2YINC 1SVMA 1G8PA 1YR6A 3ZLJA 1DAFA 1H65A 5AJYA 2RGGA 5JRZA 4KODA 1W4BA 3PFIA 1G7TA 2AD5A 1EG7A 3W90A 3KKNA 1N6PA 4M0LA 2ZSEA 4IEIA 4F4CA 3BB3A 2VPPA 1KO1A 3TAHA 1TU3A 4IDHA 4TSFD 1WF3A 3K9HA 3FPAA 3SC3A 4E07A 1E9SA 3QXCA 1UAAA 1T4GA 1F60A 1VHLA 3TKLA 1JQJC 1XXHB 1LW7A 3R9XA 1QZXA 4YMWA 1OV4A 5DHAA 1U8AA 1TX4B 4Q47A 1DAKA 1WB9A 3OFND 2FH5B 4OK6A 4B33A 1ZM4A 1OFIA 3NBXX 4KJZA 4EJSC 3GCGA 1W46A 3AH8A 3NHAA 4IDOA 2JATA 2GVZC 2W0MA 3NXSA 4PQYA 2G83A 5FTNA 5IK2D 2BCGY 3AB3A 3VX3A 1NY6A 3RANA 3QENA 5C46F 2GXQA 5JWOA 2KWIA 3B78A 3CNOA 1GTVA 1I2MA 4Q7KA 5E7MA 4YQFA 2QBYA 1H8HA 1JJ7A 3UKDA 4G5GA 2V55B 1AQYA 2OHFA 3T61A 4YDHB 2FSGA 2OESA 3ZZTA 1KYIA 2BCJQ 3MLEA 4BLQA 3QEJA 2ZI7A 4ZV4A 5FBLB 1SKYE 2PLFA 2IWHA 3AKDA 1E79D 4QJ4A 4GRAA 4B6EA 4DT1A 3B85A 3H2YA 3IPYA 3KTAA 1G20E 3I62A 1B23P 3NH9A 3LXXA 4TLDA 4QM7A 3C16C 1IONA 1GWNA 4LJ4A 4LYFA 1E9EA 2ECKA 4D4LA 3I32A 5B58C 3LH5A 4DSTA 2NG1A 1NJFA 1T0HB 1TQDA 1LS6A 1OFTA 4CEHA 2BBTA 1CTQA 3RNLA 1R0XA 5JI2E 5IT5A 2JLVA 4PXAA 3K0EA 5FPKA 1AS3A 2ZJBA 4UQOA 2GAAA 2Z6VA 4IW3B 4TLEA 1DO0A 2PCLA 4POAA 3VR3A 3P20A 4O3MA 1MV5A 2WZQA 2XNDD 4XOIA 2FN4A 1TUIA 1HT1E 2H18A 4ASUA 2D74A 4M1YA 4AG5A 2C9YA 2A30A 5EJEA 3RC8A 2D62A 4JL8A 5CJ2A 4V0LA 4G5SA 1J8YF 3IBGA 3OF5A 4D0GA 3L8ZA 3TBKA 2EFDB 5FTLA 1E32A 2GJAA 2CJWB 1MRNA 1TEVA 2G3YA 2ZAMA 3I8XA 4HUTA 1KO5A 3FOZA 2V1UA 4QC2A 4EUNA 3RS4A 2ZIAA 1QHSA 2REBA 4A2WA 4Q4JB 1T5IA 2A5JA 1Q57A 1FFHA 2DWQA 4MGZR 3RRYA 2HCBA 4M1KA 4JL6A 1OYWA 4QKQA 1E2PA 1TF5A 3LDAA 4WBSA 1Z2AA 4II7A 3AVTA 3KB2A 1D9ZA 1SKYB 2G0TA 3QPWA 2C5LA 5LBIA 2GCOB 1NVVR 2ATVA 3TH5A 2OILA 1D8TA 4EPYA 5HPYB 3I4LA 4PC7A 5BXQC 4ZDKA 2RGAA 1C4OA 4MKFA 5CB6A 3ZS9A 1T5LA 3AVPA 1AGPA 5EE3A 1NRJB 4B74A 4BFTA 5FOWA 4NE2A 4DCUA 2R6CA 4JLBA 2R6GA 5CYPA 2FEOA 2KSQA 4CYMA 4CEIA 1SVOA 4EPTA 3UPUA 3C15C 1JECA 3AEZA 2YC4C 1XMVA 4D4KA 1CKEA 3E5HA 3A1UA 3GJ5A 4XWAA 1KJZA 3GP8A 4FMCB 2WKPA 3BRWD 1BKDR 3Q5EA 2ONKA 4FXPA 3SI7A 4JVSB 4QHYA 4ARZB 3P26A 1NY5A 3LLUA 3D8BA 4HDCA 5FL7D 1W49A 5TMPA 3PITA 4EPXA 4TYNA 1US8A 2ZQ5A 4KSBA 4Q1BA 3L82B 2EFCB 4TQ9A 2JCSA 4Q7JB 2PZGA 3WNBA 1COWD 1PUJA 2W00A 1K8RA 2VHJA 1WQ1R 2VHCA 1EESA 3DVLA 1MH1A 4NCJA 5HCNA 4HB4A 4KLZA 1EGAA 4CW7A 2BOVA 1NLZA 5F3WB 2OBMA 3OEHD 1NKTA 3BFXA 2R6DA 3GLGE 5JWHA 2FFBA 3S1AB 2P2LA 4PZLA 1CBUA 5GJBA 4TL6A 4V0MA 2ZUCA 1UDXA 3CRQA 4I1OA 2WPDD 4Q1DA 2WHXA 5L3SB 4OI0A 2FFAA 1P75A 4JLMA 4OJQA 1DAHA 1J7KA 2DBYA 2OBLA 3FE2A 4P31A 4S2EA 2X1VA 1M7GA 1Z6TA 1ZUIA 4PHGA 1OPXA 2HLDA 3IO3A 3QXSA 5DI9A 5DI3A 4EKDA 1XD2A 2NQ2C 2IYYA 1X6VA 4HLCA 4EPVA 5J4HA 1KI4A 3IEUA 4ZO4A 3ZVRA 1WXQA 4PTLA 2ATXA 5FI1B 4LJAA 2WVJA 3U7FB 4DIDA 3A1SA 2ZR9A 4JT4A 3VKGA 1DE0A 2PX0A 3TW4A 2V1XA 2G0NA 2QMOA 3KXIA 4BRUA 1G3RA 3FMPB 1TU4A 3EASA 3TMKA 3BIFA 1A5TA 2BDTA 1UKEA 4PSVA 3ZD7A 4OKSA 4ILEA 1G64A 2FG5A 2WBLC 1UFQA 2NZJA 3SJCA 5FUWA 3PEYA 1Q1ZA 4KCGA 5SZIA 2ZS7A 4GSYA 3JVUA 3K09A 3PXGA 1MO4A 4QGAA 4MGKR 1VYVA 3OEED 4P33A 3SFVA 2JLZA 1GDDA 3U44A 2WKQA 2BWJA 2F9LA 4LBZA 4EQ6B 2OXCA 2H57A 3VHLB 3TNFA 4MUAA 1E2LA 2WICA 4FMDF 3QJYA 1XP8A 4PPNA 3SYNA 4DCTA 4LHVA 2WV9A 4YMUA 4OQNA 4FI3C 4ZPXA 4PC2A 4Q01A 1N0UA 3TJZA 4Q00A 1W1WA 1QHGA 2NO1A 4BFZA 1EWRA 2AFIE 3GLGB 1OHHD 3DMDA 5E4FA 5JSZB 2EWWA 3CRW1 3E2IA 1R5BA 2CK3A 3CWQA 5H70A 4C0AC 2GNOA 5DO9A 1FTSA 3W6NA 2HXYA 1XTIA 3H4MA 2ZXUA 1XMIA 3Q5DA 5HKKD 4HEJA 1F2TB 2B7BA 2YNMA 2GF9A 1PVOA 1VDZA 3L8YA 4WZAE 4C0SA 1NG9A 2CE2X 2GXUA 2ZSDA 4L15A 5FUYA 4FD2A 4XH9B 3Q72A 5EZ5A 1SULA 3G0HA 4Q9KA 2WIBA 4A2QA 5FUVA 4V0ME 2QAGA 1U8YA 2YJTD 2YWEA 1CRPA 1CJUC 1KKLA 3RSOA 5BYJA 2XZPA 4BPBA 4YMVA 2CHQA 3W3ZB 3A1TA 5HZKA 3T06B 5CDFE 1FMLA 4CIDA 1XPUA 1SVIA 4BWYA 1Q12A 1AGRA 2YYZA 3IIKA 1E0JA 1T6NA 1NP6A 2GEDA 2ZYUX 3J81k 3TVDA 2GESA 1YR9A 1F5NA 4A0FA 3AVOA 2QENA 1FX0B 2G88A 2WKRA 4C2UA 2ANBA 3VNVA 2ZRFA 3ND9A 1KO4A 2EW1A 1AS2A 1CEEA 4PO8A 2O8EB 4ZIRB 5FUXA 4C2TA 1KDPA 3A36A 3LW8A 1NIJA 2ZROA 4HLUC 1QHNA 2GBLC 1NN5A 2V3CC 3V4RA 3UMRA 5FTMA 5JJKA 2PX3A 3W5JA 2F55A 5JJIA 4AD8A 4LJYA 1XJ0A 3EIQA 4R9UC 4GI7A 1UM8A 5JWRA 1IJFA 3T15A 4Q7MB 4BQSA 1XCGB 2BVNA 4XVRA 2AR7A 1RRFA 1XRJA 4R2IA 5HTKA 3K70C 2P6NA 4D0LB 4TYWA 2A9KA 4W5JA 4QBIA 2RCNA 3O8RA 2VTKA 2ZI6A 4G01B 3ZVLA 5DISB 2C78A 3LXRA 1E9DA 3LV8A 1JXOA 1II0A 2ZYTX 2O0JA 2KJQA 4IFEA 4M53A 3NWJA 5EP2A 1OB2A 4M1MA 1OFHA 3CRMA 4UJ5A 2O8DB 2RGDA 4KYUA 1KDRA 2FGKA 3A8TA 4TL9A 4K8OA 2JIZD 4XTCS 4I1UA 1QHHB 3BFKA 5EQTA 5KNCA 5E95A 2QZ4A 3VU9A 2GJSA 4XWOA 3KUDA 4RFVA 2ZI9A 1W44A 4CEJA 1ZYUA 3AQ4A 2C03A 3EC2A 1A2BA 4KI0A 4RD2A 2ORVA 3I1FA 4WZ6A 1FMJA 1Z83A 3TE6A 2R9VA 4RSGA 1A4RA 1HY3A 1I4TD 3CONA 2A7QA 2IF2A 4G0NA 4Q4AA 1Z06A 1VTKA 4JJKA 3A1VA 3BB4A 4QGGA 3EW9A 3R7WA 5J40A 2AXNA 2P0EA 3O8CA 1EFUA 4JLNA 1M7HA 1AA9A 1Y63A 3PUXA 4TL8A 5AWFC 3OIUA 4NH0A 4DIEA 1KMHB 1A82A 1S96A 4Q9LA 2HCJB 4RD4A 1MO6A 5FOUA 2FE4A 3A4LA 3GLHE 3VQTA 1P6XA 3IQXA 2KBEA 2V6JA 2ZI5A 2RGNA 3NBFA 1Q20A 4URZR 3T12A 4E22A 1DO2A 2B7CA 1YU9A 5CJPA 4MA4A 4G5QA 3A58B 5TY0A 4EIWA 3QF7A 4QGHA 1U2RA 5JEDA 2VP2A 1G16A 2XEXA 2J9RA 3UMFA 2KE5A 4V0NA 3OESA 2GJ9A 4KHZA 2GRJA 2DB3A 3AP3A 1WA5A 2EYQA 3DEFA 1GIAA 1P2TA 2NMVA 1U0HC 1VYTA 3BWDD 3QG1A 4B3BA 3NBZC 4OHXA 1AZTA 5KDDA 4KFTA 3ZQJA 1XEFA 4Q4HB 2D7DA 1W4RA 3QG5A 4LK2A 4A92A 1ZBDA 2D4HA 3RABA 5B30A 1P9WA 4U5XA 1FOEB 1R5OA 4UXIA 3QE0A 1AS0A 1G8GA 2X77A 4H1VA 3UG6A 1YRBA 1IJEA 1XXHA 2GF0A 2QRNA 4DB4A 4KV9A 3R8CA 4DLSA 1QHXA 2TMKA 2RB4A 2H16A 4Q02A 1S3GA 3C8UA 5KO2A 1JXMA 3K0CC 1YZUA 3PQCA 5FL7A 4E09A 1Z5ZA 1X3SA 2QGZA 3BBPA 3IDQA 4KO8A 2FSHA 3VTKA 1ZINA 2JLUA 4NMMA 4PQRA 1KO8A 2IS4A 4TQAA 2X2FA 3KJEA 2BMEA 2CVHA 2EYUA 2A5GA 4L16A 5K8TA 1D6JA 1PV4A 3WXMA 1KNQA 5EXPA 1IXRC 2DWOA 2GA8A 2ZEJA 2OAP1 2E87A 2PCJA 2GVDC 3U61B 3WY9A 421PA 1KO7A 1TEXA 1DS6A 2DWPA 1U81A 4J0QA 2PJZA 2ZREA 2GHIA 3L0IB 3X1ZA 4B34A 2J3EA 4DZZA 3CM0A 1ZNXA 4E03A 4AKHA 1X1RA 3GLHB 3NBYC 3PEUA 1ZCBA 3OEHA 5KHOC 1GILA 1C9KA 3WBKA 1LF0A 2W0SA 1G41A 1E4YA 1N6NA 2HT6A 3PCRB 3U4QB 1NN0A 3U7EB 2WPDA 4F92B 2ZRAA 1E9RA 4JLVA 4F4JA 2WSMA 4QJ5A 5DE3A 2MSCB 2DFKB 3SR0A 2QTFA 1ZIPA 2PEZA 3LY5A 1GFIA 1PLKA 1TF7A 1F6BA 1HE1C 1HQYE 3HU2A 2HLDD 4B43A 1AK2A 4XD7A 1P2VA 2BEJA 3CPJB 4O2LA 2C8VA 5HE9A 4F38A 3QI2A 1HE8B 1N5LA 5C1BA 3BOSA 4M9SA 5B2ZA 4X8OA 1W48A 4TMTA 3GMTA 3AUYA 4ZDJA 2ZRHA 1X8LA 2W58A 4OI1A 4AWXA 1WBDA 1D2MA 3CBQA 2C77A 521PA 4LC1A 4BLRA 2AKAB 1G3UA 1J2JA 2GILA 4JKIA 2ZRMA 3WYGA 4RD0A 4BZPA 1TF2A 4HDOB 4KU4A 1KZGB 2OCPA 1GZSA 2CCGA 2QM7A 3LNCA 4PHHA 1C1YA 4HAYA 3SEAA 3OEEA 4B48A 5FOVA 1OXVA 4LY6A 2HYIC 2CJWA 3BERA 3B60A 3QUSA 4HLQB 2NPIA 4W5HA 3RS0A 2F1RA 3CRVA 5J4KA 4Q4JA 3PUZA 1XDBA 4OBEA 5C4MA 4CVNA 3W34A 3P32A 4LZZA 4W9MC 3RYTC 5CM8B 3R9IA 1SVKA 4B3CA 3FYHA 1N6HA 3PENA 4MYHA 4EJSA 5FBVB 2A3RA 1OXTA 4AYXA 2GCOA 3KL4A 2VP6A 3TQCA 5CITA 5B57C 3RRMA 1NBMA 2WOOA 2RAPA 2V8OA 2CK3D 3ND8A 1KZ7B 4G5RA 1FL9A 3AM1A 3OE7A 1KI7A 4OK3A 2QEQA 1P73A 2ZYVX 4RVCA 1JI0A 1SZPA 1OXXK 4XSGA 4BLSA 4AKGA 3KJIA 4XVQA 4LJ8A 5HKKA 4XIGS 4LUCA 1G291 4PPQA 2RHMA 1UDWA 3K70D 2QRZA 3C5CA 2YOHA 4C0KA 2WJJA 1N0WA 5JCPA 2C9OA 4XSHA 3Q7PA 1KIMA 5GADl 4TTRA 3THWB 1E96A 1Z47A 2NOAA 4ARZA 4RCZA 1JQLB 4FCWA 2Q9AA 1N6RA 4IOJA 2C2HA 2DHRA 4KYIB 2GETA 1TQ4A 3PUVA 2IUUA 4A9AA 1GAJA 3CF2A 2ANCA 1UBEA 1PLLA 1N5JA 1XX6A 1YE8A 3KKQA 4LWZA 3TR5A 4BFUA 3QSYA 4LJ7A 3U5ZB 4B76A 2OZEA 1CJMA 3MJHA 3GFTA 2XITA 1PZNA 5AJVB 4KBGA 3FHTA 3IKJA 3U60B 2BJVA 2VIIA 4V02A 2B8WA 4KVGA 4PC1A 4UNSA 2DFNA 3FGNA 2O52A 1Z6YA 3QXJA 1CR1A 1LVGA 5EZ6B 1W7AA 1KI6B 3F0TA 1ANKA 2QT0A 1W0JA 2GCNA 4A6PA 3FMFA 1ELOA 1Q1EA 5A4JA 3U3JA 3KQKA 4W7SA 4CT4B 2XGJA 4M4SA 4WW0A 4UNPA 3ZZUA 4MYCA 1EFTA 3S1AA 4IDNA 4GZLA 4EDHA 3FWYA 4LCBA 1JPJA 4DSOA 4LV5B 2QP4A 1ZMXA 4N3NA 1BIFA 1KK0A 4NHOA 4JLPA 3U3RA 5L3SA 2OEPA 3K0SA 2Z4SA 3PUWA 1ZM2A 2VBCA 4US2R 5EE1A 4DSNA 4IRUB 2FOLA 1D2NA 5K8IA 1TMKA 1VHTA 3M1IA 1BMFA 1RJ9B 4TWZA 4HB0A 4PPFA 2D2EA 2W2VA 5IF9A 1DADA 1P60A 3KJHA 3VMFA 1S4QA 1E9AA 2ZJ5A 5IHPA 3TRFA 2A5YB 2Q9BA 2OLJA 4A8JC 4D25A 2LWIA 1Q3HA 4NU0A 3V9PA 3MCAA 1KHTA 1P2SA 3CZPA 1E2QA 1Z28A 1KK2A 1NBME 2Q3HA 3ICQB 1S1CA 5FPYA 2HV8A 1JPNA 1KK1A 1L7VC 4AKEA 2JIZA 4BZXA 3MWJA 3TGPA 3N70A 5KDOA 1CLUA 2OO7A 3LD9A 1DG1G 3WHLA 3UANA 3LX8A 1L4YA 3CZQA 1E1QD 4EQ6A 3BORA 2F6RA 3CX8A 4IHQA 3BH7A 1R10A 2FJUA 4DUGD 3AF0A 2ZVPX 5JZVA 1DAIA 1XWIA 5DSZA 4P4TA 2NGRA 3W3AA 1Z08A 2ZU0C 2DCUA 3X1WA 3THYB 3KB1A 1CJVC 5TVKA 1X86B 2ZRGA 5FPSA 1GKIA 1BH2A 1KSJA 4IVRA 4YDSA 3GLGA 1XTRA 4UJ3A 5JSZA 1GL6A 1G1MA 1WMSA 4R7ZA 4W5WA 3EWAA 2A5DA 4Q9IA 2QQ0A 2XB4A 2OXRA 3GJ3A 3TSZA 2R6FA 1XD8A 3Q9LA 3IPXA 1Z2CA 4M1TA 4IEEA 5EUQB 4B32A 1KSFX 3LVQE 5BQ5A 2J7KA 1IOZA 1F2TA 1TTTA 1OW3B 2BBOA 3ZS8A 3QKSB 2ZU6A 1OIXA 3G82C 2GJKA 3AGQA 3VNUA 4M2LA 1ZM7A 2YV5A 4JJZA 1KY3A 4MRRA 4Q48A 3EZ9A 3F3YA 3TK1A 2QT1A 3Q8XB 1SGWA 1II8B 2N46A 5KPJA 4Q1FA 2IYTA 4F93B 1D5CA 3MUFA 4JVNA 2ZM5A 3AP2A 1OH6A 4URYR 2D7CA 3EIHA 2QORA 4GOJA 4KVAA 4M8NE 3ONWA 1OYYA 5L3QB 2FDCA 2O8CB 1QHYA 2PMDA 3M6AA 3UG7A 1NIPA 5E7JA 2GTPA 1E2MA 3N2IA 4NTZA 2G1KA 5G40A 2GWHA 4DLUA 1FQKA 1FX0A 3Q3JB 4QBGB 3BK7A 3AUXA 1G3MA 2R65A 3LA6A 4MGYR 3ICEA 1GSIA 4XVUA 1XTJA 4DDUA 4AYTA 4ZIRA 2O8EA 3EWSA 4A2PA 5P21A 1E2GA 5KSPA 5AK0A 5D3MB 1CULC 3RLFA 1UBCA 2IEZA 2KB0A 1YJ5A 2FU5C 2ZRCA 2FNAA 2ZRLA 4A8JB 4IKEA 1IY0A 1F2UB 4PAQA 4YONB 5D3QA 5CYOA 1XMSA 1KSGA 4URWR 3MGCA 3O8BA 3SJAA 4ZI2A 5A5GA 4ON9A 2IYUA 1P7CA 2ZRJA 1M1YE 3K0AB 3LWNA 3PEVA 3WMGA 1N6OA 4YXWA 3TUIC 4B6FA 5BYKA 4RD6A 3KDSE 1ZD8A 4RJLA 4AY2A 4HAVA 1LNZA 2QA5A 4QM6A 3SBEA 3GQBA 3MWKA 4MRNA 4Q1AA 4QOSA 2G9NA 5EUMA 2EFGA 4OL0A 5AR1A 1K5GA 1OSNA 2W6JA 4QL3A 5G3ZA 3SYLA 4Q9JA 1U0LA 1Z63A 1XF9A 4MDEA 3HWSA 2C04A 1KAOA 1JEDA 2REOA 3B9PA 5FPHA 1QHHA 4GZMA 2ONJA 1UKVY 4MUBA 2FF7A 3ECCA 1Z3IX 3K9NA 1E2EA 3K8YA 3WYFA 1Z0AA 1S9DA 2O8FB 4RCYA 4ZCIA 5CDFA 2B92A 3GJ0A 4QHSA 2QMUA 2IYQA 4XD7D 2AWNA 4B3XA 4JBWA 2QY9A 3GFPA 2J87A 4DB2A 3OIYA 3FHOA 3QBTA 4GT1A 4C0LA 3GJ6A 5FOXA 3T5DA 5FBRB 1H8EA 1EFHA 2I3BA 4RY2A 4AG6A 5G53C 4NCHA 2VRWA 4TMWA 2FPKA 1XJQA 4DLTA 1R0ZA 3DDCA 1E1RA 1VCOA 4AK9A 5DYGA 3DKVA 5GJVC 3TUZC 3C5HA 1Z8FA 4FMCF 2J0QA 2YOGA 1J90A 3CR7A 4OK5A 2XSZD 2OE2A 1DTSA 1W36C 1ODFA 1P9RA 4B75A 3T1OA 3ZVNA 5JEEA 3CKLA 1XEWX 4MITA 1AM4D 5KPDA 2P5TB 2RGEA 5GJCA 4A4DA 2X19A 2KI5A 4HZUB 5J5CA 2FWRA 1G5PA 2HUPA 2N1BA 1M8PA 2RGXA 3LVRE 4JL5A 5CIWA 1MR3F 1M74A 2IWRA 4L8GA 2C99A 2N42A 2BHRA 2JLWA 1Z0IA 1CJKC 4HLUA 1JR3A 1J70A 2WSSD 3X1DA 2GBLA 4PANA 4BUJA 4M1SA 3MFYA 5AUPB 1GNPA 2OSBA 3QF4B 1Q22A 1IN5A 1G18A 4U7DA 4BLTA 3FDIA 1NBMD 4G1UC 4BZQA 3CF0A 4Q4HA 2RHDA 2GJ8A 3OE7D 3ZH9B 1X8KA 4KBFA 4BE7B 2RH5A 1RFLA 2WMOB 2F1HA 2AFHE 5G41A 2VP0A 4UNQA 4JBYA 3CF6R 1HA3A 1JAHA 2WAYA 3AVWA 2IC5A 1UPTA 1E94E 4MRSA 1G8HA 3CH5A 1A7JA 4HAXA 3CUEF 1AQUA 3B1ZA 2ODBA 4XWKA 2OV2A 5HE8A 2ZJAA 4PC6A 2OCYC 4ZCMA 1NJGA 2WAXA 5CM9C 1RKBA 2OUKA 2XZLA 1OIVA 3WMEA 3Q85A 1OFUX 4OYHA 2ERXA 1GL9B 4C0QC 1MRSA 1JJVA 1MO5A 3T1TA 3I3SR 3V00A 1CRQA 3VR5A 1HQCA 4LPSA 221PA 4JZKA 3LRPA 2BJWA 1WDTA 1U8ZA 2RMKA 3QKTA 1QG2A 1KI3A 4BFSA 2SHKA 2JLXA 3M0EA 4M9XA 1W0JD 4LRWA 4LC0A 3NVAA 4M9ZA 4RZXA 2Q6TA 3W6PA 3GLHA 2D06A 1XEXB 2JLRA 1T9HA 1TQ2A 2WWXA 4PSAA 2BMFA 4TZ6A 2WJYA 2WTUA 1X8JA 1NVUQ 2XAUA 3R20A 3TLXA 3KQLA 4D0NA 4BLOA 2PMKA 2VHUA 1R4AA 5LB4A 3U4QA 3UK6A 2BKEA 5CIQA 1KMQA 3HPQA 2FGJA 1JBKA 2ZS8A 1ZIOA 1V43A 4X8HA 3C4JA 4JBXA 4QNMA 4UNRA 2QTVB 2C96A 1BMFD 2ZR7A 3VR1A 4DLWA 1W36B 1ZU5A 1RYFA 4IXMA 4Q4LA 4V03A 4JVMA 4US0R 2ORWA 2LKDA 4HAWA 1AKYA 1ZAKA 2ZI3A 3CR8A 1JR3E 3UXMA 5SZHB 1VKJA 2O5VA 3WRXC 2VO1A 4WIAA 4HATA 1HTWA 2IT1A 4Y0VA 1E2HA 1T91A 4AKIA 4OJKA 2B8TA 4R98A 2J5XA 2YWFA 2DFTA 5TXGA 1D9XA 4DLZA 2YC2C 5J4LA 4M1WA 3EZ6A 1E9FA 3CWZA 2MSDB 4OHYA 1QF9A 2IX3A 1FP6A 4S35A 2QP3A 1E2DA 1SVWA 1EX7A 2C98A 3EZFA 4R71A 4CGZA 1FNNA 2QSYA 4PC3A 1VG8A 1ONBA 5DN6D 2V4ZA 2HDNB 1Z6AA 1E1QA 1SXJC 5H1YA 1V5WA 4F91B 1IN6A 3GLIE 2Q3FA 4DUGA 1P2UA 3QNUA 4EAQA 4I99A 4PZZA 3EA0A 4P4SB 1NN1A 3UATA 1N0VC 1SHZA 1W0KA 1YR8A 4Q03A 4CZ2A 1UF9A 3I5XA 1U9IC 3TW8B 1OB5A 1U99A 2AD1A 4HSEA 3ZJYA 3CX7A 3K0CA 4LBVA 3ZDQA 1SQ5A 4ZI3A 4IOMA 2VHTA 4BFVA 3O47A 5IDVA 1Z07A 1Q44A 2RGCA 3DZ8A 5DI3B 3NC0C 4WXPA 1YRAA 3KJGA 4IOLA 2WWIA 3FKSA 1IN8A 4C3ZA 2JLYA 3RS7A 1A1VA 3R9WA 1SXJE 3RWOA 4DBLC 1OJLA 3D31A 2JAQA 1GITA 1KI9A 3EIEA 2EU8A 2VSOA 3I92A 5EP1A 1XEWY 1PLJA 5JHHB 3EZ7A 3HU3A 5LD2C 3THWA 1G5TA 2ODWA 4Y0AA 2BM1A 1KI1A 5J47A 3L43A 1SKQA 2Z83A 2ZANA 4PZYA 3TAUA 4GOXA 1T8UA 2VL7A 2FV8A 1RRCA 1ZM9A 1IN7A 3FTQA 1QRAA 3FFAA 3QBVA 4DCVA 5KSZA 3K53A 3ADBA 2VH5R 3OIWA 5GJWC 2ZYWX 4BASA 3WBJA 3QVVA 3ETLA 3THXB 2A78A 3ZYCA 1U98A 4LJ6A 2FMXA 4HUQB 4LJ9A 4C7OB 1MABB 1YZGA 2BM0A 4US1R 1OLOA 1KI6A 3C41J 4MKHA 2IYZA 2XOKD 4UKDA 3LLMA 4MQBA 3SZRA 3D7MA 2VP9A 2OFOA 3LBNA 4PSKA 3JZAA 2E9SA 1OH8A 3EAQA 3KZ1E 3KQNA 4A0GA 4NPHA 3GLIB 121PA 2VQSA 4NYIR 2QQEA 2F43B 2VHQA 3JZMA 5DHFA 1UBFA 4FW9A 1QG4A 4GP6A 4DCNA 2ZRPA 4QJ3A 1G21E 1HYQA 3QIAA 1AKEA 4G3XA 4PHFA 721PA 2CCKA 2AXPA 1WP9A 3QVUA 3GLFE 1KJYA 1RJ9A 2C95A 2FPMA 2J1LA 2PT7A 3BB1A 5E3HA 4YXWD 2O8BB 3SDZA 3BXZA 1GUAA 2CE7A 2P3SA 1OKKD 3PEWA 1WE2A 4LYJA 1SXJB 2WOJA 1IQPA 1DARA 3KFXA 4EFNA 2J59A 1XNJA 3V4FA 5F9HA 1ZUHA 2W6JD 3AF3A 2WWGA
chains in the Genus database with same CATH superfamily
4V0OA 2C5AA 3HU5A 3KKMA 3UOWA 4H35A 4BXOB 2GLXA 1HSZA 3G0OA 3IUEA 4NYJR 4KR9A 1JFFB 2XRFA 5K6TA 4IS2A 1JSCA 2QN6A 4B7ZA 2V7QD 4NL4H 1KFJB 5HF6A 3ET4A 3NTRA 1QO0A 5CB6A 4FZVA 4HDMB 1KWGA 4LJLA 1O6BA 3A6GA 4I1YA 5F33A 3K4PA 2OECA 5JS2A 5M29A 2J08A 3E7WA 3IR7A 4AUKA 4MGIR 1QGUA 2VWHA 3QNWA 4BV3A 2JFVA 2OV1A 1RWVA 1VDMA 2QTAA 1CUSA 1WV1A 4JYCA 5F51A 5KS2A 5A0TA 3MTBA 2DOKA 3L8HA 4OQMA 3REOA 1U7UA 4YI5A 3CX6A 5HF5A 1XEAA 5LYYA 3VKHA 3D2BA 4HAIA 1XL1A 5AXCA 4KAXA 5K4GA 4ZV9A 5DFAA 5HIAA 1OXSC 5JAIA 2VZEA 4GBMA 4LIPD 3BF7A 1H8ED 2XR1A 5SZKB 1VLHA 1IZ7A 3KZKA 5E3IA 2X2EA 2GD0A 1I4LD 2BJHA 1L4MA 2PMCA 4J07A 3NHBA 2WJZB 3QMMA 4MRAA 5DPMA 2XJ9A 1IY1A 1KBQA 1EXMA 1N6IA 3BWCA 1QQ5A 3EQZA 3FWPA 4XQCA 4YAUA 3EHEA 5DHUA 1G3IA 1UJ2A 2FX3A 4LMPA 4CIAA 2J45A 1EE1A 2JKVA 4YQZA 1IBLB 2ORIA 1VL6A 3DPIA 1B16A 3OU2A 3TI9A 4XDHA 2I8AA 3OT4A 5BQ3A 2P0AA 2VDVE 3IH5A 4RTMA 4B2LA 1XSEA 1XMPA 2XVAA 1V5GA 3MMPA 1EP9A 1GPNA 3EUEA 2ZDHA 3U9LA 2LDBA 1XT6A 2ODEA 4JEUA 5CXXA 1NVWQ 5ESDA 2IBMA 1P61B 2C9BA 2BBSA 3KSDO 1QHFA 3P5SA 3FSGD 1J22A 1LSSA 3OM0A 3Q0TA 3R0ZA 4P1ZA 5F9MA 1Z29A 3Q2OA 3WG9A 5H68A 3DAGA 5IFLA 2H63A 4C7XA 1GSHA 3VKFA 1SG6A 3IILA 4M8KA 2IXEA 4QE3A 1ITZA 3W4JA 1IB6A 5HUHA 4LF5B 4R5MA 4KSCA 5DYIA 4BKMA 3K9GA 1YJAA 4DIOA 3NIBA 2ZPTX 4X60A 6REQB 3KKPA 3UYLA 4HGZA 2GPWA 5FQOA 1RVDA 2GBPA 2W2LA 1L4HA 4MW2A 4IZOA 1RW4A 1Q84A 2Q2WA 2QROA 1AQNA 4KDCA 1PYDA 2ASEA 2ZJ0A 2PT5A 4LDZA 2G06A 1KMNA 1Q1BA 3K05A 4CCWA 1NC3A 3A1EA 1X7WA 4YJ2A 3BXHA 1B2LA 1DQPA 1P8JA 2RCYA 3B9BA 3KYCA 5F64A 2IYWA 3B36A 4EG8A 5L4SA 2Q6IA 3QXHA 4QRDA 3T95A 4X3CA 1HEUA 4JFAA 5AUQA 4F85A 4QPDA 4UD6A 2V9CA 1B2RA 3WL3A 3DYIA 3AKCA 3DL0A 3LPAA 3ZXYA 2B5VA 2V58A 4D8VA 2ZRDA 3D6TB 3I73A 2OQRA 2ZJOA 1LQUA 4OJTA 4PBRA 3DE2X 3SJZA 1M73E 3FBTA 3CVWA 2OK8A 1R7RA 2NU7A 1KOFA 1F2UA 4HLDA 1Y8RA 2V65A 4K6OA 2B34A 4L9WA 4MEAA 5E6RB 3UT5B 4Z1OA 3I04M 1V3TA 2ZYGA 4CT5A 5TGZA 3U6BA 1QDEA 5BURA 3ET5A 5AK6A 2NAPA 4H1WA 2L17A 2X7JA 1PK7A 2DR3A 1RTKA 2E37A 1TUEA 2HJSA 2V7UA 4G5XA 3PP8A 2Z6UA 2IS2A 2C8JA 1VPLA 2PXHA 3OIVA 4JLDA 3MVEA 4DVGA 3K0AA 1G1AA 1O87A 2QG9A 3GEEA 3TLYA 4FPXA 1YBVA 5C1PA 4YRIA 2I1QA 5JNUA 1TLTA 2YQ4A 4D98A 2P9JA 5HM8A 2AN5A 4E7PA 4ETWA 1T26A 2FY8A 1XQ1A 4DBVO 3EIWA 1ZUD1 4L5BA 1EUDB 2P1RA 3GLSA 4UBOA 4AU1A 4G9BA 3K8ZA 3RS5A 7AT1A 4P9NA 2BV3A 1HO3A 1ZNZA 1JX6A 4ECEA 2E49A 2KMLA 1AO3A 1NMYA 2O8NA 2BGNA 3CPSA 3S5UA 4AMGA 3DP9A 3WLTA 4RA6B 2KBFA 2X9NA 1XZKA 4INAA 5I8WA 1A88A 3FKQA 3HMQA 4Y6QA 1E4VA 1N6KA 2W2TA 1DAOA 1EFRD 2FK8A 5DBHX 5D5PA 5AKHA 1JDTA 1FTNA 2RHGB 4HQFA 1NE7A 1SCKA 4Q39A 2BLLA 5ESXA 5CG1A 4C76A 3AILA 1PVVA 2BFMA 4HWOA 3ADDA 5I3ZA 3PC4A 3PPYA 2XZOA 3T9EA 1NLYA 3W5IA 3KLOA 5IXSA 2F3RA 2RHJA 2TMGA 3DOFA 1I4DD 4J4TA 2C5EA 4KN6A 4YRNA 5FWDA 3B5IA 3BSSA 4B73A 5C5EA 3HXTA 2OOKA 4XEUA 2EQBA 4ZP1A 1V8FA 1W5SA 2H1HA 1IM8A 4PAOA 4KFSA 1ZK2A 2OCGA 2OORC 1OTXA 2LVBA 4C3VA 1ZCFA 2O1WA 1D2AA 4NFHA 1IBMB 4FEYA 4KBYA 1G60A 1YZNA 4M8IA 3FYTA 1YT5A 2WQ6A 4TRRA 2UYQA 1YKSA 1IATA 3A6JA 3SXJA 3VVLA 3JALA 5AW9A 3UHOA 4ALKA 1H2AS 5FBZA 5AVOA 3I1YA 2OA0A 4Z7OB 2IYLD 1VBFA 4PSCA 1W35A 4QATA 4Q1CA 4UEQA 4OHVA 3SIPA 5I7EA 3C8HA 4TMKA 1QGYA 3BWEA 1YU6A 5M04A 3F9CA 3UICA 5LOVA 1B8NA 1PZGA 3FVRA 1WCYA 3MRSA 4U3JB 1W87A 1L4EA 3QQPA 5DN6A 4R6XA 1L7NA 1NASA 4TVKA 5ULLA 1CR6A 5CLJA 4M99A 5KX5F 3I2IA 2P4UA 3UJDA 5K0BA 1M1YA 3F9RA 5LUBA 1SUFA 4E08A 4YRMA 2EATA 1G9TA 3QU5A 5ARCA 3BSWA 4MYTA 4J0KA 1N6LA 3GU3A 1ZH8A 4FQ5A 1BEEA 4UTXA 1YGYA 5DWDA 4BE4A 3L0OA 4CMKA 4DPMA 1OX6A 1Z0FA 1NSFA 2LTAA 3H1AA 3N7TA 3W9YA 3KXLA 1XCPA 3PWZA 1DUSA 2Z0MA 4MRMB 3IUYA 4PZ9A 3SMVA 4KRFA 2HMUA 3DPUA 4N49A 1UXOA 5AQEA 3CY6A 2NYVA 2O2HA 3E2MA 3RTGA 3VV2A 2QNIA 5KVCA 2W43A 2E55A 1DHRA 3HO6A 1XLTC 2EZ8A 2ZTHA 4UM7A 2GN4A 3FNHA 1IVSA 5ALRA 1GT6A 2J30A 2AEEA 1G6Q1 2OPHA 1OLSA 2FSSA 2XNHA 2YHBA 2A8YA 4RZ2A 1Q3KA 1R64A 1RJFA 2Z1MA 2O54A 1G19A 4YAJA 5ITVA 1YZLA 3DO8A 1E8NA 3H65A 2XQJA 4N18A 1SXPA 3ADKA 2Z1NA 5DMHA 1U1CA 4ZEOA 4HFMA 3DDSA 3I6BA 2JDIA 4MMXB 1B0PA 1FUKA 1TO6A 1YZYA 2YIMA 1Z73A 4JWTA 4ND2A 4DLRA 1QLHA 1TVEA 1AQLA 2HEIA 1M2OB 2O6LA 1R1DA 4WESB 5AHXA 5U4XA 3ZCTA 1FVXA 2B2CA 2X4LA 4OGFA 3U31A 3LIPA 4EJ2A 4AUEA 4BUCA 1EHCA 2ONYA 3F4LA 4URUR 4B3JA 1WVIA 4DTIA 3L93A 1K8XB 2VCHA 5IAGA 3ME5A 3CE9A 5JOQA 4GPIB 1AA6A 1K2VN 3IHWA 4O4HF 4PGFA 4BAZA 4D82A 3DBHA 5IYZB 4N7RA 2H00A 3UA3A 3DFUA 4P35A 1ZJ6A 3AZPA 5CYGA 2JLQA 2FSIA 5T3YA 4KE8A 1WIWA 3NX4A 1BGXT 2A88A 1SMKA 3LPLA 5K3FA 1IH8A 4QTTB 4A82A 3KKKA 2P65A 3BGOS 4CKCB 1L5OA 1SCJA 2G5TA 3BN3A 3SQWA 1XEXA 4AP6A 5EXDA 2J0UB 4OHWA 5HJ5A 2AQKA 4YAGA 4HFNA 1RABA 3HFRA 3OD5A 1KKMA 2C3PA 5K8UA 2H7YA 1GZ6A 1ZC4A 2JFZA 4WASA 3ZHXA 5I3CA 1IU9A 3U09A 2QUKA 3M4ZA 5CP8A 3F7OA 4DWJA 3JQBA 5HZHA 1OOEA 4H0FA 4X8LA 5L3ZA 1W5EA 4Q5IA 1T2NA 1KK3A 2Q5CA 2VLBA 4FGSA 1N2HA 1EFCA 2GD1O 3EZGA 3IP7A 4WVFA 3B13B 4AF6A 1IXZA 4QXOA 2H9IA 5A7HA 4HNTA 5LL6P 1RBYA 4ESVA 2NV0A 3R41A 3PBKA 1AZSC 4FEGA 4OUDA 1XQVA 3FPFA 1NUAA 2R6ZA 4MKIA 3UHAA 2QTHA 4I1IA 2PBZA 5B4VA 4DXAA 1XTKA 4YMLA 3A1WA 4QX6A 4ABTA 3G49A 4DN6A 2ID8A 5DGCA 3KM0A 1U2ZA 3KPUA 2CXNA 1KZ4A 3BXEA 3BMCA 3RDPA 4ACBA 1H2FA 3Q7IA 4FN5A 3C4QA 3B1VA 3QUQA 3B51X 1SOVA 4F7DA 4HSGA 3RS3A 4R54A 2WJVA 3B1XA 4KB5A 3URKA 5JXHA 1EDDA 2OGTA 821PA 4CKWA 4KW7A 5JVDB 2V7VA 1CX9B 2EWVA 3V4ZA 4EA9A 4R2HA 3CCBA 4C6HA 5KMGA 2EFEB 3IBSA 2YZGA 3M82A 4TSKA 1RMYA 3BDVA 5E8RA 1UT8A 1PK9A 1QO0D 3BJEA 3DL4A 3GEPA 3A9VA 4RZ3A 4X6LA 4N47A 4K28A 5EERA 5I7HA 2AL7A 1XTSA 1I8TA 3IUNA 2FG7C 4QUEA 5F4BA 1ZGCA 1D1SA 2FG6C 4JJ7A 4RVOA 5KYXA 2NP7A 4U00A 2DPXA 1KI8A 2JGLA 5HS4A 2HQOA 4KRXA 4S1VA 5I9NA 2H48A 2O2XA 4DEXA 2LGJA 1U65A 3R9XB 3OE4A 1E60A 4K8RB 1CRLA 1JLLB 1XYGA 4DYDA 1XE3A 5DM0A 1JVNA 3MWLA 3K2QA 4FFBA 5KJEA 1CZKA 5EWMA 3VPHA 1M6VA 3BMQA 3EVCA 4D5GA 4ZJPA 2V7XA 4MCIA 4XWGA 4FFDA 4WFIA 4I4TF 5CT8A 2FW6A 3IT2A 1H2HA 4ARUA 1ZITA 3TW8A 4MDFA 5A5VA 4HKTA 4A10A 1UQTA 1P45A 1SEVA 1XK6A 1MKYA 2BMWA 3LO8A 1I36A 2HC9A 2F7SA 4Y30A 1F0YA 1QS0A 1VLZA 2H5EA 2YFQA 3RU9A 1L5ZA 3V7UA 3IP9A 3PRKE 4E2XA 2ODNA 4LYAA 3N2LA 3IYLW 3OI7A 1Y5MA 4TKVB 1W4ZA 3T9BA 2B30A 1KEKA 4S1PA 1YQTA 3GXBA 1KR5A 1NG1A 3G2NA 4NSNA 4OCZA 5FR1A 1OLXB 4AWAA 3WWYA 4EHFA 2EIXA 2XNCA 5K03A 4IH9A 2Q27A 3JD0A 4IIDA 1A4IA 2X8BA 3QQ5A 1Q7BA 4FILA 3I4CA 5HWSA 2UZIR 4Y1RB 4QA9A 1T2VA 5KJFA 1JLHA 3DNFA 4CIXA 2ENUA 1IN1A 3KOXA 5TARA 1CFZA 2E4WA 1RQPA 2PEYA 3A4NA 4OQLA 3X1XA 4MUIA 4C4PA 5KINB 4X1KB 1YZKA 3WLPA 3PPVA 3EUFA 1OUMA 2ZRIA 3RR2A 1TAHA 3LSYA 1OWLA 1TMGE 1V4VA 4F6CA 2H8GA 3AGPA 1XA3A 5CMLA 5KU1A 4WVLA 3TB4A 5CA0B 2I54A 1OC4A 3T9FA 3ZE2B 4YMSA 1MEOA 4UQLA 4C6TB 2W2LD 3KYJB 3UH0A 3ZD6A 1N34B 5A05A 1AH2A 2I1VB 4RZUA 4LXYA 2PGJA 1SBYA 3OJ0A 1C7RA 2AHOA 3O8OB 4IDQA 3R5KA 4N0DA 1G8KA 3W8NA 5AUNB 5IZ4A 2ZIZA 2QGNA 2IF0A 1MABA 1PE0A 3M70A 4GDMA 5D01A 5HIKA 3JY6A 4PV7A 1C30B 2G7MC 3ISTA 5MDHA 3R77A 1DOHA 3FTCA 2QMEA 3KSRA 4MV4A 1R37A 5KSYA 3AWIA 3TECE 3A7EA 1UJ4A 4M89A 5E2AA 5EKTA 4EM6A 5BRJA 4F2WA 4MMYB 3WX0A 1C1XA 1Z7EA 3HY6A 2ZLBA 1N1MA 1NLFA 2NSYA 2ZWOA 4ZKEA 1Q7TA 3VR5D 3GLIA 5K2OA 2GZ3A 3E03A 3WRXA 2PK3A 4C04A 5LMZA 4MW6A 1DEKA 1KOJA 1DCKA 3LU1A 5A4MS 2AC7A 2QE7D 3FROA 2DPMA 3EH1A 1ZNWA 1PTJC 3HZRA 2DY1A 4OGWA 1RQGA 2XTAA 2M6KA 4EO4A 1YNSA 1G63A 2ZSUA 1ZJJA 2VPYA 3G0BA 4TTJA 4Y2GA 4BKQA 1N92A 4XLTA 5AI9A 2QP9X 2QYHA 3N74A 4GMKA 2DCMA 1OGJA 2QLJA 3NFYA 3QPUA 2XLBA 3ZIAD 1ZSVA 1PNRA 3CZ9A 4MUFA 2BDEA 2ZYDA 3JYHA 1EMDA 2YIDA 3GHHA 4JWKA 1EWVA 1Q0UA 2PV0A 4NJEA 1AHHA 4MKGA 4DMFA 1U8CB 5ENDA 1YTUA 1WB5A 3W05A 1SXJA 2QZZA 4DCJA 1JLMA 1U94A 3WNCA 3MJTA 4R7GA 3D1JA 1VCIA 3PV0A 1EGMB 2X0JA 4OGLA 3UWKA 1GLGA 4E15A 1FFAA 2C2GA 4BFWA 1MAWA 5FTKA 3H11A 1UXGA 3L6CA 1EWTA 3I0ZA 3ZEIA 5IRCD 2IOYA 3L1UA 4BFCA 1W4CA 1YZTA 1HFKA 3I01M 4EY5A 3V55A 4CLHA 3EA5A 3U39A 3QEOA 1TL7C 1NX6A 4ZO8A 3DZGA 4KOEC 2LCFA 1PL0A 1LV7A 3OHSX 5IJ0A 5C3UA 4GI1A 3R0IA 2G9VA 4KP7A 3DEAA 1YK1A 2JHAA 4J6EA 2PR2A 5B64A 1EPUA 2BKUA 4RQTA 1HORA 4NKRA 2BM9A 1QFXA 4RM3A 3KHSA 4YLGA 1N3YA 3U0VA 4D2IA 1RBMA 4MR8A 3WB0A 3A6ZA 2UXDB 5IK2A 5ER6A 2DR2A 3VJLA 3DOEA 1T9GR 4MH0R 1TTQB 5ARBA 5LZ2A 1MXHA 2BR3A 1YVEI 3PEFA 4IJWA 4P36A 3ZGOA 4N6OA 3W9SA 3BIJA 3GPCA 5B3JA 3DKPA 4XZ3A 5ICCA 1L3CA 2H11A 3A4VA 4KDRA 6Q21A 5IKXA 3M5CA 2YNMC 5EXSA 1YOVB 2IHBA 4RWEA 2XKKA 2DULA 2XWSA 3C45A 5H3LA 4RHCA 1H2XA 2YKGA 3MT9A 1I1OA 3M9WA 3GQBB 1JB1A 2V59A 4JI7B 2QN2A 3DLAA 2PD6A 1NTOA 4BRWA 5DHPA 4G86A 1H3NA 2BCEA 4S12A 1DIHA 1CERA 2C4HA 2J6HA 2CT8A 1GYPA 3PDCA 3ZWBA 1NATA 1XGKA 2LRHA 1YQ9A 4QNNA 1KR2A 4TZTA 1L5MA 3DGEC 1ZEMA 1TTHA 1R2QA 1V4BA 2FW8A 2R8ZA 2Y27A 3BD9A 3BJIC 4FDTA 4Z7QB 4Z4IA 2K6GA 3BJMA 1NMXA 2VP5A 5FFMA 4EEXA 3HKEA 3FBWA 5FA5A 2QVLA 2EXXA 2W2NA 5TB5A 2NVWA 1MCZA 1EFDN 1JHVA 3K1JA 3PL1A 4UHEA 4ZODA 5DGXA 4FYXA 1WHSB 3BH0A 3IJEB 3ROKA 2QMHA 1H3EA 1V2HE 1BS1A 3E7DA 1WZ2A 2ZQYA 4REQB 1DNPA 1SPBS 1GZHB 4ZANA 1ARZA 3RO7A 6ABPA 3PB3A 5CFLA 5C9ZA 2WSYB 4KLNA 1JLKA 1PR6A 3BXOA 4BGDA 2XGMA 3AUKA 4ZOAA 1E20A 5JAPA 5C31A 2JZOA 1J0EA 2R6AA 4JJIA 4QYIB 5EXEA 1G8FA 1YBMA 1LSOA 1LTQA 3DXZA 3ZW8A 1XU9A 4FKZA 3T7JA 8LDHA 2WU1A 3V97A 2HZBA 1M6EX 3ABZA 4AN0A 4ZZ3A 3H7IA 5AVZA 1C9NA 2JDID 3VR3D 3OZDA 1JHZA 3VVBA 2HXSA 3OKAA 4ASUD 2LD4A 3B82A 2UYYA 1CR2A 1MW9X 2QAIA 2HA0A 4WZBB 5EFOA 3ROZA 3O2JA 3GFVA 1R6BX 2V6MA 3FVQA 3UW3A 4R9VA 2JIDA 3KFVA 4MUJA 1TD9A 4PZPA 4MUMA 3STYA 2QD4A 3D6HA 1T0PA 2X42A 1PDVA 2CVQA 4JLOA 4WFJA 2C9CA 1TW3A 3QHQA 3FCUB 2OVFA 3N6RA 4HAUA 3G79A 4HRAA 3VZSA 1GRQA 1GNQA 3OPVA 2Z8ZA 4B4KA 5LZ4A 4J0HA 1SB8A 1RC8A 2RIRA 2D0DA 1EA7A 5LQUA 1GPYA 3SEZA 1EVZA 4BATA 1JSXA 4AJIA 4DCMA 2PFGA 3GLVA 3IRUA 3CLRC 3K9LA 3FTNA 3PIRA 1P1BA 2IU6A 2POQX 2QR2A 3FUXA 4N0MA 2OFFA 1VECA 2WG0A 1MIOB 2G07A 3DE6X 3LL4A 1ECFA 4JUDX 5KYKA 4KPYA 4BFLA 2EFJA 3EA4A 4M83A 5DLPA 5LP6B 2PX5A 5ED0A 2I5PO 5TS3A 1UEIA 2QU8A 2FW7A 4LE0A 3L1VA 4R0NA 3OTGA 2HQBA 5BSGA 5ESWA 1S2LA 3OT1A 4H0CA 4HX2A 3SJUA 3WP1B 5KVVA 2QRKA 3SFZA 1KJWA 1QIDA 4MCJA 4IUBS 1SHLA 3NDPA 3T8YA 1PHPA 2HJGA 2GK7A 2Q07A 3FB4A 1ZIXA 2OKGA 4XE5A 1SBNE 1SUIA 3C70A 3IJRA 4I9GA 3RFTA 2I91A 2H2HA 3QJGA 1YRHA 3FAKA 5JNRA 3GPDG 4X93A 3FDZA 1A7AA 4HVAA 2R48A 1WDKA 4M7PA 1NW7A 5GONA 5JJLA 2BELA 2W2XA 1TZBA 1ID1A 5FTJA 1T3SA 1EFVA 4ENQA 4J4HA 1U8XX 2RE8A 2P2SA 3CLSC 2NZYA 3EDRA 3LUKA 4LC9A 2WIAA 2H4FA 4N3BA 4TRNA 5HJ7A 1XMXA 3ORYA 2Q2OA 1M9NA 1IRXA 2R8RA 3VTFA 3ZBTA 3VO2A 4YK7A 5CCXA 1E2KA 4MIYA 1Q1QA 5LDGA 3SX4A 5BV7A 4W99A 3E9ZA 3ANXA 3CB4A 4G0OA 1D04A 1LFAA 3PKZA 1I5EA 1UPAA 2DEUA 2H0QA 3DG9A 4P84A 5FFFA 1UT5A 1D4OA 4AJKA 5A6SA 5CEJA 4IVQA 2QGFA 2AG6A 3PVZA 3KWMA 4NU5A 2COUA 4U2FA 4XB1A 1ZUNB 2IXTA 1NTRA 3IQFA 3A1FA 3EGXB 1S3IA 1UR5A 5JO9A 4R2WA 2FA9A 2C3OA 4PIMA 3DFMA 4G6ZA 3UGQA 1GARA 5JH7A 1ZK1A 3AM4A 4GPBA 3ABSB 2ZBGA 4LPKA 5C18A 1FP7A 1Y5LA 2Q5FA 2RAVA 4W8HA 4UXJA 4BUZA 4AO7A 3IIIA 1VJRA 1NL3A 1R0RE 2HA4A 2OD7A 4GKJB 4L02A 1Z3CA 3BH6A 3L05A 5A3RA 3AY7A 1SOMA 3I1JA 1JEYA 1HKUA 2PGNA 4G0VA 5FD8A 3GJSA 3GRKA 1Z5WA 4K9NA 1H5NA 1R0CA 2JGDB 5J2TB 2XKAA 3T54A 4NCIA 5FNVA 4A6DA 3F47A 3EGDA 3WMWA 4D6PA 1ULUA 3OAAA 1BFDA 2CYBA 2BW0A 4EHHA 3NEJA 3TW0A 2GYWA 4RZIA 2Q5LA 3JW8A 3MIIA 4L4UA 4M9QA 4IVPA 3GJYA 3E5NA 4DUZB 3DDNA 3JVVA 2PS0A 3HNPA 1VJCA 1TFRA 3E9MA 1QIHA 2HMYB 3HDJA 3WHKA 1XL0A 3WGHA 5AVQA 4ABYA 1R0KA 1IZ0A 1F38A 3FPHA 4PHTA 4NARA 4OM8A 5DIFA 3SQDA 3WGNA 4D5EA 2YDYA 4NZYA 3NH6A 5E2BA 2G40A 1S8NA 3IESA 2RHOA 5GAJA 1G3QA 4TV9A 4EEZA 4ZK6A 1SOUA 2DWUA 3ZWWA 5KYWB 3R23A 5BVHB 1E2FA 4NBSA 4DL9A 2W6PA 2P2GA 4CU2A 2DJIA 1HFJA 2J9FA 5EZYB 1ZOOA 2XGGA 2JEYA 1S2MA 5F5XA 5HK8A 2V5VA 2AUNA 4ONEA 3NHLA 3VU9B 2JANA 1Z45A 2JA2A 3P1JA 1LQ2A 2QX9A 3R6DA 3IOBA 5EMHA 4ZVSA 3LBFA 3OIGA 3SU8A 3QA3E 4Y7DA 1II9A 4LOIA 3U2QA 2J3LA 3CG4A 3VKWA 1DOAA 1VGQA 2QJWA 1GRNA 3C7KA 4JT2A 2P2DA 2B82A 1XTQA 4N0EA 4YCDA 3TUJC 2ZUFA 1PUXA 1MW8X 2OWEA 1W5TA 3PDJA 4MS4A 1CP3A 2HDWA 4YACA 4AS3A 3COPA 5G3YA 2X1LA 4ZCSA 1WW8A 1GKUB 1NOKA 1P0PA 3EPLA 2VNSA 3TSYA 4I4LA 4IJMA 2BR4A 1UQRA 1D6NA 3WSVA 2DE0X 4I1RA 5E7IA 2ZUBA 1RM0A 1SXGA 1YZ3A 2H52A 1OHHA 1YAJA 2VSFA 4NNOA 2WWWA 4Y6GB 1YZQA 4K9QA 4JI3B 3TN7A 5BOSB 5BN1A 2ZSKA 4XEHA 4BDSA 2NO9A 4INPA 4KWEA 4ESHA 4Y9SA 3VH1A 1WHTA 1SJ9A 4RQAA 4DDWA 1E69A 2QSJA 5EIBC 5A06A 2XF2A 1Z2PX 3HMKA 5K3OA 3UIEA 3GJXC 1XDDA 2XXBA 4K2HA 1ABFA 3AI1A 5GPBA 4D80A 4Z99A 2WC1A 1MN6A 1WAMA 3GXOA 3VYWA 3RREA 2AN9A 1OIWA 1T4DA 5G1NA 4CV0A 4S1WA 1GPUA 3EGWA 2R5WA 3MWGA 5JRZA 3LBHA 2Q0SA 1ICIA 2Y1FA 5CT4A 1SVMA 4QWWA 4R8MA 3QZUA 2PL9A 3L1HA 1H65A 2RGGA 1WZIA 3MCUA 2GT1A 2HWXA 4M86A 5CLGA 4G65A 3RFFA 1W4BA 4BNTA 4RVNA 3BTSA 1G7TA 3TM4A 3AT1A 4ITUA 3I28A 5ELMA 3KKNA 4RTSA 3ZHQA 2ZSEA 1TCAA 3UJAA 4F4CA 3O4FA 4CF4A 1PL7A 2VPPA 3FR8A 5E0KB 2FDXA 2WJPA 1SBZA 3ACBA 4MI3A 1GG9A 1FDVA 1J5PA 2D4AA 3L4BA 1F60A 3B7PA 1DV1A 3W8EA 1K27A 1M2HA 1LW7A 2XXJA 4E2ZA 5J9FA 4ZYLA 5FLXA 1QZXA 1BTOA 1AHNA 1OV4A 3WLOA 2WJWA 4FNAA 4YYEA 1TX4B 1HBJA 4DQXA 3D54D 4R0MA 2P6OA 4B33A 1ZM4A 5KTMA 1VYHA 4ISCA 4J0FA 4BU0A 3W8DA 2AVDA 3KAQA 4IDOA 4JJ4A 3UJ3X 2I7TA 4A3SA 4BNIA 5IK2D 4EEKA 3LTNC 2BCGY 2W71A 3CLTC 2MT9A 3IALA 3Q40A 3QENA 2GXQA 1Q92A 4PG5A 1CQIB 1MLDA 3M6MD 4ZU6X 2IU0A 5JWOA 1LX7A 4U0KA 3B78A 1ZK0A 3CNOA 3EYAA 3I5AA 5FTLA 5E7MA 1RAFA 1EP2B 4QTUB 3AIKA 3DV0B 4JDUA 1U31A 1B8VA 4CFSA 4HGQA 1XCLA 3DMGA 2VBIA 3NT4A 1AQYA 2XCQA 3AJ8A 4DPKA 2IEAA 3V8PA 2FSGA 2OO3A 5C3MA 3V1YA 3ZDRA 3LLVA 4BLQA 1NU8A 4KYTA 4RJJA 3QEJA 2ZI7A 1XVVA 3PGKA 4ZV4A 4Q15A 1DCMA 1KIFA 5A3QA 2JHPA 1PJ3A 1ZSNA 3LGAA 1NNUA 2IWHA 2O3UA 4EJ6A 4EMTA 4DT1A 3B85A 4EP1A 1W59A 3FNIA 2HDHA 4GL4A 2VK2A 1TT7A 3GMIA 5IG2A 3OCJA 4EZEA 4H3HB 3GPIA 4AQDA 1IONA 1GWNA 1RRMA 2QV7A 3KZXA 3F6CA 4L73A 4L9RA 1U1FA 3MD9A 4IIXA 4TWIA 2HSJA 2Q3DA 4NE7A 4E2FA 1J5XA 1UJCA 1X9GA 1NVBA 4YUXA 4RDCA 2P8JA 4CEHA 2O06A 1ZY2A 2QB5A 3IV6A 4ZQFA 1JGTA 1QGOA 1CIVA 2WFLA 1VP3A 1ZS9A 2ZT5A 2ZYSA 1R0XA 4JR1A 3A6EA 2JLVA 4PXAA 1QE3A 4WPGA 4H18A 4XOUA 5ALDA 1T6YA 1DC3A 1LBTA 2WUFA 3HFGA 1EEHA 2GAAA 4FU0A 5IUNC 4TLEA 4JP8A 1DO0A 2IE8A 3LJKA 3O4RA 3GP3A 3P20A 5ESRA 3ZXXA 3JZIA 1O95A 5HFNA 3S0JA 4RO0A 1L5VA 1VIMA 3KPWA 3NAZA 5IJAA 3A70A 2ROQA 3KAKA 4PNPA 2PIAA 2PR7A 4M1YA 2QD2A 9LDBA 1KFBB 3K94A 4BVLA 2A30A 3RC8A 3DUWA 1MPXA 5CJ2A 1ZD2P 3E3MA 4YRLA 3ZLUA 1MZVA 1T5BA 3OF5A 2YYAA 3JQGB 3L8ZA 1MVOA 2EFDB 5JC8A 2P27A 2VYVA 3CF4A 2H1WA 3HRKA 3MF4A 2GJAA 4GHWA 2FPWA 3KP1A 1R6AA 3GGCA 2BF7A 2G3YA 3I0NA 4PYQA 1M2KA 4RAQA 4RFLA 5CT6A 2M9MA 3OJWA 3PRYA 5FI3A 4EA7A 4EUNA 5LQRA 1MX3A 1U0BB 3QVSA 1QHSA 2BFEB 2REBA 2VZLA 1V3UA 4OA5A 4OSEA 4ZVRA 1GG8A 1BNCA 5K0JA 1TCVA 2R3SA 1NBWB 4XYBA 5LXTA 4KXVA 1OYWA 2PUHA 1NJ6A 1AD2A 2J3HA 3C0KA 3PJDA 4M1QA 1SCUB 1TJ4A 1RT9A 3H75A 5LLSA 3MN1A 1PR3A 3KB2A 1M6YA 2R8OA 3QPWA 2G0TA 1ST2A 3TL2A 3AVTA 5LBIA 3JTMA 3QVJA 1LTKA 1NVVR 4FSXA 2G1PA 3E48A 2ETXA 1GFSA 3FYSA 2W2MA 2GF2A 3AIOA 1FYVA 1QRRA 5DBOA 4DDHA 5HW0A 4F04A 4EUSA 2PT6A 5SY6A 3AVPA 2B37A 4QLBA 3HXQA 3IXMA 3IPRA 5EE3A 4B74A 3N7AA 1Y3HA 1F17A 3W2IA 4NE2A 4RZQA 4GC5A 3LQFA 1KKUA 4NC9A 2R6GA 5ALWA 5IT4A 4ARCA 1WR8A 1A9QA 1GGJA 5KVSA 3MGKA 3T3HA 4HNAA 2OV6A 3AEZA 3UK0A 1A8PA 4D4KA 1A9XA 4PX3A 1P3DA 3OMWA 2D1QA 4XWAA 5C4IA 4Z4EA 1KJZA 1CUXA 4G37A 4FXPA 1BKDR 1F6WA 3Q5EA 3AHEA 2FQ1A 2JKZA 4HUJA 4JVSB 3P26A 4ZC1A 4HDCA 3HDQA 4MLZA 3LP5A 1FNBA 1W49A 1P4AA 4HDNB 4YT5A 1QFMA 2ZQ5A 3IPAA 3JTEA 3OJFA 4M36A 4KQJA 3L82B 3JYOA 1UBLS 1MJGA 2PZJA 2PZGA 1N2ZA 5BSKA 4UASA 4FK8A 2B4QA 2XI4A 1DDGA 4MARA 1ABBA 4HPWA 3VSBA 2AFIA 4A26A 2HIGA 3RYFA 1QOZA 1RWMA 2C42A 2VHJA 5K3AA 1GYQA 4X90A 2M6SA 1XA4A 3NRBA 3SC6A 3JVDA 4H7EA 3IE0A 3DWGA 2GO1A 2NYRA 3I5UA 3LT4A 4RXMA 3EEFA 4ENTA 1EGAA 1F12A 3AU8A 5C52B 3FI0A 2ICAA 5D8DA 3L8MA 4CW7A 2ZKLA 1YA6A 5DRYA 2BOVA 4X3OA 2Y2VA 3IUSA 4U0JA 5IYZF 3HNOA 4IIJA 1O94C 1NKTA 4WZAA 2AJTA 5JWHA 2XNJA 2I3ZA 2WP0A 1EAYA 1TZCA 3H9QA 3PDUA 3S1AB 1ODTC 1BCRB 2MIIA 4R2MA 5BMVB 2B83A 3KOZA 5JXWA 2ZUCA 5TQ2B 3CRQA 3D02A 4I1OA 2WPDD 4Q1DA 4B4WA 2C4WA 2JIPA 3KAPA 3LQ4A 3WXBA 3ZEAA 1YFJA 1BD4A 7ADHA 3HRIA 1NU6A 4JLMA 4PYLA 4RA9A 3ZJVA 1FB5A 1GTL1 3T5MA 1A72A 2DBYA 1CC1S 3T3EA 4P31A 4S2EA 3IOEA 3NEPX 4HH1A 3QWFA 4PHGA 3IO3A 1DKUA 1T5HX 3SQOA 5J4HA 2D5LA 1XD2A 4RWZA 4HDSA 2HADA 1MC5A 3WSTA 4PTLA 4PICA 3KALA 4NS1A 3WO1A 2WVJA 3A14A 3BWMA 2R00A 4KQXA 3SM3A 4DIDA 2QW8A 3VKGA 4DJDC 5KKCA 3TW4A 4EUFA 1YNOA 3HCAA 2XD9A 1B1CA 3K96A 1YI1A 2G0NA 2QMOA 1VL2A 2OOSA 3MINB 1D1TA 1R9MA 1YCFA 1QH0A 3BIFA 3K5WA 5AMXA 1SIUA 2OB1A 3C8ZA 1UOPA 4RF3A 4XKJA 5F1YA 4B5LA 4PQGA 1WZCA 1E4EA 1WXIA 1DFGA 1R74A 5FHRA 1H1LA 1G64A 5TQVA 3GA7A 4D02A 1ABEA 4CIYA 1U3GA 3SJCA 5KJ1A 5KQPA 1FZTA 4ARAA 2ZS7A 3FJYA 1MDBA 4LFCB 3HZHA 3L6EA 1J06A 1ZIDA 1TK3A 1VYVA 3LQ1A 4FR0A 4MGKR 1UPFA 2B7LA 4Y6LA 4EELA 4UBMA 2F59A 1LLFA 4WGFA 2D1FA 2EBUA 1Y34E 5JVDF 3AYZB 2NACA 1GUYA 2ADMA 3H1PA 2F9LA 5A4FS 4EQ6B 2BTEA 3BT7A 1TJPB 3VHLB 4Q24A 3DHEA 4NQZA 4WLNA 3DMTA 4MUAA 2WICA 5JZSA 1BE0A 4DV4B 2GKOA 3K1ZA 1NZFA 2QRQA 3MC1A 4CR7A 1EHIA 2J4DA 3TGWA 2LIPA 2AV6A 1N1DA 4HO1X 4Y2QA 3RC1A 4JROA 2XYGA 4YMUA 3LHSA 4MPRA 5FDFA 3Q3EA 4OQNA 2EHJA 1Q2XA 2E4XA 4KE6A 3B3AA 1N0UA 4LQLA 3TJZA 1TT5A 2BD0A 1EWRA 4BFZA 1XZJA 2O0MA 1OHHD 3LX4A 5AJUA 4R9RA 1GZ3A 2I2FA 4J76A 3CWQA 4BV2A 5AKIA 1U6JA 2QTGA 3M5WA 1XKLA 2R87A 4FUQA 3L6OO 4P3XA 3M6WA 4M49A 3TG8A 1YK0A 1N8SA 5B7QA 2V7GA 3Q5DA 4HEJA 4ND6A 3V8RA 1Q7EA 1DWOA 1PVOA 2YMLA 4BVJA 2XE7A 2PLAA 4C0SA 5BSTA 2PTHA 4XVCA 2QXUA 1SOAA 1ZCZA 4F3YA 1DX4A 4MWTA 3RI3A 1BG6A 4FD2A 4DG8A 3L4JA 1YB1A 3OHPA 4M7OA 5B1DA 2EJTA 1JXAA 4Q9KA 1VHQA 1C0LA 2DHDA 1H42A 4K9RA 2I4NA 4O4IA 2BGMA 5I8ZA 1CRPA 1UUFA 2I62A 1CZUA 2YN4A 3DC2A 2QXYA 2P2CA 2XBUA 2XZPA 3D2AA 2R68A 4G1MB 4YMVA 1F2VA 3IP1A 5F2KA 3W3ZB 1RHRA 2V3WA 4EGJA 1MBZA 1GTSA 3GARA 1IFXA 1XN4A 3IIKA 2B35A 5CGQB 4ZYTA 3TGLA 5HRUA 3HBJA 2OK7A 1NP6A 2IOFA 1TYDE 2NYUA 3TXYA 2GZRA 4BQQA 4BZZA 2XDQA 1HLPA 2AOXA 3ENWA<