1PUJA

Structure of b. subtilis ylqf gtpase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
261
Chain Sequence
b'HMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKNKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSGGLINYDKTTEVIIRDIRTEKFGRLSFEQPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein ylqF
publication title Structure of the YlqF GTPase from B. subtilis
rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
total genus 94
structure length 261
sequence length 273
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1580.10 Mainly Alpha Orthogonal Bundle Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 1pujA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1pujA01
2EFDB 5FL3A 2W2XA 5L8VA 4MRPA 4LI0A 2VSXA 1RZ3A 3NXSA 3QUSA 1Q21A 4A2WA 3SDZA 3B78A 2G77B 4A15A 2ZE7A 1OH5A 4MRNA 4MYUA 4D4MA 4QGHA 4CT4B 2O8DA 1H8HA 3QBTA 5EE0A 4LUCA 4RZ2A 2QRZA 3OFND 5G41A 3AP3A 2QPTA 5FPHA 2IYZA 1NI3A 3VNUA 1KI6B 2BEJA 2D7CA 2GXSA 3A8TA 3UPUA 5EUQB 3NWJA 2O8DB 3EASA 4DSTA 2Z4SA 2BBWA 1ZINA 1J8MF 4KFTA 1U0HC 2QP3A 4V0NA 3Q5DA 4M22A 2RB4A 4E03A 1BOFA 1T0HB 2QQ0A 3BFKA 4A2PA 2WZQA 4HAYA 4BFWA 1E9AA 1KNXA 2UKDA 3CWZA 2ZR9A 4HDOB 2UVQA 5J40A 3SI7A 4ACAA 4AY2A 2CL7X 4HAWA 4MGIR 1JR3A 1KO7A 1W48A 1DAIA 3IIJA 4BZQA 3F0TA 2BWJA 2C98A 2FE4A 3DKVA 2GK7A 1AQYA 2B8TA 2XTMA 2RGCA 2VF8A 4JIMA 3RABA 4QJ3A 3LXXA 3ICEA 2QROA 1OFHA 1OXTA 1W0KD 4PAOA 1G7CA 2ZYWX 3PITA 4H1UA 1WF3A 1NN5A 2IBMA 1K5GA 2KB0A 1KDOA 1KK1A 4V02A 5L3RA 1XZQA 2QG6A 5CK5A 2GBLC 1NLYA 3NEJA 5AJVB 5EP1A 3Q3JB 5JI3E 1KI7A 3C4JA 3D8BA 1UBFA 1XFAA 1SXJC 4Q4JA 1S9HA 4QJ4A 3ZZUA 3SHWA 2FEMA 1A5TA 1U2RA 5G3YA 5SZIA 5AK0A 2W58A 1VDZA 3TUZC 1A7JA 3TIFA 3C16C 3TBKA 4BLPA 2OESA 4M1TA 4Q4JB 2OEPA 2OCBA 3ZYCA 2HT1A 5EP2A 5E7IA 2RHDA 5KHOC 1XEWY 3BWDD 1KSFX 4EFMA 2ZAOA 4WIAA 3AM1A 2O5VA 4MKGA 1DG3A 4QRHA 1JEEA 4WZ6A 3O8BA 2C95A 3L43A 4AYWA 4KFSA 4PAMA 2GVDC 4JJZA 1ZVQA 3EAQA 1FTNA 2C78A 1KIMA 3MWKA 2NPFA 1CU1A 4P3YA 3WXMA 2OBNA 4AKGA 1HE8B 3DKPA 3TVTA 1NMYA 1YR9A 3SYNA 2NQ2C 4B47A 1ZU5A 4OI2A 3W3AA 4L16A 2JDIA 3LY5A 4M9XA 1CJMA 3UG6A 5B30A 3J81k 3CNOA 2QQEA 2W6IA 4PZLA 4XWKA 5JWOA 1LFDB 2WSSA 1NY6A 2N46A 2ZYUX 2QSZA 1XU4A 1P9NA 2C9OA 2ZE8A 2ZXUA 3N2EA 2OXRA 3THWB 3V9PA 4BZXA 2O0HA 2ATVA 4LX0A 1ZM9A 3QPVA 4B71A 1R4AA 3RS2A 1E4VA 1VG0B 4A82A 1XTKA 1RJ9A 4O2LA 4D0LB 3WNCA 5KOYA 4M9ZA 3NBYC 1FUKA 3NBFA 1QHGA 4NCJA 3VR3A 1ETUA 1OIXA 2V8OA 3B1YA 3U3RA 3BGWA 4HB0A 3RNLA 2KBFA 4LYHA 4JL8A 3OEED 4NU0A 3ZVLA 3TKLA 4G5SA 1YKSA 4A6PA 4OKSA 1FW6A 3WNDA 2R6FA 1LW7A 2FMXA 3QXSA 1KY3A 2ZR7A 1US8A 4ZV4A 3IQXA 2DWOA 1KI8A 1P5ZB 4QBFA 4CYMA 3QXJA 3ASZA 2EYUA 5JCPA 2D4HA 4Q66C 2CDNA 2LWIA 4IOMA 3PUXA 1YU9A 2G9NA 2ZEJA 1US8B 4PPQA 1V5WA 4I99A 2Y8EA 2R2AA 1QHIA 4DSUA 2IF0A 1VPLA 4W5JA 2VHTA 4DLVA 2QAGA 4JKYA 3LX5A 3H0KA 1OJLA 4QBGB 4TLEA 4FWTA 4Q7MB 1D5CA 3KKMA 4UNSA 4BLSA 4QXAA 1HQYE 1KMQA 3BH0A 3L0SA 4DJTA 2H57A 4ZDKA 1XNJA 3EZ7A 4HUQB 3U7EB 2IWRA 4C0JA 5IHPA 4LRWA 3I72A 3I5YA 4NCNA 4AG6A 1N5KA 4P4SA 1D9XA 1E79A 2A5YB 3HPRA 4Q4HA 1U81A 4KBFA 4ZKEA 1KK0A 2XNDA 2ODBA 4GZLA 5DN6A 4L15A 2C2HA 2PT5A 2WPDD 4MH0R 1OXUA 4TYYA 2JAQA 2HEIA 3WYAA 2VBCA 2AD5A 4P4SB 4TMZA 3EC1A 2ZSBA 1II8B 3UWKA 5FBQB 2JLWA 1Z2CA 2ZU6A 2XSZA 2WKPA 2IT1A 1TF2A 2X1VA 3FVQA 1CJVC 1E1QD 2PZFA 1XJCA 3LH5A 4GNKA 3HWSA 3JVUA 4TYPA 4FMCB 4YC7A 1W2GA 3D6TB 3CR7A 4LJYA 1R0YA 2ZS9A 4LBZA 1HTWA 4CEJB 5EE5B 1R6BX 4IXNA 1OPXA 3QVVA 5JI2E 3KB2A 3C7KA 2JJ1A 4HI0E 3ZQJA 5HZHA 4POAA 3TAUA 2ZRNA 4DIDA 1M74A 4DCTA 5KSZA 1VYTA 4A6XA 4Q19A 1A4RA 2AKAB 3MWJA 3REFA 1FPMA 1GRNA 3OAAA 4M4SA 4OQNA 1AJEA 4KVGA 3ZS9A 4DRZA 1U90A 5E7JA 2ORWA 3HR7A 1SHKA 4PAQA 2VHQA 2XB2A 3QG5A 2IEZA 5FTLA 3GP8A 3U60B 2GZAA 2R44A 1ZD8A 3VTKA 1XPUA 3CO5A 4GL2A 4B75A 5G3ZA 2ZUCA 1N6OA 2JEOA 4IVRA 1MR3F 3FMPB 3IEUA 4KFRA 1JPJA 5TARA 1GDDA 1MO5A 1D8TA 5H1YA 2EFEB 2ZRFA 1WBBA 1NSFA 2PBRA 3DPUA 1R2QA 1QF9A 4RZUA 4O25A 3QE0A 1IJEA 4P0TA 1MT0A 5A0FA 1ZAKA 1P6XA 3Q8XB 3SNHA 3ZJYA 2IXEA 3I4LA 2ZSFA 4B2LA 4DC9A 4AKIA 2GJSA 1K5DA 3HDTA 1W44A 4KFUA 3B1XA 2GEUA 1EX7A 1D6JA 1Z06A 1II9A 3QKTA 1U8AA 2R6GA 2VIIA 3VKGA 3A4NA 2VHJA 1VCNA 4KHZA 4CT5A 1AS2A 1ZUHA 1FP7A 2QBYA 5D3QA 2FGKA 3I73A 2YWGA 5TVKA 3CZPA 1U9IC 3GJ8A 1DOAA 3P20A 2QMOA 4PC3A 5CYOA 1VG8A 2FFAA 3FHCB 2OO7A 4Q02A 3X1YA 2K5UA 4BWYA 1AKEA 2VTKA 1W47A 3RS7A 2CLCX 4JLBA 4CRWB 1LS6A 4I1SA 3DVLA 4UXHA 1OYYA 3GLGA 3ZVMA 5HE9A 1HA3A 3U3KA 2YWEA 1VHLA 3K9NA 3Q72A 1VCMA 2FJUA 3I8XA 3UANA 2QT0A 3U3MA 3L8YA 2EW1A 4M0LA 4WW0A 4UXJA 2DWPA 2OLKA 2O8CA 4PXAA 5AUQA 3EXAA 3WRYC 3B1WA 3E5HA 4NTZA 2GTPA 3PQCA 3V4FA 3WMFA 2QP4A 2J0SA 4XSHA 5CLQA 1T3HA 3A37A 1H8HD 3AGPA 2IYYA 1NIJA 2O8CB 1GG2A 3KX2A 1MOZA 2WOOA 2NOAA 3M0EA 4DLSA 2ZRAA 1R8QA 2WJIA 4GMXA 3RANA 1XTRA 2AFHE 2ZRGA 3OEHD 5DE3A 4DZZA 2Q9BA 4ILEA 5JS7A 4OL0A 3LRPA 1AZSC 1U98A 3SBDA 1DO2A 3MJRA 4EPXA 2IW3A 2W0MA 1YR7A 3GLFE 1XEXA 2RKOA 2OE2A 3BD9A 2OCYC 1SKYB 1TUEA 1XD2A 2XZPA 2WWXA 4NL4H 4BGDA 1R7RA 3Q7PA 5TY0A 2GXQA 4BQSA 1OKKA 1JR3D 2XEXA 5JHHB 5CYPA 4DVGA 1NBME 2DWQA 3BRWD 1S0UA 1XD2B 4XTCS 5EP3A 2FH5B 5A4JA 2WJYA 2CHQA 2F9MA 2FFBA 4DB4A 3EC2A 5FI0B 5KNCA 3A1VA 5IK2D 5AR1A 3B82A 4AI6A 3GJ0A 3I3SR 4WAUA 4AKHA 1F2UA 1FMJA 3IBYA 4NE2A 2Q6TA 3R7WA 4EQ6A 1CIPA 4OHXA 3EPJA 3GLHE 1M8PA 1HH4A 2DFLA 4F92B 2WM9B 3C14C 4GSYA 2WWFA 2VF7A 2DHRA 3FTQA 5DHAA 5JWRA 1Y63A 2RGGA 4PO8A 4EQ6B 2FF7A 3U7GA 1R5NA 5ANRB 3NDBB 4JKIA 4B48A 1KHTA 1TX4B 3F3YA 1LVGA 5BYJA 1OXSC 2WKRA 2ZE6A 5L3QA 1FOEB 2BBSA 2VSOA 3LWNA 5FOUA 2F3TA 1DBSA 2X2EA 1XJQA 4M1MA 3U3JA 4DBLC 1Y3AA 4LV5B 5BN4A 4UXIA 4EPYA 1KSGA 4YXWD 2EU8A 4IHQA 4XJXA 4LYJA 5JMTA 4PO1A 5JZVA 5KPDA 1QRAA 1U9IA 5LPNA 2J45A 1VYVA 2V6IA 3CNLA 2EFGA 1OFIA 1Z6AA 3WHLA 2GAOA 1ZP6A 3H2YA 3AVVA 1CTQA 2JCSA 2HYIC 1GNQA 4DXAA 1E0SA 3ZS8A 1Z6TA 5DLQC 3HR8A 1EFUA 2J0VA 1F3OA 3R9IA 2V1UA 2W0SA 4A36A 1VG1A 3QPWA 2GEDA 5FUVA 2RGXA 3ND8A 1DAFA 4HLUA 1WBDA 2AK2A 2ODWA 821PA 4A4DA 3JZMA 1GOTA 4F38A 2AXPA 1AKYA 2BM0A 3CRRA 4JYCA 5F9FA 1EFRA 2H8KA 2IYWA 3ECCA 3IDQA 4LHZA 2QMHA 2BKEA 1HT1E 3P26A 4Q7KA 4DHEA 5GVSA 2J7KA 3NDPA 1IBRA 3NH6A 4C2TA 4CEIA 1P2VA 3OEEA 3QKRA 4B3GA 1WA5A 2QRNA 5FTKA 4JBYA 3TR5A 3P27A 4DLZA 1ESNA 2QY9A 4MGYR 4AWXA 4CEIB 1T4GA 1VMAA 2GHIA 4YDHB 1G4UR 3FHOA 1OSNA 4URYR 4DLXA 1W7AA 4AD8A 4NZYA 2GA8A 3ADKA 3LAWA 1QZXA 3HU1A 1GAJA 3PV0A 1XMSA 4OI1A 1EWRA 1G5PA 4HB4A 4E07A 5HKKA 1NJFA 1Q3TA 1YZLA 1P60A 4MGZR 1T5LA 2JJ2A 2ZI9A 3IQWA 4K81B 3I62A 4U5XA 4MKIA 1NVXQ 1ZMXA 4QM7A 1XF9A 1S96A 3AVQA 4BPBA 4D0GA 3PEWA 4C0SA 1Z0AA 5G40A 1SHZA 4FW9A 2V1XA 1BMFA 4O3MA 1N0WA 2WBLC 3ZVRA 4HDCA 3EARA 4Y0VA 4BRUA 2BJWA 3QEJA 3AVYA 1UEJA 1EG7A 5KDOA 3KXKA 1WE2A 1KK2A 1OW3B 2ZJBA 5J5CA 5SZKB 2EVWX 3MWLA 4BFUA 4G01B 2V6JA 4ABYA 3PCRB 4URVR 4LBYA 4PHFA 3EZFA 1RRFA 2WPDA 4DLUA 1UKZA 1F48A 1TF7A 4IOLA 4IOKA 1T91A 2QU8A 4IDPA 4JZKA 2IXGA 3L0PA 3OIYA 2GVZC 4KLNA 1OXVA 1R8SA 2ZJ8A 2Z0MA 1E1QA 2XNDD 3B13B 4JLVA 4KAXA 3WBJA 4D6PA 3V00A 5FBLB 4Q4LA 5JSZA 2ZIAA 3RC8A 1J90A 2GXAA 1MO6A 2AHOA 1EESA 3LVQE 3DL0A 4FINA 5LDDC 4DCSA 3K09A 3RRMA 3X1XA 2CNWD 5KDLA 3ADDA 2HLDD 3EA0A 3GMTA 1UDWA 2HYDA 1NVWQ 4P32A 2OCPA 3AP1A 4KBGA 1G6OA 3CPHA 3KKOA 4ON9A 4Z51A 1G3IA 2A5DA 1E2EA 2GEVA 1CEEA 5JECA 1FTSA 1YR6A 4NYJR 5EZ6B 3WNBA 2ZUDA 3SE0A 3GLIE 2JJ1D 1HYQA 1QVAA 1KAGA 1QG4A 1TQ2A 1M7HA 4NCIA 2RHMA 3PG5A 5DI9A 5BQ5A 2X19A 2EWVA 4QBIA 1SVSA 2R8RA 3AQ4A 4UNPA 4ITRC 1T3LA 5EXPA 3FHTA 5EXSA 1CP2A 2BMJA 4LY6A 3SBEA 3THOA 2JIZA 1FNNA 4R2IA 2PLRA 3AF3A 4B3FX 5BN5A 4GZMA 5C4GB 1TQ4A 2OFWA 3BB4A 1Z22A 1FZQA 1G5TA 1NMXA 3C5CA 4OI4A 1N25A 4GP6A 3U2QA 3PEUA 1Z07A 3H4MA 2D2EA 4Q7LA 1SQ5A 4TT3D 4ZI3A 1TEVA 4NH0A 1CF4A 2J0QA 1GUAA 5CITA 1NVVR 1AGRA 2VHCA 3OZXA 5D3MA 5JHGB 1E9SA 2IHYA 2RGBA 4M9QA 3TMKA 2ATXA 2IC5A 4ZCLA 1XP8A 2IL1A 2YC2C 3QJYA 4PPFA 2H1LA 1JQJC 3KXIA 3B1VA 5D3MB 1GKYA 4QFMA 3TH5A 5FH9A 3T5DA 1CXZA 3K9HA 2V55B 5SZJA 4KO8A 1ZD9A 1SXJE 3P1JA 1MV5A 1KO8A 4PC7A 4GDFA 4H1VA 4D4JA 4LBWA 2P2LA 4KODA 5CDFA 2VEDA 2DYKA 2ZREA 1DELA 5FPKA 5AUPB 2R9VA 3OIVA 3QIAA 3NHAA 1Z6GA 2GWHA 2EQBA 2Q21A 2CBZA 3TVDA 1EFCA 3BIFA 3MLEA 5C1BA 2YVUA 2JLYA 1E69A 3UMSA 2C9CA 2P0EA 3DOEA 3VX3A 3PEVA 1NLFA 1ZJ6A 4BFXA 2A5FA 3U4QB 4QM6A 2Q3FA 2FX3A 4FD2A 1J99A 2ORIA 2R6AA 1YZQA 1TPZA 1UKEA 1IXSB 1RC8A 3T15A 4RZ3A 1WB9A 4W5WA 1IJFA 2F55A 3B9QA 2WAXA 3WRXC 2GCOA 1KI6A 1COWD 1FQKA 1Z28A 2AWOA 2C04A 1E4YA 4OQLA 4FMCF 1G4AE 3PEYA 2ZRBA 1AGPA 3T1QA 3ZIAA 3U61B 2J41A 4ERNA 2GCOB 4LC1A 3TLXA 4URXR 1N6RA 3CKLA 4HEJA 4RKEA 1RPZA 1DVRA 3AB3A 1Q1BA 1AS0A 1Z3IX 3OEHA 2IXFA 4NONA 1X86B 1YQTA 1G3MA 3K9LA 2HXYA 3AEZA 2AKYA 5FR1A 1HUQA 3MD0A 4AIIA 2A9KA 4UNRA 2ZJ2A 1G3UA 2FG5A 3Q5EA 4JLKA 2O8BA 1JI0A 2JGNA 4UQOA 1NVUQ 5FTNA 5BW8A 3TSOA 2O8BB 1NG1A 1OKKD 1IQPA 3FMOB 1AM4D 5IK2A 1BO6A 721PA 5DIFA 3IEVA 3F5FA 1I2DA 2RGAA 5DISB 2XJ4A 3SJZA 2O8EA 2BIFA 2FFHA 3BS4A 4GPTA 3OIWA 3ETLA 4IVQA 3SQXA 1E3MA 3DO6A 2QAGC 4JLAA 1G3QA 3UMFA 5C4MA 1DO0A 4EFLA 2AN9A 2CJWA 3RRYA 121PA 3LDAA 1MRNA 1E1RD 4OHWA 2ANBA 1M6NA 2O8EB 2RGDA 2YOHA 2QSYA 2R6DA 2HDNB 2RH5A 4A8JA 2YWFA 3V4RA 2CJWB 2DR3A 2NO7A 4N1AA 3T06B 2JLVA 4TMVA 4B43A 1XD9A 1OT3A 1ZM7A 2REOA 2ZYVX 3VR1A 2G1JA 4OQFA 5J4VA 3FFBA 2GJKA 2AD1A 4A8JB 1GKIA 3QKUA 5CJ2A 2FSHA 4IOJA 4YXWA 2O52A 2QTHA 1IN7A 2KI5A 3F8TA 2NO1A 2X2FA 2HT6A 4FI3C 4WZAE 2CVHA 5F9HA 3QEOA 4D80A 2IYSA 3RRNA 2N42A 1TL7C 3W9YA 3GLGE 1IY1A 5CM8B 5FFMA 4WXRA 4L4UA 5TDHA 1RIFA 1E6CA 1TU3A 5E95A 4P33A 1KZGB 1YR8A 2G83A 2XX3A 4B2IA 5FOXA 1FP6A 3VKWA 4HAZA 4TSFA 3ZD7A 5JJIA 1R0ZA 3ADBA 2ASEA 2ZRHA 3CLVA 1JXMA 4KV9A 3THWA 1LV7A 4BZPA 1KK3A 4XWAA 3T61A 3EIQA 2CCJA 1GZSA 1R0XA 1CULC 2E1RA 4RFSA 1Q20A 2N1BA 4BLRA 4D2IA 1EFHA 2GKSA 3VR4A 2GZDA 1Z29A 3CPJB 4BFVA 1BYUA 4ZDJA 2RMKA 1Z83A 3FKSA 2I1QA 1W5TA 1Q57A 2JJ8A 4RFSB 4MKFA 3D3QA 4MRVA 3T12A 4UNQA 3QXCA 4TTQA 1EFRD 2ZRJA 4LJ4A 2HUPA 4BRWA 5CB6A 4D25A 2H5EA 1J8YF 4BASA 3LVRE 4LJ6A 4U00A 2ZRCA 3CRW1 4QC2A 1X3SA 4NKRA 2H16A 4MKHA 2QP9X 1KI3A 3SU8A 1FL9A 4TQ9A 1LY1A 2BBTA 5AUOB 5B57C 1PLKA 4IFBA 3KJHA 1NN0A 1YHNA 4RD4A 2ZJ5A 1QHHA 4Q03A 3FKQA 4MYCA 2C8VA 1Q12A 3QNUA 2Z5FA 2F6RA 1ZIPA 4YLGA 3L82B 4M1WA 2ZJYA 4PX9A 5J47A 1QHHB 3HJNA 2DFNA 1C4OA 4AG5A 5HKKD 2CLSA 3OIUA 3VNVA 2WHXA 5B2ZA 3CONA 1DAEA 3RC3A 4TMTA 1LF0A 1ODFA 1KOFA 1X8LA 2JJ2D 4HUQA 3FDIA 1XMIA 3K0FB 3HYTA 2L0XA 4JSTA 3OESA 3KJIA 4AKEA 1LB1B 1T5IA 2NGRA 2G0TA 4JL6A 3Q9LA 3TAHA 3VR2A 2P6NA 4X8OA 2HF9A 3C5HA 3SFVA 1BMFD 3BH6A 4KI0A 4NYIQ 4S2EA 2VH5R 2EYQA 5F98A 2NG1A 5KNDA 4HB2A 2B21A 5EXXA 4URUR 3SS8A 4DCVA 3FWYA 1II8A 3RLFA 3RS4A 4NPHA 3IO5A 1U0JA 4P4UA 1UBCA 4B3BA 5UKDA 5KYKA 1TTTA 3BH7A 3RS5A 1S1MA 4MUAA 4N0EA 1YZTA 1U94A 4GOJA 4BFZA 3SN6A 3SJBA 1Z63A 4TQAA 1S3GA 2V7QD 4KVAA 1GKUB 2RCNA 3DDCA 3NH9A 4A92A 3BXZA 1D2NA 1PLLA 2BCJQ 2CNWA 1NN1A 3MSXA 4CEJA 2HLDA 2P6UA 4RJLA 5C18A 2ZRLA 5JJLA 3QXHA 2WV9A 1G21E 1SVIA 1PUIA 5K8IA 1Z0IA 4DUGD 2CCKA 3PIRA 2IYTA 1JXOA 2BVNA 3BJIC 4EKDA 5AUNB 1AQUA 1MABB 5FI1B 1E2QA 1KMHA 5CB8A 5HE8A 2C99A 3RAPR 1WRBA 2IK8A 3D7MA 5J4KA 4XH9B 3R9XA 1SULA 4EPWA 2CXXA 4XTRA 5L3VA 3CRQA 1KMHB 4UNNA 2BC9A 3A36A 3LBHA 4LJ7A 1VYUA 1D2MA 4M1SA 3KQNA 4JSYA 5DI3B 4HLDA 2R6CA 3L2OB 1NP6A 2ODEA 5FL7A 4RVCA 4Q1AA 1E2MA 4B6EA 2JIZD 2SHKA 4TT3A 1X1SA 3EW9A 1B0UA 2GILA 2OLJA 1RE0A 3MRSA 5E7MA 5FUWA 3EG5A 5DGXA 1SVOA 3I8SA 3OHMA 1HY3A 4M21A 2RGNA 4Q5IA 4C30A 1YE8A 1H65A 3HP1A 1OXXK 1KDPA 4Q18A 2PEZA 1CR2A 3MCAA 5DYGA 2J7PD 3A1WA 4B32A 2I1VB 1V43A 3BFXA 4WZBE 3GPLA 2J3EA 5K8LA 4HB3A 4JBXA 221PA 2B92A 1YZUA 3KDSE 1FNMA 2REXB 4TLDA 2ZI5A 3A1SA 1KKLA 3N2IA 5TB5A 4PZZA 1EX6A 3GJXC 1NN3A 4RD3A 2NIPA 1H8ED 1GL9B 1XX6A 2IEYA 5FBWB 1NBMD 1TF5A 4BLQA 2W6JA 1M2OB 3A6PC 1P2TA 3UK6A 1D2EA 2EWWA 2GXUA 1F60A 4PFSA 4BFSA 3FB4A 3H86A 4FMBB 4OK3A 1GP2A 1WXQA 1S2MA 1G6HA 2ECKA 4OHYA 1UPTA 3I1FA 4M8NE 3TQCA 4V0ME 3MUFA 5IF9A 3AVXA 4R9UC 4LV6A 4W5HA 1OH7A 2UZ3A 1XPRA 2PX3A 1ONBA 4PC2A 2MSCB 5EP4A 1PJRA 3KJGA 2IX3A 1CJKC 3PJRA 4W9MC 3K9GA 1ZCAA 2WICA 2ZTSA 2GRJA 2QEQA 3D31A 3I32A 3KJEA 3KUDA 4HAVA 2HV8A 2FDCA 1COWA 2VPPA 3GFTA 4AK9A 1KO4A 4HLUC 4MDEA 3B6EA 1E99A 2XB4A 2OFXA 2QL6A 2OUKA 1P3JA 1BYIA 1ZCBA 1EGAA 1HURA 3SOPA 8OHMA 1X1RA 1SVMA 1E2FA 1E2DA 1J70A 3KQHA 3LBIA 4LC0A 1E2LA 2OT3B 1Q1ZA 2NO6A 2BOVA 3GEIA 1IAQA 4QJ5A 3R20A 4B44A 3ZIAD 1ZC3A 2F1JA 1W49A 4LDJA 3GJ7A 4TMXA 1E0AA 3VHXA 3X1DA 3QPUA 4PHTA 2IUUA 2XNSA 5B58C 4G1UC 1QG2A 5KU1A 3TK1A 4MA4A 3JZAA 4EJSA 4NHOA 4G5GA 4KU4A 1LTQA 4IDQA 3WP0A 2PCJA 1P2UA 1Z6XA 2HJGA 4PSAA 4QL3A 5J4LA 3IILA 4PTLA 2OM2A 4EJSB 3HU3A 3CR8A 2KBEA 1X8JA 4RY2A 4JJKA 3C8UA 1ZU4A 1XCGB 2ZANA 2CLDX 2KWIA 4OK6A 1L7VC 2G1KA 4U02A 1E1RA 4LK2A 4DLTA 4B3DA 4NCKA 2PL3A 3TSWA 3BORA 2YJTD 5KSYA 5FOVA 3PVSA 5CIQA 5JRZA 3FMIA 4G3XA 4IEIA 2PMDA 2XAUA 5EE1A 1YJ5A 3DEFA 1FQJA 4WVFA 4GRAA 3KQKA 4LHVA 3TJZA 5BXQC 5AJWA 4S35A 5FUYA 1ELOA 1XWIA 2UZIR 4IJMA 1NLZA 2WAYA 3QVUA 2ZROA 4OHVA 4LJAA 4PZYA 3EWSA 1L4YA 4JVMA 2NTYC 1MRSA 3VU9A 3MGCA 1JEDA 2BM1A 4YQFA 2QE7D 2I4IA 3LLUA 3KTAA 1P4SA 5BYKA 4B3XA 3VU9B 4HYYA 1A2BA 1QHSA 1ZM2A 4F93B 2ZUBA 3G5UA 2FU5C 3DM9B 3K09C 2OILA 4QGAA 3KTAB 4TZ6A 2J1LA 1TNDA 4YMWA 3KKPA 4H9GA 4XVQA 3SHFA 1GL6A 1KSHA 1XTJA 5SZHB 4FCVA 3AVOA 4ZPXA 3W6NA 1OB5A 3ZVNA 1UADA 1CRQA 3MAAC 3ND9A 1GL7A 4Q00A 1JAHA 2FA9A 2BEKA 1OIWA 1NIPA 4TSFD 1Q3HA 2LKCA 3X1WA 3QBVA 4ACBA 2QA5A 4C9BA 5J4YA 1N2CE 5FTJA 2D2FA 3B2EA 5CLLA 1GTVA 2WJGA 3PENA 3IIKA 2H92A 3KQUA 5H8WA 3IPXA 1GITA 3A4LA 2IS4A 2WWHA 4DDTA 2PJZA 4U7DA 4PO9A 4QHSA 4TMKA 5BN3A 1K6MA 5J4HA 3NIBA 2WWWA 2NZJA 3FKSD 4LJ5A 4TTRA 4YDSA 1DTSA 5EUMA 1ZW6A 2V9PA 4AYTA 1JR3E 3QG1A 1E98A 3U6KA 4DSNA 2QZ4A 3SYLA 3GJ3A 1Z8FA 5F2EA 1NJGA 1T8TA 2J46A 4MRRA 1JQLB 1PUJA 4G5RA 3TE6A 2F1HA 4NYMQ 3ZH9B 3SR0A 3NBXX 1SZPA 2FPMA 1A2KC 4CW7A 2H17A 1KI1A 4V0KA 4MQBA 4RSGA 1S9DA 3WYFA 4JLPA 1T9HA 2RAPA 1G8HA 2OZEA 2YV5A 4GP7A 1E32A 4JVSB 4RCZA 4UJ5A 4CF7A 3EPLA 2DFKB 3LV8A 4Q9IA 1F2TA 1NL3A 1RRPA 1P73A 2A30A 4M1OA 5AJYA 1LS1A 2QN6A 2H18A 2WMNB 4DCUA 2PJRA 1WDTA 2GCNA 1I2MA 2HXSA 2FFQA 3UIEA 1XMVA 4C0AC 2LCFA 2WVJA 1F2TB 2ZSEA 1DAKA 1ZM3A 2OBLA 4C0LA 4R7ZA 4R71A 4XVRA 2MMCA 2WMOB 2VHUA 4R2HA 1IN6A 1KSJA 2HCJB 1OH6A 1JBKA 1WCV1 4D82A 2DFTA 4KXFB 4L9WA 2NO9A 3B85A 1PLJA 1J7KA 4KYUA 4Q4AA 2GJ9A 4C7OA 1W46A 4ASUA 4Q47A 4QHTA 5FTMA 2MMGA 4HAUA 2V7QA 2IA5A 4Z8YA 4F7WA 1G5RA 4B74A 1DAGA 4RZXA 4JBWA 2Q0HA 3GEEA 1LF5A 4Q4AB 4ZIRA 4C7OB 1U8ZA 2OV2A 2YNMA 2ZRDA 3M1IA 2ZS8A 2QGNA 1CKEA 4URZR 3DZ8A 3IPYA 3SJAA 1R5OA 1CR4A 1RKBA 1YZKA 2B7CA 4ZIRB 1ZNWA 3W5IA 3R8CA 4PC1A 4DUGA 1G7RA 4DSOA 4GOKA 1XXHA 2BDTA 3L0IB 4IKEA 1D9ZA 1W0JD 2CK3D 2Q3MA 2ZSDA 3KL4A 4DEXA 2ANCA 1M1YE 2AR7A 2YOFA 2IUTA 3K70B 1ZNXA 4PQYA 3LFUA 1JJVA 1UBEA 3AGQA 4C0QC 1XXHB 2RGEA 4Z54A 4Y0AA 4DLWA 3O8CA 4NMMA 3OE7D 3B7GA 4JLDA 1NMZA 2O0KA 1M34E 3GJ5A 4PHHA 3W90A 1E9DA 1WP9A 1U99A 2OG2A 1W36B 1UFQA 1JR6A 3RHFA 3W8NA 3IUYA 1WQ1R 4KITB 4TYNA 5JWHA 4HDQB 3PR1A 2QPOA 3T1VA 3RSOA 2IS6A 1AZTA 5EE3A 2ZQ5A 2NPIA 1N6NA 4C0BA 3RRZA 3K0CA 1HE1C 1OIVA 2DY1A 4EFNA 4XSGA 5FL7D 4YMUA 2QAJA 1QHXA 2O0JA 2PLFA 1G3RA 2IS1A 2J7PA 4LPKA 3K0AA 4A8JC 4E22A 1XBTA 3CW2A 3EPHA 4FMDB 2JLXA 1RYFA 1G9XA 3C15C 3ONWA 3T34A 2PCLA 1PZNA 1N5LA 1L4UA 2FWRA 2HJVA 2AX4A 1XEWX 3K0AB 3OF5A 1KJYA 1G8FA 2AL7A 4UKDA 1H8EA 4HSEA 3GLFB 3BBPA 1RYHA 2CL0X 1NBMA 2ZVQX 1G7TA 3E70C 4TL6A 5EE9A 3SC3A 1XCMA 4JYBA 2VP2A 1G7SA 3WP1B 3ZDQA 4C4PA 3SZRA 4LGMA 3EX7C 1EXMA 1MO3A 1S4QA 2VQSA 3GQBA 4QG7A 3UKDA 1QBKC 2P65A 4HZIA 5KSOA 5GVRA 3RS3A 4BLOA 2REBA 2W6JD 3IHWA 3VR5A 3U4QA 2A7QA 1W1WA 4DDWA 3W34A 1OYWA 2OCAA 4IDHA 3AKYA 3GLHA 3CUEF 2V54A 4BEBA 5GADl 4MYHA 4N3NA 4NCHA 5KTYA 1KO1A 3M6AA 1IN4A 3GLHB 4TN1A 5JRJA 3LA6A 1Z2AA 1Q0UA 1NSTA 4JS0A 2ZE5A 1M7BA 1T3SA 4PSKA 1XTIA 4TL9A 4TLCA 3T5GA 4RFVA 1R5BA 5LB2A 4M2LA 4EAQA 3CZQA 1BS1A 4HZUA 4MDFA 5AWFC 5LBIA 2GDJA 3TQFA 3R8FA 1PV4A 3AV0B 3K0EA 6Q21A 1KI2A 2QENA 3VMFA 2JA1A 3CF2A 1UKVY 1NY5A 3PUZA 4HZUB 5FR2A 4AURA 2IYUA 2FV8A 2F43B 2FPLA 2GK6A 4ZDWA 2AK3A 5GJCA 3HYRA 1JECA 1ZUIA 5CIWA 1N3BA 2D06A 3AVPA 3X2SA 2ONJA 2YINC 1GWNA 2F9LA 1L2TA 4BLTA 3BOSA 1CR1A 4V0OA 1KI4A 3NC0C 4KSCA 4TLBA 4F4IA 4Q7JB 2IUSA 4KCGA 3U7FB 3GFPA 3AVUA 1Z0DA 1HEIA 2F7SA 1DS6A 5CK4A 3WY9A 3W6OA 3PUVA 2VP9A 1G41A 3RVBA 3EZ6A 1SKQA 4FCTA 2ODNA 4LOAA 4I81A 3G0HA 1KY2A 1Z0KA 1OE0A 3AF1A 3FMFA 3H84A 5KNBA 3LX8A 2JLQA 1XZPA 2C03A 3BAFA 3L0OA 5LD2B 4CGZA 2VP0A 4LHWA 2X8AA 3ZQ6A 2LKDA 4KYIB 3O8RA 2IYVA 2QTVB 1NKSA 2ZRKA 1OH8A 1VCIA 1ZBDA 3SFZA 1QHYA 1HT2E 1OB2A 5JLJA 1JALA 5CM9C 3CX7A 4D0NA 2VLIA 2QPAA 1XB2A 1G17A 4B6FA 1NG9A 1VCOA 2VL7A 5FBRB 1L8QA 2BMFA 2J87A 3EIHA 5B64A 5JFGA 1GVNB 5FPYA 2A5GA 2ZM5A 4Q9JA 4FCWA 4K46A 1IXRC 5FPSA 2D74A 1RRGA 2WSMA 5H68A 2CCGA 2VA8A 2VSFA 2QE7A 3BK7A 1GFIA 1TMKA 4LWZA 1R0WA 1ANKA 4Z1MA 2JLRA 1TAGA 1SVKA 2V4ZA 4GT1A 3U6BA 4URWR 3Q7QA 3AKCA 2FZLA 3N70A 1G19A 2WJJA 4D4KA 4PQRA 3TNFA 1NKTA 1TQ6A 2BBOA 4HATA 1CJTC 4TWZA 1T0JB 2ZS7A 1OFUX 4LYFA 3CWQA 4TTPA 4C0HA 3K0SA 4Q9LA 1OV4A 4OJKA 4DB2A 4RCYA 4LJ9A 5EQTA 2WWIA 2XOKA 4DDUA 5HPYB 2ZRPA 1KAOA 2VP6A 1UF9A 4ZCIA 5KO2A 3A1TA 2Z4RA 5DH9A 1W5SA 4MYTA 5FPTA 4TMWA 1JJ7A 1VTKA 3CPEA 5IDVA 4CZ2A 2WWYA 4I1OA 2G0NA 2O8FA 3QQ5A 3U7HB 1Z6YA 3B1ZA 1G1MA 5DNYB 1SKYE 4M53A 2VO1A 4G5OA 2XJ9A 1GRQA 3B8HA 2GNOA 3FOZA 4L5BA 5LB4A 2O8FB 3UMRA 3CRVA 1E9BA 2Z43A 1O87A 3LQQA 1C9KA 1GSIA 1Q1EA 2CE2X 4FWIB 4DIEA 1WMSA 2BMDA 3WBKA 1A82A 1EWQA 1ZRHA 3TSZA 3DOFA 5JBQA 2WOJA 2RGNC 1E9EA 1MKYA 4US0R 4QNRA 3VFDA 2Z83A 3AUXA 1MH1A 1P72A 3GLIA 5GJBA 3H1TA 4X8LA 4TQUS 3PXGA 4QOSA 3IGFA 4G5QA 1DADA 3SEAA 3UATA 3THXA 2FGJA 3K0FA 5TMPA 3GLIB 1RJ9B 1C1YA 2E9SA 3IKJA 1E2HA 4IFEA 2BMEA 4EPVA 1E9RA 4DKXA 3QF7A 4B35A 4GBMA 3C41J 3MMPA 5C2JB 3THXB 1IOZA 1O3YA 4HAXA 4IDOA 2W00A 1HQCA 2QMUA 4N0DA 2JLZA 3CB4A 3U44A 4ESVA 1E0JA 2DCUA 3VQTA 3KQLA 1G16A 4MUBA 3CH4B 3DMDA 4PC6A 1XTQA 5KSPA 3UG7A 4OK5A 3U44B 1KGDA 1YRAA 2IHBA 5G53C 2HCBA 2QI9C 5FBVB 1ESMA 4Q1EA 4D4LA 4HLQB 2GBLA 3K8YA 2CL6X 4K8OA 1P7CA 2A78A 4NBSA 4NP6A 4OJQA 2ZPTX 4IDNA 3TW8B 3IHLA 4RD2A 4ASUD 3WMGA 2J0UA 1KZ7B 3HU2A 1S1CA 2C77A 1SXJA 5JEEA 2F1IA 2QAGB 4L8GA 4M9SA 5HCIA 1JPNA 2FPKA 1IN5A 3QXXA 5AJZA 1I4DD 1FX0A 2P67A 1ZD1A 2PMKA 4MRSA 3WHKA 5CJPA 2J0UB 3QI2A 1W0JA 2CK3A 1SXJB 4GFDA 1ZNZA 3R9WA 4II7A 2XTZA 2DBYA 1MABA 2WIBA 3EA5A 3DM5A 4JLOA 1FX0B 2C96A 4Q1FA 4MGKR 3K70D 3DZDA 3DHWC 4EJSC 4LZZA 3VHLB 4Q4HB 3OE7A 4EUNA 4Q1DA 3ADCA 3CM0A 5GJWC 3E1SA 3VKHA 1MO4A 2ZI4A 3AF4A 621PA 5IRCD 1VKJA 2XZLA 4G0NA 3ZZ0A 4QHYA 1KJZA 3X1ZA 4IEEA 4BE7B 2P5SA 2X77A 1SVWA 1W36D 3LO5A 5DI3A 2OAP1 1G64A 2ZJAA 1HV8A 1E2NA 4WBSA 3E2IA 2R65A 1KI9A 1T8UA 1XMJA 4IXMA 5IT5A 3GD7A 4XD7A 3CH5A 2GZHA 3T1TA 4ZDIA 3KXLA 1B23P 2QM8A 2MSDB 3RWMB 4ESHA 1W2HA 1YZNA 3HPQA 4QGGA 4V03A 4NYIR 2NZ8A 1NF3A 2ZU0C 1DAHA 2CMKA 1DPFA 4D81A 1W4BA 4B3CA 4KSBA 4LSGA 5EZ5A 3BC1A 2CHVA 3SYKA 1YRBA 2PX0A 2CVFA 4R98A 1AS3A 3IBGA 4RD1A 3W6PA 4DWJA 4ZKDA 4ARZA 3FYHA 5E4FA 5DSZA 1QHNA 1KJWA 2ZRIA 3NC1C 4E09A 4EIWA 1UAAA 4ARZB 3NKVA 4V0LA 4ZO4A 4CDGA 2IYQA 3NEYA 4NDZA 3THYA 3B60A 1TADA 1K8RA 1YZGA 3ZGXA 1P61B 3AKDA 3MG9A 3AVTA 3ICQB 4FN5A 2QM7A 1Z0JA 1Z0FA 3QENA 5DO9A 2ZAMA 5TV2A 3ZLJA 3KZ1E 1E96A 3THYB 3EZ2A 5P21A 3TRFA 1AK2A 5FOSA 3RSLA 1UJ2A 1OHHA 1XD8A 2GCPA 3QF4A 1CJUC 1PVOA 2CHGA 4YMTA 4RD0A 4BUJA 2BJVA 5JCZA 2D62A 2A3RA 2ZRMA 2GAAA 4JL5A 5GJVC 3K53A 3CF0A 3P32A 4I4LA 4UJ3A 5K8TA 2VYFA 2KJQA 3AUYA 3QF4B 4JLJA 1UM8A 4OQMA 1JB1A 1IHUA 2ZR0A 4PSVA 3FFAA 4Q21A 1XXHE 2QBYB 1XTSA 3WMEA 3PUWA 4XWOA 1E9CA 4F91B 2XTNA 2CE7A 3N5CA 2WJHA 2DPXA 2XITA 2ZJZA 1RRCA 1Z47A 3LNCA 3NHBA 4W7SA 2GETA 1U8YA 1CR0A 1ZNYA 4Q48A 5FOTA 2FSIA 1SVLA 2GJAA 1XPOA 2F3RA 2OFOA 3P4YA 4LPSA 1W4AA 1XEFA 3PFIA 3GLGB 3CIOA 5HTKA 3OFNA 2WJVA 2G6BA 5ELXA 4O0MA 3A1UA 2ZVPX 1N6HA 1XJ0A 4JVLA 3DMNA 4PPNA 4QNMA 4ZI2A 3PUYA 1S8FA 5KPJA 1RVDA 3RDPA 1UBGA 3QY0A 1DEKA 1KDRA 4F4JA 1E2JA 2J5XA 2P5TB 2ZYTX 1CS4C 1N0UA 4DEYA 3Q85A 3CX8A 5KUTA 2NMVA 1E2PA 1TEXA 1CBUA 2ZSAA 5FOWA 4I1UA 3LBNA 1BKDR 2B8WA 4US2R 2IS2A 4A0FA 2JLSA 2G3YA 4B2PA 5C46F 4FMDF 2C9YA 3AKEA 5JS8A 3B5JA 3GJ6A 4GOXA 1W0KA 2MSEB 2OAQ1 1P9RA 1XEXB 4B34A 1XDBA 2FNAA 3MWYW 4JT2A 3LLMA 1W4RA 1IN8A 4EPRA 2Q9CA 2ZI3A 1KDTA 4PPGA 1OFTA 1XRJA 5CDFE 4GMDA 5KDDA 1TUIA 2H7VA 2XGJA 3U5ZB 2Z6VA 2W2VA 3VR6A 4BFYA 1M7GA 2FN4A 3SQWA 2P6RA 3W5JA 3TUJC 1VIYA 1FUUA 4XOIA 4Q01A 2B6HA 4MITA 1II0A 1F2UB 2JATA 3R7WB 4Z1MD 2AFIE 2BHRA 3TW4A 4IVPA 3K70C 2GJ8A 2WWGA 3WYGA 4P31A 1CLUA 3TR0A 1BH2A 5H70A 4LYAA 1F5NA 2BKUA 2YYZA 2E87A 3FE2A 2YWHA 2IWHA 3GCGA 3BB3A 1QDEA 1JAIA 4JVNA 2WTUA 2FOLA 2TMKA 1E9FA 5L3QB 1GRRA 1W4CA 2XOKD 4PR0A 521PA 2PZEA 1W36C 3TUIC 2D3WA 3CX6A 4XIGS 1GILA 5EXTA 1GNPA 5K8UA 1BIFA 2VP4A 4DDVA 1T6NA 1U0LA 4B76A 4CEHA 3BB1A 4A0HA 4A1FA 2B7BA 4PHGA 4DLRA 4FIDA 3UXMA 5FUXA 3RYTC 3CRMA 2QUZA 2QNRA 1N5JA 4Q9HA 2EFCB 3S1AA 4CEHB 5M04A 2G88A 1IM2A 5JEDA 5AJXA 3EIEA 4A2QA 2Q9AA 1P62B 2JDID 1E2GA 1QVRA 3K0CC 1Q1QA 4BEJA 4CIDA 2PH1A 4ZCMA 2W6ID 3S1AB 3SJCA 2JASA 2QT1A 2OHFA 4J0QA 1P9WA 2WSSD 1KYIA 4HLCA 4XVUA 5HZKA 3NVAA 1R10A 2YC4C 1GIAA 4CVNA 3T1OA 2A5JA 1NRJB 4IW3B 4LHXA 3W8RA 3FGNA 2J9RA 1VIAA 1G8PA 1ZC4A 1XCPA 4OYHA 3RWOA 3BE4A 4QGFA 421PA 1N6IA 2FEOA 1NNEA 2V3CC 1ZIOA 3I5XA 3EZ9A 2IYRA 1TQDA 4Q9KA 3REGA 2DB3A 1X8KA 4BFTA 1SGWA 2PT7A 1FMLA 4FXPA 4KJZA 3A4MA 1E2KA 3NTUA 4C0KA 1VHTA 3QKRB 1DE0A 4TZ0A 4DCNA 1IXZA 3ZD6A 4TL8A 5DYIA 3BFVA 1S3SA 4DT1A 1I4TD 3VAAA 3QOFA 2ERYA 4NYJQ 4OHZA 3I61A 1EFTA 1GNRA 3ZZTA 4IRUB 2ONKA 2VP5A 4DT1B 3L8ZA 4I1VA 3RS0A 2YOGA 4BECA 1E0KA 1G291 3LD9A 2IYXA 3I92A 3K1JA 4A9AA 1GM5A 2OXCA 1IY2A 1I4LD 2W83A 1J2JA 4L9SA 3UWOA 2D7DA 1Q22A 3QKSA 5DHFA 4PANA 2PZGA 4AC9A 4YMVA 2GESA 5A5GA 2ZITA 4YMSA 1KKMA 4RKFA 3QKSB 1SXJD 1A1VA 3P4XA 3KFXA 1DARA 1RW4A 2YZ2A 4M1YA 2IF2A 1DAMA 4NYMR 1OLOA 5E3HA 1NVVQ 2BV3A 3LQRA 1AN0A 1E79D 2HF8A 1N6LA 3M4YA 1KO5A 4V0MA 1N6PA 2W2TA 3NBZC 3T35A 2JLUA 4EDHA 3ASYA 4OQXA 5DN6D 4X8HA 4LBVA 4D26A 3FPAA 1AA9A 3CNNA 1X6VA 1P2SA 3O8DA 1E2IA 4QBHA 4KLZA 3TGPA 2XSZD 1AIPA 4Q1CA 1FFHA 3W3ZB 5JSZB 2P3SA 2YKGA 2ZI7A 4HUTA 5HR5A 5LD2C 4JLNA 3LW7A 4E5UA 1IONA 1VG9B 1YVDA 2KE5A 1KTVA 1P75A 1ZYUA 1G8GA 2FSFA 3AP2A 1UEIA 4XD7D 3GJ4A 4M1KA 4Z8XA 1Z5ZA 4F4CA 3AF2A 1IY0A 1N5IA 4PQFA 1N0VC 5EJEA 1VECA 2FZ4A 5L3SA 3LXRA 4LJ8A 1CRPA 2PEYA 2IYLD 3A58B 4A0RA 4OBEA 2WKQA 1G8YA 5HCNA 4B33A 2AXNA 3CF6R 3MJHA 5L3SB 2QMEA 2A2ZA 3EWAA 3GLFA 4GI7A 2VRWA 3GEHA 2XXAA 3IIMA 4TL7A 4LV8B 3OAAD 2QTFA 2XZOA 1UDXA 2WIAA 5F3WB 2ZJOA 4O2RA 4OI0A 4B73A 2BCGY 4EPTA 4RD6A 2I3BA 4JT4A 2XXAB 1G18A 4QKQA 4TYQA 3CBQA 1KNQA 2FSGA 3B9PA 4WXPA 3U3OA 2AWNA 2KSQA 1TU4A 4JLMA 3O47A 2QGZA 1JNYA 1G20E 3NG1A 1E94E 4DLYA 3KKQA 4WOPA 3AH8A 3AVWA 4C3ZA 4Q1BA 4US1R 1F6BA 4P4TA 4TYWA 3BERA 2Q3HA 4C2UA 2CEAA 3MFYA 3LW8A 4JMPA 1OHHD 1ZM4A 3IO3A 4WA7A 2J59A 3JVVA 4TLAA 1N6KA 3EPKA 1EK0A 4AYXA 1DG1G 2GF9A 2R62A 2F1RA 3AF0A 1UKYA 2GF0A 2EFHB 2ZETA 5BWMA 2OBMA 2QORA 3KUCA 5TXGA 2NO0A 4YONB 1LNZA 4A0GA 2OSBA 3KFVA 2F43A 4X8MA 3QSYA 1Q44A 5JJKA 4LHYA 1ZUNB 3G82C 4LCBA 3KKNA 2C5LA 3VX4A 1OF1A 2ORVA 1Z08A 3KB1A 1RFLA 3GFOA 2ERXA 2YHSA 2ZI6A
chains in the Genus database with same CATH superfamily
1T26A 4UCWA 5FL3A 2O4UX 4HYQA 2JAUA 2W2XA 4W7HA 1BZYA 4LMAA 2VSXA 3FR7A 5L95A 5D5PA 4I19A 4CF6A 2FR8A 1KE2A 3GIWA 2Y27A 3O75A 1WG8A 3SDZA 5T5QA 2OBYA 1YGYA 4YUWA 3UGKA 3NRCA 4LOHA 1IEVA 2ZE7A 3ZOZA 2IFTA 3WYNA 1OH5A 2Q5JA 1YNOA 4D4MA 4PGHA 1ISGA 3HADA 3QBTA 1GPJA 2QRZA 1KMNA 3R3HA 1VDMA 1Y4DE 4FGWA 1AKVA 1B0PA 1DDOA 2BEJA 1O97D 1N2CA 1BMTA 1C8VB 2NACA 5EUQB 3NWJA 1B43A 1P4HA 2P9YA 3F5SA 3FCAA 1YJXA 3DB2A 4H0NA 2BBWA 1OC2A 1HYEA 5I6DA 3CHYA 4M9CA 4GS5A 4XZ3A 2XUOA 3TZLA 1BOFA 2OPHA 4A2PA 3JD3A 1N2CB 3ZJUA 4PCAA 1E5XA 3AY6A 2QLJA 4HDOB 1S2LA 2JFPA 2ZDQA 1TGYA 1KS2A 1JR3A 5JZMA 1KO7A 2EKLA 5TMBA 1JIJA 3M6XA 3VMMA 1L5OA 4J49A 2HRRA 4DPLA 3EEIA 1T1IA 2C98A 2HHAA 2P9FA 3AWIA 2XTMA 4JIMA 3DCIA 3WXBA 2BFBB 4QJ3A 1XP5A 2ZW9A 1EPUA 4Y1RA 5BWCA 4X20A 5DYTA 1OFHA 2HTFA 3C4VA 2VZ9A 3O3CA 1P4RA 4KLCA 4KPYA 1T29A 3DEHA 4H1UA 1KBOA 1I1NA 4HDRA 1JQ5A 3RF6A 1AXGA 5D87A 1NN5A 4Y1RB 4QDZA 8ABPA 4LMRA 3HO6A 1KK1A 5L3RA 1I4WA 4KIFA 4X20B 3ER8A 3PPXA 4DQKA 2GBLC 2CJPA 2IYPA 2IIQA 2SKCA 2BGIA 2VA9A 3NEJA 5B1SA 5JZBA 1T3TA 1U7XA 1L4FA 4HDRB 2EZ8A 4RDCA 3C4JA 3D8BA 5FJIA 5JSHA 1UBFA 2YRXA 4RM3A 2BGRA 4Q4JA 5BQOA 5T3YA 3FUVA 4QJ4A 3U80A 1DC8A 1GCOA 1YIAA 5B1DA 1B2LA 4BCBA 1ECJA 1CHDA 4L6AA 2OYRA 3UMBA 4JZYA 2P9GA 2X9NA 2MINA 3C16C 2G5GX 2P4HX 1CZRA 2OESA 1EVZA 3NB0A 4Q4JB 5GV8A 3TBKA 2OEPA 5ALUA 2OCBA 5F5NA 2HT1A 5E7IA 5KHOC 2PGIA 2XUGA 2PU5A 1KSFX 2OMEA 1PO7A 1TJ3A 3BWDD 4ZANA 3UWMA 3AM1A 1JHOA 3JV7A 4D8YA 1DG3A 1YB1A 1RJGA 2D54A 3D1JA 4NICA 4QRHA 3O8BA 2DECA 4Y6PA 1Q17A 2DPMA 4PAMA 5KWIA 2GLUA 1WD7A 1ZVQA 1KIMA 3H4TA 3MWKA 3FTNA 2X5JO 4XXHA 5FT9A 1CU1A 2G08A 2BE9A 1JB9A 4Q24A 5JH7F 1N7HA 4AKGA 3IYLW 2X58A 3H1EA 1BFKA 1WUTA 4N9QA 4PY2A 4FSXA 3D7LA 1NMYA 2QUKA 3H8VA 4J0EA 1IUNA 2NQ2C 2JGDA 4CLRA 1Z68A 5ICSA 1E3QA 4HNAA 4NF2A 5DHTA 4Q93A 4YV7A 1ZU5A 3JQBA 2AG5A 3W3AA 4L16A 2JDIA 1A71A 1NOJA 2EQAA 3LUBA 3LY5A 3PA6A 1CJMA 2PV0A 2BUAA 3VJKA 1JZSA 1XYVA 1HBJA 4EF6A 1JIIA 2B4TO 2DPYA 3R1IA 5EI5A 4CLRB 4PZLA 2JGDB 4NV0A 1CY7A 4GLBA 4QJBA 4DXDA 4NOLA 1LFDB 4N7MA 1NY6A 1JFFB 3ZNNA 1XU4A 4F8YA 1TIPA 4BZXA 4D8VA 2O7QA 1K3FA 4XIFA 1BEEA 4LX0A 4ZT2A 3RHSA 1WDWB 3TJMA 3QPVA 4ZVOA 4B71A 1R4AA 3RS2A 1KVQA 3WHPA 1VG0B 3E7DA 4RMHA 4WBNA 5ICEA 4HXFB 1RJ9A 3JYPA 4H3KB 5K0TA 1K4YA 4M9ZA 2YL2A 1PGJA 3NBYC 4NABA 2AZ4A 2BRUA 4PLCA 1V9SA 4XDZA 3ZEIA 4DC9A 4KMMA 4M7RA 4QUIA 5KYWA 1IY9A 1OZAA 3K16A 3EDOA 3OA2A 3C45A 4WBNB 4B4WA 4HB0A 1QLJA 3C6BA 2KBFA 3ZV7A 1H2EA 4OYRA 2O8NA 4JL8A 4IIDA 4NU0A 3TKLA 2XWSA 3J7AC 2Q5QA 1FBNA 3WIOA 1JWBB 3MK31 4H6XA 2OQIA 1ZRSA 4YMGA 1EZ1A 1JH8A 5KYWB 3WSTA 1AK1A 3QXSA 5TC4A 4J0DA 4Q82A 2M9MA 2VFAA 3VNSA 2OQRA 4M8KA 4CYMA 1EZZA 3QXJA 3ASZA 3NV7A 2D4HA 3H17A 4HJXA 4WNCA 2LWIA 5TLSA 3LDUA 4OXRA 2QAIA 1UM9A 4PPQA 1XVIA 2C31A 2ZQZA 2Y8EA 3DOHA 2R2AA 3T3PB 4DSUA 2WE8A 2IF0A 3M5DA 1E63A 2ETXA 4EENA 1FCJA 2IZ1A 4ZCRA 2KS6A 4W6ZA 4EHLA 3LX5A 1UM9B 1GHTA 3EBLA 3LPCA 3PIIA 4BEWA 3H1FA 4FWTA 4Q7MB 1D5CA 4RGBA 2WW8A 2H1OA 5DSXA 2I7TA 5K6TA 1VPDA 4BKPA 4ZDKA 1KMQA 2C29D 2W71A 1C3OA 1N2GA 2FDRA 3D3WA 3K8OE 3L0SA 3W06A 4C0XA 5CT5A 4HUQB 4K9NA 3U7EB 7MHTA 3K05A 4P98A 5IANA 3OBIA 3F6CA 5L7TA 5JNRA 4MRAA 3A9UA 4IQ0A 3P2EA 4PONA 1N5KA 4GM0A 4P4SA 1D9XA 1E79A 1WQ3A 3D3WB 3HPRA 4H6PA 3W8DA 3U62A 4ZKEA 1KK0A 4O4JF 4GEGA 4UPEA 1WOMA 5AW0A 4NRDA 1E0DA 4O29A 2Q3EA 1OXUA 4MO9A 3RFXA 2AD5A 4P4SB 4BXOA 3EC1A 3LK6A 1XZMA 4XYBA 5GGYA 5FWXB 3ORHA 4GC9A 4U63A 2XSZA 2WKPA 1ZA1A 3NTXA 5FORA 1A9OA 2X1VA 2BFCB 2FMIA 2VJMA 1CJVC 1YI0A 1Q0SA 3FVQA 4MVJI 3SIXA 5HJ5A 5HS4A 1DC5A 4G0QA 3UF0A 4CM8B 3QUAA 3IV6A 4UBKA 4BXOB 3HWSA 3NEPX 1LK0A 1ML3A 2CFRA 2QZSA 2IPMA 2VXBA 1VLJA 1C50A 1MX9A 2IOQA 2VJMB 3ZWNA 3F98A 1QK3A 1W2GA 1SOMA 3HXKA 1NUAA 3NP7A 1R0YA 3AZPA 3OZEA 2ZS9A 4Q3BA 4CEJB 3PF8A 5EE5B 1M1XB 2WHPA 4AECA 2G71A 1LBEA 3V32A 3C7KA 4AS1A 3QUBA 3WS7A 3VDRA 2JFGA 1W1UA 3UOWA 2ZRNA 2WHPB 4BMVA 1GAXA 2DBZA 1OI2A 3RSZA 1N1EA 2HHLA 1OFVA 5AHXA 4DCOA 2AKAB 2A84A 1P44A 4W1SA 3REFA 4YCAA 1GRNA 3OAAA 4KQ1A 1F8XA 2CN1A 4KVGA 4MR7A 1ODKA 1LRKA 3FN4A 1V8FA 3URKA 4CM1A 1KEUA 5C52B 1I1HA 3FSEA 1TVCA 4DR7B 3IJRA 3GP8A 1NBWB 2QW8A 3U60B 4MR7B 3RSSA 1R15A 2XV1A 3GXOA 1QQ6A 3BGSA 4IIVA 1MR3F 1NXPA 2BE7A 3AINA 1JPJA 1WKBA 3Q87B 3X44A 1GDDA 1NASA 3ZWPA 2XQKA 4YAOA 4CMCA 1MV8A 1RKUA 1VQ1A 3DPUA 5I5EA 5TMDA 1N3LA 2NXCA 2NWQA 4JVOA 4UD2A 3U3DA 1QF9A 4J07A 2FZGA 4O2BB 5HK8A 5A7GA 3X2FA 4CLDA 1X7HA 5KTOA 2O7VA 3ZJYA 1Q92A 2IXEA 1UKCA 4AKIA 1RJEA 1YS2X 1ZXBA 4EJ6A 5MF6A 1K5DA 1MGPA 4D8XA 4V1CA 3NTRA 1W44A 3INNA 2XBLA 4KFUA 1M0EA 3PC6A 5A7HA 4OO3A 2R6GA 4JGGA 2O0MA 2XLCA 4XIIA 4DUPA 1GZ6A 2VHJA 1WOYA 4EX6A 3K9BA 4AP9A 1LSSA 1NVEA 4D45A 4MPPA 3ROXA 4NDAA 4V1CB 5M34A 2OSVA 2YIVX 3AESA 4S1WA 5GMOA 3LGXA 4XQ0A 5TVKA 3GJ8A 1DOAA 4REOA 4QT4A 2CDCA 2RBGA 2WD8A 2WIFA 1VG8A 1EHCA 1H0KA 2FFAA 3AOEC 3QELB 4PC3A 5CYOA 1V96A 3MBIA 2K5UA 4AULA 2LVBA 4C6SA 3AESB 3G13A 3ZJVA 1W47A 3DYBA 3DLCA 3GGDA 1SG9A 2V7GA 4L2IA 4OSPA 4QTXA 3V6MA 4CRWB 1KPGA 4RDHA 4O8CA 3CE6A 1W5EA 2NM0A 1GNVA 4C08A 2WQ7A 1K9VF 3FGOA 1IEXA 2QRJA 5HE9A 3W2EA 3K9NA 4EA8A 1VCMA 3IP7A 3DONA 1R66A 4F85A 1C4XA 3UANA 4OXIA 4XJSA 4M88A 1E1CA 4R84A 4H18A 3BDVA 1A8QA 5C35A 3F8SA 4A2CA 2EW1A 2AMFA 2JVIA 5BSEA 2OLKA 4NXMB 4O33A 4PXAA 5AUQA 2B8EA 3B1WA 1O9HA 2OP1A 3IBFA 3PQCA 5LKAA 1PR3A 4R31A 4EMBA 1E3JA 5E1BA 5CLQA 1QTRA 2JFZA 1T3HA 3MERA 2PBLA 2PX4A 1H8HD 1PIWA 3DFIA 5C80A 1MOZA 1OILA 3V1NA 3EOZA 2AE2A 5HRCA 4D0SA 3A1NA 1DV2A 2ZRAA 4GMXA 4DLSA 3DDWA 1XTRA 2I3AA 4XR4A 2AYZA 2O1EA 4ILEA 2CKMA 4QVIA 3SZ3A 4DXHA 1HL7A 4N3GA 3RBVA 1AZSC 1U98A 5KWVA 4FM9A 3M2TA 3LUHA 2RKOA 2OE2A 3BD9A 1SKYB 1TUEA 1XD2A 2HSGA 3N7AA 4RGVA 3G5TA 3HH8A 4K05A 5KYVA 5TY0A 4ZT7A 3HLYA 3A6HA 3IC5A 4NBUA 2W6ZA 3R5HA 3UWPA 2XEXA 4IZHA 5GP1A 2NZ2A 4FYWA 1ID8A 4EG4A 2WHQA 1XD2B 4LQLA 4PINA 2CHQA 2F9MA 4IBOA 2FFBA 4HMPA 3EC2A 1G9TA 4B6OA 3G68A 4YP6A 3A1VA 4DILA 1XV5A 3I3SR 4K9KA 2D00A 3A6ZA 1EDZA 3M9WA 4J6EA 2I76A 1KQNA 3D43A 3NWEA 5C1DA 2LV8A 2Q6TA 3PDCA 1RWVA 4L6CA 3WWZA 4DLBA 2IUFA 4QUEA 1Z6QA 2WM9B 1NLUA 2DLNA 4LI3X 3FTQA 2Q1TA 1M8FA 2G1AA 4DA8A 5B7GA 3GRYA 4B5LA 2RIRA 3AR4A 1IOLA 1R27A 5ANRB 4BCDA 4C3UA 2Q5IA 2WABA 5K0GA 1ONSA 4GBJA 3F3YA 1MORA 1BWRA 1JDBC 3LWNA 2IPOA 4LN1A 4R1LA 3UO8B 4Z9XA 3WL3A 2F3TA 2WG1A 1DBSA 2QTCA 4M1MA 3RKSA 1SZDA 4B87A 4IR7A 4OLAA 1U1DA 2QMQA 3WLMA 2F3QA 3IDAA 1PQWA 2YFHA 4YRAA 3PVZA 4U1RA 1ZZEA 1KSGA 5A4FS 1Z7EA 3K31A 4YXWD 2EU8A 1QRUA 4J1QA 4G23A 5JAMA 1YZ3A 2Q99A 2V0CA 4KQMA 4LYJA 1QDUA 1WY7A 1QOZA 5KPDA 1N8TA 1C7JA 1QRAA 4HK4A 5KNBH 3GH1A 4RTSA 1X14A 2X9QA 4GEKA 2J45A 5LPNA 3CNLA 2EFGA 1OFIA 4J4HA 3WHLA 1ZP6A 1A5ZA 1YKFA 4E4TA 1CTQA 2HYIC 4CL2A 4I8IA 2JD2A 2VWHA 1PFQA 4DXAA 2QV7A 5KC8A 1RHRA 1VE9A 1Z6TA 1EFUA 2OC4A 3R9IA 4FDAA 4CM7A 2W0SA 5CVEA 1YACA 1XKLA 1TYCA 1ESCA 1QOQB 3QPWA 4J03A 3BSYA 3Q2KA 5FUVA 2HOQA 2PD4A 1Z37A 3RUDA 4UDNA 821PA 3TOZA 4IV0A 3VKVA 1GOTA 4F38A 3CJTA 2VTEA 3OCJA 2R7MA 1AKYA 2AUTA 2BM0A 2CD9A 5SYMA 4JBIA 5F9FA 3OQHA 5AW9A 3ECCA 3BT7A 2XUAA 2AFRA 3UH0A 3UJCA 5LNK1 1WV1A 4N54A 1N2JA 2WU0A 2BKEA 5CG2A 4MI3A 5EZYA 3IULA 4C6RA 1JYSA 2VPYA 2J7KA 3EGXA 4GYWA 5BN3B 1H9BA 2RBEA 4R01A 4FZ3A 2H1WA 2W2QA 4OX9Y 3P5BA 3TR5A 5EZYB 3BJZA 1QPGA 1U3GA 4KE9A 3W7AA 4U8GA 3K6SA 4MGYR 3FNEA 3BCUA 3EGXB 4E2ZA 3HBMA 2WB4A 3KOXA 1G4UR 3O90A 2RK6A 4HH0A 4URYR 2ORYA 3K6SB 4MWBA 2QJRA 1EWKA 2W98A 4PQEA 4OKIA 1DJNA 3ADKA 2OAGA 1QZXA 1LWNA 5KJEA 4OI1A 2F8LA 3DMFA 3HKCA 3PQ5A 4HB4A 1NJFA 1Q3TA 1SCAA 1W59A 3DDOA 1SZJG 4J3JA 4MGZR 5GY7A 4DS3A 1TQ8A 3I62A 1SHUX 2ST1A 2VPWA 4JB0A 4X54A 1ZMXA 1FUEA 1GA1A 2LD4A 4NOMA 3EMDA 3HKCB 3GNSA 5IXSA 2AKEA 5IAJA 1FLNA 1Z0AA 5G40A 4OMUA 1PU2A 3OFVA 2W2LA 4MEBA 1BMFA 3GU3A 3VAYA 2ORED 3I9FA 4HDCA 4PFQA 4X7MA 4S0ZA 2BJWA 3QEJA 4U6NA 4I9NA 3VJLA 2LDBA 5EZQA 4F06A 1SNYA 4I4IA 1OW3B 5SZKB 1SUWA 5GV7A 3QXGA 2WRZA 3TQRA 1D4FA 2V6JA 4ABYA 3WIDA 4S05A 3KOWA 2JGIA 3PCRB 4G8CA 1YFKA 4OFWA 4Y98A 5CBPA 1F48A 1TF7A 4IOLA 5KNDD 5EERA 3HVJA 4XD2A 1SUPA 3GT0A 2PLNA 2QU8A 5A9SA 3ZJTA 1YS6A 3O8NA 3TPCA 3QKWA 3R3UA 4Q37A 4RAQA 5IT4A 2B0JA 2GVZC 5C3UA 1VKOA 2WHYA 1JSCA 2FQYA 1J33A 3B13B 3H3FA 4JLVA 5DPMA 5ED0A 3WBJA 4PAWA 1O7JA 5A4KA 4PLVA 3RV4A 5A9SB 1JPUA 2GXAA 4XRGA 2I6FA 3L9XA 4MYDA 3DVSX 4KK4A 4PNZA 2QTZA 4P81A 3WFIA 5JCJD 4GPEA 1PGNA 3IQHX 4BGVA 1EDDA 3X1XA 4MV1A 4PSDA 2O14A 3A9WA 4AG3A 2OVFA 3ABIA 2HLDD 3GMTA 3ZHRA 2WF9A 3ENNA 1NVWQ 3RBAA 4P32A 2OCPA 3AP1A 2FPGA 3IQFA 2D0IA 1L7EA 2A9RA 4B8WA 3VDXA 5DFAA 1PL7A 1F2DA 2G7MC 1RABA 2VHVA 4WFQA 4YJGA 1EEHA 1OASA 1UT8A 1UP7A 2FLWA 4FBGA 4JI6B 4D6YA 3N86A 2WU3A 3BMCA 1E2EA 3E58A 2AT1A 2X40A 4LXHA 5LZ9A 3C3XA 3T5TA 2I4LA 1FTSA 4NYJR 5KI6A 3WNBA 2FPGB 2YJ4A 3SE0A 2FFJA 3RJ5A 1TAUA 2JJ1D 1QPZA 1HYQA 4TKZA 1ECBA 4YJGB 1TT5A 3CUWA 1OLSB 4NCIA 3IUQA 3DL2A 1P17A 3ZGZA 1JHYA 4EJMA 2OB1A 2X19A 2EWVA 2IIPA 4UUOA 1D2RA 1TEHA 1A96A 3DDHA 5I9LA 4BQPA 4GMHA 2YHIA 3DEJA 3OECA 1TT5B 4PO3X 4ONEA 5EXPA 4EMUA 1BE8A 1CP2A 4LY6A 4S1VA 3A9SA 4BO6A 4CM9D 3B6JA 4WBNF 2PLRA 3AF3A 1R18A 1QGOA 3LNTA 1OQAA 3GZJA 5TQ2A 3QH4A 6AT1A 1QJCA 5HHTA 4KR3A 1I3CA 4EHHA 3GO4A 2WI8A 1K88A 2YHIB 2B2NA 1UBKS 4OI4A 2ODQA 2HGSA 1PNOA 3U2QA 2DC1A 2EZ9A 1ZXLA 4Q7LA 4GF5A 3RQIA 1UWCA 5EIBD 3OY7A 9LDBA 1P2DA 4B45A 5C3MA 5L7YA 2PL9A 3OZXA 4OA8A 1F9AA 4ERXA 3WNVA 1RADA 5CDTA 1HDZA 3QE2A 5DX1A 2ATXA 1K7FB 4XB2A 1L8OA 1Y9EA 5DX8A 3EZYA 1J97A 1N4DA 3IAAA 4JCOA 2H1LA 4PPFA 4XGIA 4UHBA 2D13A 4RS4A 4CIVA 5IKPA 3B1VA 3LZCA 4LE1A 1LA2A 5I7EA 1CXZA 1MAUA 1L7OA 3HZZA 5SZJA 1OXBB 1KO8A 4KXMA 5FD8A 4C5CA 3PXDA 4GDFA 4QUAA 4NS1A 7GPBA 1EVIA 2JZCA 4F5EA 5CDFA 2Y1FA 1DELA 3KOUA 1JIVA 1Z12A 3GRKA 3LYAA 1B2RA 1TYDE 3OIVA 5GWXA 3GRZA 3W5SA 5AUPB 2EQBA 2QS9A 4KEAA 3EQ6A 4HGRA 4U3JB 1EFCA 3MLEA 4Y6SA 3ND6A 5MN4A 4ROSA 1E69A 1A5AB 3P7MA 1UP4A 2B5WA 4JOCA 2P0EA 2Z58A 1QC5A 1RRVA 1ZKDA 3OTWA 3STXA 5HFJA 2A5FA 3A25A 3U7RA 2Q3FA 4QA9A 4ID3A 3PF9A 3QWIA 2ORIA 2PSSA 4QYMA 2RHBA 2R6AA 3JATA 1TPZA 4BLWA 4C5BA 3Q8MA 1PX2A 2YZKA 4OMCA 4HNUA 1XRNA 1QC5B 4ESOA 3HXMA 4JJ4A 1Z5NA 5HQTA 1WB9A 4W5WA 4ZZ2A 3STYA 1RQPA 1WUJS 2AFIB 2FB9A 4E4RA 2GCOA 4DCGA 3JATB 3VPXA 1E4YA 4JC5A 3UMJA 1G4AE 3T52A 3PEYA 1AGPA 1ZX1A 3K20A 1GPH1 2G82A 3D7RA 3U61B 1RQ2A 1V95A 2GCOB 3OX1A 4LC1A 5AKJA 5KAMA 2ZATA 3CKLA 4HEJA 4XX0A 4RKEA 5T64A 3ZV4A 4URXR 2EFYA 1GZ4A 3KPWA 1PDWA 3FWKA 4GMFA 1SRRA 3PD7A 1TAQA 3E9CA 1GKKA 4F3RA 1DXQA 3K9LA 4XX0B 5AKHA 2HXYA 4PLPA 5JYCA 2YMQA 5AXDA 4UEOA 5CCXA 1OC4A 1GTL1 1VHQA 2DLCX 5HR5A 2RIPA 5DOZA 4AB1A 3FCEA 1G3UA 3TLBA 1XQ9A 4Y7DA 4EY8A 5CLIA 4ZYXA 4W7IA 4YS6A 3QVXA 1I51A 3AXTA 4YDRA 2Z9BA 4XM2A 3EVTA 3EZNA 2XQIA 1RJDA 3HO8A 5BW8A 5E3JA 2C2YA 1VLZA 3RYFA 1V5IA 1NG1A 3FMOB 4IZ6A 4UUBA 3W0LB 3CT6A 1I2DA 1OVMA 1Y98A 2L19A 4U4AA 2HHCA 3AFHA 1OOEA 2XJ4A 3SP1A 5FTLA 3SJZA 2P5YA 3DL4A 1V4VA 3C6YA 3S8MA 2FFHA 3BS4A 3RYFB 2O8EA 1ISPA 3RTAA 2QAGC 2WJ3A 1TK3A 2SKDA 3PA8A 4UHJA 1FLVA 1Y5IA 4B85A 3KQWA 4Q3OA 2HIAA 3RD5A 4W1QA 4O2BF 2VDJA 4OHWA 1QZZA 1TE2A 3KQVA 4FLFA 2O8EB 1SQFA 4QYIB 2HDNB 1QX4A 1PTKA 4A8JA 5CVCA 2DR3A 2NO7A 5AJHA 4TMVA 1QG6A 1C3LA 1QE5A 1O89A 1UINA 5J4VA 3ITKA 1XO1A 1L1EA 1OPRA 1EXNA 4MQUA 4A8JB 1E2UA 5CDYA 4JR1A 1VZ3A 4TXMA 4N7JA 3KM0A 1V71A 1XVLA 4X7BA 1T5SA 1WDLA 2CNNA 4YXWA 3SVZA 1IZ8A 4WLNA 2XA2A 3AR9A 2NO1A 2JKZA 3UM9A 1UZMA 5G2OA 1ZI9A 2CVHA 1I0ZA 4UD6A 3QEOA 3BWXA 5F9HA 3EQ7A 2JFFA 1GL3A 2IYSA 4JBGA 4GZ6A 4TTIA 1VE1A 3MPOA 1GARA 1T3ZA 3EMVA 4MOWA 5B3AA 2AV6A 5DN9A 1IY1A 5K8CA 3MN1A 2I29A 5K6RA 2B6NA 4FOLA 1N78A 5TDHA 5HSGA 1TU3A 2Q41A 4DNXA 2WU1A 4S0XA 5E95A 1XL1A 1CPYA 1DQPA 2DULA 4IG9A 2XX3A 3CNEA 4JN6B 4JXKA 1FEZA 1QOPB 3PLRA 4ZQFA 5FOXA 3PU6A 3W5HA 4DTCA 4HAZA 4UVHA 4AUMA 5I4CA 1R0ZA 2ZAIA 4IFTA 4AMBA 3CLVA 4I9GA 3I6ZA 4GECA 4CQLA 1LV7A 2G06A 4BZPA 3THWA 1QFSA 3CNBA 3EIQA 3MJSA 1FXWF 1MN6A 3R40A 1KFKB 1Q20A 1UMKA 1PR6A 2C5GA 2IHJA 5DLPA 2W2KA 1ZRNA 3GEBA 4RSMA 3VYVA 1Z29A 4CQLB 2FX2A 5KQRA 4AY5A 4FN4A 1Z83A 1SOAA 2CB0A 3F7MA 3MCWA 4GU5A 2JJ8A 3RKUA 4LGVA 1CQJA 1UC8A 3D3QA 2W2KB 4MRVA 2HQSA 3DXFA 4IDEA 1P6QA 3T12A 1T36B 1EFRD 2BSAA 2XWPA 2P9ZA 2ZRJA 2HUPA 4TTQA 5H3HA 2I3ZA 1GAWA 4L5CA 4LOIA 4G0ZA 1J8YF 4LJ6A 3UZUA 2HBQA 1BEZA 1CQJB 4Y1FA 1H2WA 4MWSA 3V3KA 1S3IA 3M4ZA 4F2PA 3I9V6 4UVIA 4YV1A 3ESRA 2Q4RA 1NJ8A 3PGVA 3SU8A 3UOGA 5IX8A 4TQ9A 5EKDA 1UXJA 1K98A 4QSMA 3VU1A 1ZICA 1OUMA 1W5BA 3F4KA 4IFBA 1J6UA 1W87A 1ZG3A 3R77A 3W5DA 1P1JA 4RD4A 4IF6A 1O08A 3EVGA 4L8VA 4IO1A 1QHHA 2WUWE 4U2FA 3AG6A 3SSAA 2CW5A 1AGXA 1QCDA 2X14A 4WQMA 3ITDA 4MYCA 3VYTB 4ZYUA 3LE8A 5BR1A 1TPYA 2F6RA 1ZIPA 3L82B 4M1WA 1IDOA 3ZC3A 1VOTA 2OCIA 4PX9A 1IULA 1QHHB 4J3NA 2DFNA 2N3ZA 4YJ2A 4BNZA 5K6AC 4AG5A 3STHA 4PG8A 1A2QA 3PFGA 3OIUA 5FAXA 2WHXA 2G28A 3CONA 3F78A 1OWPA 1KOFA 2JJ2D 3BUSA 4PV7A 3UJAA 4GLLA 1EDOA 2NN3C 4YJ2B 3HYTA 3UHFA 3ESYA 4WOCA 3KJIA 4AKEA 1T5IA 4L76A 2G0TA 2AHRA 4JLUA 1EE2A 1V26A 4C88A 5DRYA 4H7HA 4ZZ0A 2EYQA 4RZSA 5F98A 1ZGGA 1R74A 2BONA 3RYIA 5KNDA 2WDPA 3JD0A 5EXXA 2VQ3A 1VFPA 1FFYA 4RF3A 3N8HA 3FWYA 1II8A 2ZKIA 3RS4A 4NPHA 5C31A 3N0WA 4B3BA 1Q84A 2OV1A 1TTTA 5B3JC 4LRTB 1VGRA 2AC2A 3RYIB 4DDMA 2NO4A 2LGJA 3TLGA 4GOJA 2PSDA 5CT8A 1FTYA 3EXG2 3DDCA 1USWA 1ZVKA 4KB5A 5JCJA 3BXZA 1K4MA 4RORA 3ZN2A 1PLLA 4E08A 2A9FA 1NJSA 1SPBS 1I5RA 4I5GA 4ARCA 2HLDA 4V2IA 2P6UA 4KTTE 2IUEA 4RJLA 2ZRLA 1ZD2P 2L2QA 4RA9A 5CVVA 4BVEA 1B00A 2EBUA 4B4VA 4EF5A 3O8LA 3QXHA 4JQZA 1QQAA 1T1SA 3I1JA 2N75A 3LUAA 3L06A 3PI6A 4ARAA 3S6JA 2J9GA 2NNWB 3OPYA 3PIRA 4Z0HO 1EK2A 5JZ9A 1T5DX 1TJNA 1USKA 2IYTA 2IZOA 1JXOA 2PLWA 3COYA 4RJKA 5AUNB 4AO7A 2GFQA 3OVMA 5JPDA 5FI1B 5ALIA 3KLNA 5HE8A 3RAPR 1JKMA 3VU8A 2ISCA 1ZHFA 2AEMA 3OPYB 1UJBA 4FLMA 1X1TA 3MJ4A 5LU8A 3PL1A 4YJ3A 1PT5A 3N2KA 2F90A 5L3VA 1WU8A 2XDWA 3LBHA 3M33A 2ADFA 3ZE6A 2O48X 3ZNQA 4AO6A 1T3GA 2CBXA 4J1TC 3CN7A 4TTTS 1CFJA 1XDGA 2XMZA 3I05A 3P2OA 3VTZA 2FYTA 1HKHA 1P7WA 3N2KB 4LK3A 4YJ3B 2R6CA 2ODTX 3BMQA 1J2YA 5EC8A 1M54A 5FL7A 2F4VB 2JB9A 1E2MA 3JQFC 2JIZD 3AB7A 1X1SA 3EW9A 4JOSA 4KXUA 1PNQA 2WQ6A 2JJMA 1EWYA 1PFWA 1RE0A 2QTLA 5FUWA 3RABA 1PZXA 3BMQB 5DGXA 1SVOA 3RM3A 1C8KA 1F4LA 3V7UA 3NU1A 2RGNA 1XQXA 1YE8A 2Z1NA 4Y2PA 5IMSA 1KDPA 2O2CA 4Q18A 3AIKA 4RL4A 1YMUA 4X65B 3LYHA 1FMCA 3IT0A 3AF6A 3OLQA 1AU9A 4MZXA 3BFXA 4WZBE 2WYHA 5K8LA 2M32A 2B92A 1BW9B 1SCQA 3CIFA 3CN9A 4P93A 3VKFA 2H2IA 4P1ZA 4GX1A 3DT6A 3JW8A 2G25A 3N2IA 5TB5A 4HEHA 3G8CA 3HHEA 1G2OA 3GJXC 3ZPXA 5BSVA 2FR1A 3H6GA 2RKWA 1PW7A 5AQEA 1DBVO 1H8ED 1GL9B 4X5OA 3WLAA 1SA0A 1NBMD 1P45A 1PBTA 2W6JA 3ISTA 3A6PC 3JQ6A 2EDCA 1P2TA 4M76B 3G0GA 5EUCA 4RL6A 4ZT5A 1QWSA 5CA1B 3BCSA 1ILWA 4N3BA 4WE3A 2WF5A 4FMBB 3KZNA 1GP2A 4BNXA 1OBCA 1WXQA 2WIDA 4YRTA 1SA0B 2YRWA 2ECKA 5I9MA 1YVPA 5L9AA 3AVXA 4UHHA 2QJOA 3JQPA 1DIGA 2D3TA 4LV6A 3HYNA 3I1YA 3ETDA 1KJIA 4Q16A 1YB6A 1MRZA 1PJRA 2PKWA 3IPAA 2BN4A 2FPUA 1HFWA 3KAKA 5GIOE 3PLAE 3LHIA 5COBA 1U8EA 2ZTSA 2GRJA 3S99A 4B3SB 1KL7A 3KS9A 3B1KA 3GFTA 3HVKA 4FK8A 4MDEA 2DSNA 4EY6A 3SKVA 3NUZA 1QIHA 1P3JA 4JEIA 2H48A 2UXBB 1B14A 4P82A 1ZNQO 2Q4EA 3AZOA 2PZLA 1J70A 3KQHA 4CODB 4LC0A 1XPJA 3DPIA 4R5HA 4QJ5A 5F4BA 4TS1A 3RIEA 3ZIAD 3I6MA 4B44A 1Z8HA 2F1JA 4LEIA 1SHTX 2DETA 3CYFA 3QV1A 2EGHA 2BF7A 3HRIA 4CUJA 3VR5H 4QAQA 4KQHA 3L4JA 1TO6A 2NTNA 2ZBQA 3HLTA 1QG2A 1B8NA 3LDHA 4G9BA 4GW3A 4OLJA 5AOVA 3TK1A 2OO3A 2DQYA 3N59A 3WOVA 4J91A 3OEWA 3WP0A 1JHDA 2WP0A 4G37A 1Z6XA 2HJGA 4PSAA 4QL3A 1YDGA 3IILA 2CV2A 1PGQA 3EZXA 4Y6QA 1YQUA 3UMGA 3KSAC 4P3PA 3UHJA 1YCHA 2KBEA 1PL0A 4WN9B 1TD1A 2KLBA 5KTTA 2BZGA 1RM4A 3F9IA 3OU7A 4AY6A 4DHWA 1R37A 2YFYA 3NJRA 4UEJA 1QP8A 5KYNA 3C3DA 1TYAE 3DUWA 2OMKA 1FTWA 4G0XA 4J1TA 2FPWA 3C7DB 4PIPA 1SKUA 2A88A 1W52X 2KWIA 1O95D 3DMTC 3LPLA 3VOBA 2QDXA 2GN1A 1KWGA 4EDFA 5IDXA 3UMMA 4RQUA 4NCKA 2PL3A 5AP9A 2XYPA 2YJTD 5ER6A 3RUEA 3PVSA 4WK4B 9ABPA 1TK9A 2RSLA 5CIQA 4AW9A 4HQLA 3FMIA 4M9UA 1U3DA 3CSDA 5DIZA 4U8HA 4LRXA 1WEHA 2XAUA 3SIWA 3U7QA 2J3IA 1HDGO 4LG1A 2VT2A 3KYIB 3A6LA 1FQJA 1VHJA 4GVPA 5E1DA 2AN5A 3QTLA 4GRAA 4HTFA 3TJZA 3HCWA 1R6VA 2EV9A 1MQ8B 1EK1A 5IEJA 4S35A 5FUYA 1XWIA 2UZIR 3CZ4A 1YQDA 4IJMA 1AHNA 4K6OA 2ZROA 1U7DA 4LJAA 2UYHA 3OD5A 1L4YA 1U0GA 1P0MA 2ZFUA 3U4DA 2NTYC 2BY4A 3SEFA 3VU9A 4BNLA 4HTFB 4WCVA 2GKGA 3DOJA 1TW2A 3KSRA 3HXOA 1EUCA 2R7AA 3R3JA 2XNHA 5JQWA 1YUBA 2VZ0A 2QE7D 2G04A 2I4IA 2NNLD 2RAVA 3FPFA 3GRAA 4LXQA 3KTAA 2JD0A 3B38A 4PNHA 2BCEA 4KXYA 1K1EA 5BYKA 3VU9B 4GDMA 1RHKA 3KVYA 1QHSA 2OBFA 3CO0S 4CKBA 1EUCB 4L28A 4CMJA 4XYEA 1Q7RA 3ZXIA 3RT9A 3KTAB 3SHFA 4XVQA 4EB8A 1GL6A 4B6SA 1H85A 3UW1A 4TX1A 4CKBB 4M86A 4ZYLA 1A5BB 1R64A 3HCDA 1SIBE 3W6NA 2QTNA 1JG7A 1OB5A 3I5MA 1GN9A 3K5IA 1GL7A 3LBFA 3MAAC 4LQCA 1K7EB 2FWJA 1QF7A 2GD1O 2XDQA 1A1SA 3ZW7A 4DKJA 5DBHX 5ERYA 1DWQA 2FUKA 3F5MA 3X1WA 1VLVA 1BHO1 5G0UA 4EI2A 5E3IA 2R7LA 4JB3A 3M89A 1N2CE 3KSUA 5LQRA 5HIIA 4M8LA 2X7JA 3PUIA 1M6YA 4PXYA 2HWYA 3BCRA 2BEWA 3B2EA 2XDQB 4KWHA 3GLTA 1EUYA 1D4ZA 3G02A 4PRKA 3IIKA 1O6GA 5IW8A 3L1KA 4IIHA 5BRAA 5H8WA 5FFFA 1QUFA 3LZ6A 4DDTA 2H2WA 2PJZA 3LG2A 3IJEB 2I2DA 3UYKA 2KW5A 4HGYA 1MU0A 2BEWB 4P8RA 1PD0A 2B99A 2WWWA 1UBJS 4LJ5A 4YDSA 4YI5A 3A9RA 5IEBA 4HX9A 3HWRA 5SV2A 1GGFA 4DY6A 1ISIA 1PJTA 1JR3E 3NT5A 4BO2A 3PHBE 4DSNA 4JP2A 3SYLA 4BJ3A 5GTDA 1WBJB 2GEFA 1MB4A 1Z8FA 1F20A 2A9PA 1NJGA 1XALA 3DEKA 3PPYA 5B55A 1JQLB 2YUIA 4O6VA 4ZA2A 2F1HA 5DWQA 1DKQA 3PFWO 3NBXX 2FPMA 2J9XB 4ND5A 4CW7A 2H17A 1KI1A 1HL3A 4X97A 1AG9A 3F73A 4DV6B 4MQBA 1UBHS 4RSGA 2O59A 2NSJA 4MV0A 3G2IA 2FI1A 3IVCA 4LZOA 4XGRA 3OHSX 4GP7A 5JZOA 3HCAA 4RCZA 3TDKA 1I1QB 3D02A 1IJKA 1U3VA 3KT3A 4M1OA 1WTCA 6ADHA 2Q62A 1Y3HA 4QOFA 3K0KA 2LZ0A 3O1LA 1XKXA 2GCNA 3DP9A 1ESEA 1M72A 2FFQA 3PRJA 4WI1A 1EP9A 1UBMS 1XMVA 3KWFA 4C0AC 5I7FA 3CCFA 3K0HA 1GY8A 3R75A 1L7BA 3FW1A 1GSAA 2ID9A 4Y2QA 3CVYA 4ENUA 3UJDA 4E33A 1R9JA 2BGTA 2QRGA 4B6PA 4XVRA 4W5NA 1CS0A 2HZBA 2JLCA 3IXLA 4CXMA 5BMVA 1KSJA 3OCZA