1PUJA

Structure of b. subtilis ylqf gtpase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
261
Chain Sequence
HMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKNKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSGGLINYDKTTEVIIRDIRTEKFGRLSFEQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein ylqF
publication title Structure of the YlqF GTPase from B. subtilis
rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
total genus 94
structure length 261
sequence length 273
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1580.10 Mainly Alpha Orthogonal Bundle Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 1pujA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1pujA01
3KXLA 2IS4A 2IW3A 1ESNA 2DPXA 5TVKA 1P2SA 3THWB 1RRPA 1XD2A 2ZAMA 3PCRB 1QF9A 4KVGA 2XITA 2ZRDA 5CDFE 3BH7A 1YR9A 3I5YA 3W6OA 4OQXA 2QM8A 4LUCA 4AYTA 3CO5A 3LWNA 1E1QA 4JLJA 3LBNA 2ZRLA 3TSWA 1KI3A 2IYWA 2C9CA 4ACAA 3TSZA 3QJYA 2J3EA 2F3TA 5LBIA 3C16C 4ASUD 4MYHA 1TF7A 3QEJA 4HB3A 4B6FA 3A1WA 3ZLJA 1NL3A 2R6CA 1CULC 2VPPA 3BFVA 4Q4JB 2ZJBA 4AURA 3FKQA 3QNUA 4LGMA 2BWJA 2F3RA 5GADl 2NO1A 2PH1A 5J40A 5FTMA 1JB1A 2OCPA 2BKEA 4PAQA 4RD4A 3LXRA 2PZGA 1ANKA 2XNDA 1Z83A 3EAQA 3I32A 2FZ4A 5CIWA 1NVVR 1HT1E 3KB2A 2IX3A 1T6NA 2W2VA 2QQ0A 1BS1A 2ZI7A 3ONWA 5GJBA 2DBYA 4B2PA 4ZCLA 3EPJA 3LFUA 3V4FA 3X2SA 4C0AC 4AC9A 4IFEA 2WWFA 4PSVA 5AUPB 5JEDA 1IY1A 1FP7A 1WMSA 4OJKA 4G5GA 1AK2A 1GL7A 2GEUA 4P4TA 4Q5IA 5FBLB 4A0GA 1Z28A 1LY1A 2KJQA 4LI0A 4IVPA 3OIVA 3DPUA 2CLDX 3K0FB 4V0LA 4P32A 3K09C 1TAGA 1XX6A 2MSEB 1G8HA 2V7QD 3B1XA 3I8XA 3ZJYA 4BFZA 1VCMA 3F3YA 3I72A 4I1VA 4JLVA 2H18A 3WRYC 1ZIPA 2X1VA 2R6DA 3FTQA 1BMFA 4A6XA 3NC1C 2R44A 1L7VC 2QA5A 5H70A 1E9EA 4EPRA 4M1WA 1UADA 1Z6AA 5FPKA 4Q9KA 2OAP1 1UJ2A 4TT3D 3QF7A 4HEJA 1G6HA 3QUSA 3TKLA 3CLVA 1QVRA 4P33A 3SYNA 4EAQA 3KXKA 5FL7A 1KHTA 3BH0A 1N0WA 1WE2A 2A3RA 3KKMA 3BAFA 3PEUA 2FSHA 4V0OA 1TQ6A 2FH5B 3LXXA 4XD7D 2EFEB 1M7HA 2I4IA 4M9QA 3I8SA 3G0HA 5A4JA 1EESA 1A4RA 2QNRA 3B9PA 5H68A 2DR3A 3VNUA 1SXJE 1G18A 1X1RA 4K81B 3RS2A 5J4LA 4DXAA 4A8JC 3ZIAD 3GJ7A 3HU3A 4QHTA 2CEAA 4PO1A 1E6CA 2OG2A 3IIJA 2AN9A 4A2WA 1W47A 3WYFA 4ZIRB 4DLSA 2VSOA 1E9CA 2ZJOA 1JR3E 1KDTA 1NRJB 3HWSA 4ON9A 1E2GA 5FOUA 1OH8A 4U00A 1KJYA 4MRVA 1XTJA 3OE7A 4HAYA 3RABA 1PUJA 2H7VA 4M21A 2BCJQ 3IPXA 4G0NA 2GRJA 3QENA 3QXSA 1O87A 3FVQA 721PA 3H4MA 5EJEA 4PC1A 2IYYA 1YZQA 2YVUA 4BLPA 4CIDA 4QJ3A 4IDHA 1OJLA 4AG6A 2OBMA 3R9WA 4TWZA 2GNOA 4Q9JA 3U44A 4D6PA 3K9HA 1YHNA 1L2TA 5CITA 3LV8A 1W0JA 2YHSA 3A8TA 2QORA 2ZJAA 3ZZ0A 4WAUA 2HT6A 4MYTA 2O8FA 2O52A 1FQJA 4RZUA 4HYYA 3N5CA 5SZHB 5LPNA 2P0EA 3X1YA 4EPYA 1OF1A 3AB3A 3Q8XB 4D0GA 1FZQA 1G3MA 2O8EB 1P61B 1NKSA 2W2TA 3UANA 5AUNB 5BWMA 2BBOA 4HAVA 1VYUA 1GFIA 2ZI3A 2RGCA 4MRNA 4QGGA 2VF8A 1US8A 1YQTA 3EASA 3V00A 3KJEA 5JHHB 4A82A 2XXAA 3UK6A 1U2RA 1VYVA 5GJVC 4E5UA 3SC3A 2Z83A 1KO5A 2EWVA 3TK1A 2R2AA 4XWKA 2VHUA 1G4AE 1OFUX 3FGNA 3M6AA 1KAGA 2NO6A 2WPDA 3DVLA 1U98A 3WY9A 1G8GA 1C9KA 5K8UA 2XZPA 2GZHA 1KMHA 2ZS7A 4RJLA 3O8DA 3OFND 3QOFA 3KKNA 1KZ7B 2RGBA 4NYMQ 4HSEA 1XFAA 4LYHA 2WTUA 4A15A 2WOOA 3WP0A 1MO5A 4TL9A 2ZRAA 1OYYA 4ARZA 4CRWB 3B7GA 1L4YA 2OXRA 1TUEA 2ZSDA 4B44A 1G8PA 1KO7A 1LV7A 4LBVA 4Q7MB 3D31A 5DSZA 1G64A 1CJKC 4J0QA 2ZRKA 5D3MB 1NI3A 4P4SB 4KFTA 1J99A 4R2HA 1G16A 4Q1BA 1SVLA 5BQ5A 1Z47A 2QSYA 1E1QD 3BE4A 1YZNA 4KFSA 5EP3A 1XJQA 2IYQA 2GF9A 1W2HA 1EFHA 2JEOA 1QDEA 2LKDA 2CLCX 2QAGC 1AKEA 1ZC4A 3AKYA 3VX3A 2WJJA 1E0KA 4C0KA 2P5TB 3LX5A 1E0JA 3QKSB 2WSSA 1KNQA 3MCAA 3B1WA 3GLFE 3THXA 3UMFA 1KI9A 5FOVA 3PITA 3BOSA 4ZPXA 1Z6YA 2GJKA 4PSAA 4V02A 3NHBA 2XZOA 2PJRA 2IYRA 3AKDA 1SQ5A 1GL9B 5K8TA 5FPSA 3R9XA 1CR4A 1DAGA 2XNDD 3L43A 4FMCB 2GXQA 1E1RA 3LD9A 4LHYA 1RC8A 2EW1A 3L0IB 1LFDB 5FOWA 3O47A 5L3SB 2GCOB 4JL6A 3FMFA 4OHZA 2Q3MA 3CKLA 1W4CA 4YMUA 1ZCBA 2RHMA 3B8HA 4BPBA 4A92A 1HA3A 1MH1A 1RRCA 1XRJA 2CCJA 2CE7A 1HE1C 1G6OA 3KX2A 4M1MA 3DKVA 4DLZA 2AD5A 2YWFA 2D7DA 4GT1A 4HZIA 2JA1A 4C2TA 1K5GA 2GETA 3HP1A 3KQUA 1EWRA 5BN4A 4DCVA 1NBMA 2AWNA 3QVVA 2VLIA 2DFKB 5DI9A 5BYKA 2RGDA 1GNPA 4EPXA 4YMSA 4NYMR 1G8FA 2C5LA 1C4OA 5EP2A 2CVFA 2Q9CA 2WJIA 5HE8A 4LV8B 3CRQA 4R7ZA 5CIQA 3RSLA 3UG6A 4EFNA 2A5GA 2V54A 1U8AA 4CEIA 1BKDR 1E79A 1W44A 2EVWX 3LLUA 4DSTA 5HKKA 4W5WA 3U7HB 4LBYA 2GHIA 1Q3TA 1W5SA 4UXIA 1FTNA 3RAPR 3DL0A 3A58B 1UFQA 3E2IA 5FUVA 3A4NA 3KKQA 1DAEA 4DB4A 4BEJA 2IXFA 5AJZA 1UKVY 4CT4B 1G5RA 2ZJ2A 4PX9A 1TU4A 1XEXB 3NH9A 5HZKA 3AVXA 2V6IA 1KO8A 3GEIA 5KDOA 2Z4SA 2P2LA 4A2PA 3Q72A 2AXNA 2EFHB 2ODBA 3DOFA 2JAQA 2V8OA 2A5JA 3BWDD 4D26A 1Q1EA 3DZDA 4HLCA 1C1YA 3UKDA 4HB0A 4CEJB 1HT2E 5JFGA 3T35A 3PUWA 1UM8A 1PLLA 2WHXA 2WJYA 4ZI2A 1N5JA 4E22A 4DCNA 1E2PA 2J5XA 3F5FA 2JIZA 3KTAA 1VIAA 3CONA 3CPHA 1EFCA 3FB4A 4TMTA 1IY2A 4JVMA 1PJRA 2PMKA 1NY5A 3O8BA 4RFVA 2EWWA 2B8TA 5LB2A 3WYGA 2ZU0C 1ZUNB 2PJZA 1FUUA 2O0JA 3I62A 1VHTA 2ZROA 3EIQA 4PANA 2WWWA 1OH6A 2IS6A 1VIYA 1OFTA 1AZTA 2LWIA 4DEXA 5IRCD 1NY6A 5HPYB 1W0JD 1WP9A 1NLYA 4UJ5A 5CJ2A 4OHYA 3CIOA 4ILEA 1ZUHA 3C8UA 1AJEA 2HDNB 1W0KD 1OB5A 1OE0A 4FIDA 3R8CA 2FDCA 4Q47A 1Z06A 4GOKA 2QMUA 5AJXA 5IK2A 2O8EA 2OEPA 2VP9A 4KYUA 1F48A 4LHZA 3SJZA 1QHYA 2QUZA 1RYFA 4EIWA 3G82C 5L8VA 5J47A 2F6RA 4F92B 4RFSA 4B76A 3WNDA 1NN5A 2ORWA 4IJMA 3WRXC 3GFOA 3DMDA 4JKYA 3LNCA 1JNYA 3MWJA 1CRQA 4QC2A 5JI2E 1KI7A 4LBWA 1HE8B 2J0QA 4NKRA 4NONA 2OCAA 3FFAA 3Q3JB 5EE0A 2A78A 2X19A 2FEOA 3HYRA 4JLAA 3FE2A 2Q9AA 2QP9X 2R9VA 1E69A 2VO1A 4HAWA 3AP3A 4URWR 2ZIAA 4LBZA 4L15A 4LV5B 2BMJA 1PLKA 2R65A 3KKOA 1K6MA 2EFDB 3OEHA 2YINC 2OO7A 1ZM9A 1WB9A 1TL7C 3SJAA 2YYZA 3MAAC 5FPYA 1A2BA 2OESA 3C15C 1UDWA 1SVMA 5D3MA 4C2UA 4URZR 2FF7A 2QTVB 2WIAA 5HCNA 2HXSA 4BQSA 1N2CE 1OYWA 1DAKA 4IVRA 4A0RA 2ZR7A 1LS1A 2DWPA 3PFIA 5DHFA 1G1MA 2FMXA 1YR6A 2CMKA 4TLBA 3UWOA 2OE2A 3WHLA 1KO4A 2QSZA 4YONB 4B47A 2G1KA 3IHWA 4M1YA 3CF2A 4F4IA 3QKSA 1JR6A 4DC9A 5FPTA 1DEKA 2IHYA 3UMSA 3N2EA 2GJ8A 4JLMA 3EXAA 3IUYA 5CLLA 2QBYB 1LB1B 2NIPA 3TVDA 4TZ6A 2YWEA 1AKYA 1JPJA 2F43A 1CU1A 1KI2A 3SHFA 2ZSEA 1XD2B 4DZZA 5L3QB 2FOLA 5TB5A 3MJRA 5JRZA 4PHGA 1Q0UA 1U99A 1E2HA 3K0SA 2ZS9A 1RFLA 1N6LA 2NZ8A 5FBRB 3IQXA 4JJKA 4CYMA 5J4HA 5JWRA 1VPLA 1COWD 3B60A 4JBXA 4PC7A 1OIWA 5FUYA 1J8YF 3B82A 1G5PA 4Q9HA 3CR7A 4GBMA 3RS5A 3U3MA 4RD1A 2C9YA 3KL4A 4CW7A 2ZRCA 2L0XA 1P6XA 2GBLA 1IXSB 2J0UA 4GOJA 3U7EB 4F91B 5HTKA 3V9PA 4LJYA 3W8RA 3CM0A 4IKEA 3A1UA 2F55A 4BLQA 4TMWA 1NBMD 3BD9A 2B7BA 3VQTA 2IS1A 2C9OA 4B74A 3A1SA 4L4UA 4BLOA 3B5JA 2FGKA 4P0TA 5CDFA 3BFXA 4TMXA 1HTWA 2BM0A 3BB3A 1CR0A 1KK2A 4IOJA 1E79D 3ETLA 3REFA 4B34A 2X2FA 2NZJA 4BLTA 4Q18A 1DAFA 1EX6A 2A7QA 3R8FA 2OHFA 2QZ4A 1P4SA 3QBVA 4HDCA 2WWIA 3FMPB 4I99A 3AUYA 5GJWC 4BE7B 3UMRA 5KYKA 4QM6A 2BBTA 5AK0A 2HCBA 2O8CA 2YWGA 2CE2X 1H8HA 2IS2A 4KVAA 1A82A 1LNZA 3HU1A 2V7QA 1Q57A 1S0UA 2JJ1D 2C95A 4Q4HB 2C04A 1R5OA 5B2ZA 4HAUA 1ZC3A 2BMDA 3QG5A 4QG7A 4US2R 1P3JA 2ZE6A 3QXJA 3WMEA 4HDOB 3M4YA 4KLNA 4KCGA 3W3ZB 4PHHA 4TT3A 3CR8A 4WBSA 3RS3A 5HCIA 1EG7A 1J90A 2LKCA 3TNFA 2ZRBA 3CPJB 3TAHA 1NMXA 2RHDA 1ELOA 1EFRD 4II7A 1T3LA 5JJLA 3CB4A 1F2TA 5CM8B 4XD7A 2AD1A 3EZ9A 4PAMA 1DE0A 5BXQC 4C0JA 2HJGA 3AV0B 1B23P 3DEFA 5LDDC 4M9XA 2TMKA 4BLRA 3F0TA 4OK6A 5G53C 4Y0AA 1E2IA 2CHQA 2CVHA 3NTUA 3GQBA 4TYYA 1PZNA 1QBKC 3JZMA 1Q22A 1VYTA 2PX3A 3K09A 3TMKA 3E70C 2GCPA 4D80A 1M2OB 1Z2AA 2FSIA 3VR1A 2QAJA 5KUTA 2JLVA 4DDWA 1GWNA 3ADCA 4JIMA 4RD3A 1YZKA 4XSHA 2QENA 2GILA 3SFVA 2J45A 3ZVMA 3TW8B 3WBJA 1XMSA 3RANA 1OFHA 2O0KA 1Z3IX 4GZMA 1W4AA 5IK2D 3BS4A 5FR2A 3AVWA 1ZRHA 2V3CC 4UNNA 2FSFA 2IYZA 1E32A 1P73A 4JT4A 3T1QA 4A0HA 5EXPA 4JLOA 5DIFA 1JEEA 1M34E 1R8QA 1SXJA 3GD7A 4MUBA 4AWXA 2W6JD 5G41A 4Q03A 4OHXA 1GNRA 3U44B 1WBDA 3FDIA 1DVRA 4IFBA 4A8JA 1IN5A 3EX7C 1NF3A 1CR2A 3NKVA 4KXFB 4JLPA 4KLZA 2H1LA 4PQFA 2O8FB 1X8LA 3FMIA 1JR3A 3CPEA 5JJKA 2OSBA 1G20E 4Q66C 1NVVQ 4FMDF 1U8ZA 1G5TA 3HYTA 1SZPA 3RLFA 3EC2A 3RRMA 4OI4A 2V55B 4LDJA 1J7KA 3OEHD 3ADBA 3W6PA 2E87A 3LAWA 1IJEA 5CK4A 1W36C 1VDZA 2UKDA 4B75A 3I1FA 4PZYA 4EJSA 4MGZR 3CUEF 1E4YA 1ZMXA 1G8YA 1HQCA 1US8B 2EQBA 5EE1A 2XXAB 8OHMA 3GLGE 1NJGA 4B6EA 1HH4A 2OXCA 2G83A 2WKRA 3IKJA 5EUMA 1X86B 1NVXQ 3T1VA 3X1XA 2ODNA 4XTRA 4D4JA 1MR3F 4DJTA 5CYPA 4GPTA 1XCPA 3KKPA 1DG1G 1T0JB 2CL7X 3OFNA 2GBLC 3IILA 5M04A 2V9PA 4NL4H 1WCV1 4IDNA 2XOKA 5FBVB 2IF0A 1DO2A 1FMJA 2A30A 3OIUA 4KODA 1HY3A 3QBTA 4ARZB 5JLJA 4AYXA 5KU1A 2F7SA 1SVIA 2IYTA 3VKHA 5C1BA 2AL7A 3I4LA 3U2QA 5L3QA 4NU0A 1E2MA 1D6JA 2FG5A 2RGEA 1IM2A 3AF1A 1S1MA 4E07A 2VP6A 3ND8A 1W36D 2ZQ5A 1E98A 1ZU5A 3ZDQA 1P9WA 3GPLA 2FPMA 1OXUA 1D2MA 3PVSA 1VCOA 3BJIC 4FMCF 4BLSA 2WBLC 4FCVA 1P9RA 3KJIA 3L82B 4DCSA 1HEIA 2ZYWX 3VHXA 2ZYUX 5FBQB 2IXGA 3VX4A 2IYLD 2IK8A 1NSFA 3THXB 3LO5A 3QKUA 4DVGA 2UZIR 4G01B 1XTSA 4KV9A 4URUR 4RKEA 5JECA 3AP2A 2F1IA 4NCJA 3CBQA 1OXTA 3EIEA 2IUTA 3C7KA 1SGWA 2BVNA 2R6FA 2QU8A 3K9LA 1KKMA 2ZRMA 4UJ3A 1E9FA 3KQNA 4CZ2A 3IEVA 2WZQA 3GEHA 4IXNA 4LJ7A 4ABYA 4M8NE 4BUJA 1Z0DA 1V43A 2XJ9A 1MABB 3SJBA 1Z63A 3ZD7A 4ACBA 1NN1A 2VF7A 4MDFA 4P3YA 2DYKA 2QAGA 4B35A 1EFUA 1VG8A 3GLFA 1H8HD 1A7JA 2ANCA 3A4LA 3QIAA 3VFDA 3AM1A 3TUJC 1Z29A 4M4SA 3BORA 4Q4HA 4XH9B 4RCYA 1NSTA 5J5CA 1UBCA 5UKDA 3H0KA 2IL1A 4JBWA 2Q21A 4PC6A 2ZANA 1Z8FA 1TX4B 1KSFX 3C5HA 5DISB 3CZQA 5KOYA 4IHQA 1W48A 1P2UA 1VTKA 5FPHA 3KQKA 4D4KA 2ZSFA 3BXZA 1OHHD 1GRRA 4CEIB 2WOJA 4PHTA 4NYJR 1Z6XA 1E2EA 1Z0KA 2FN4A 4BFTA 4DLWA 2GDJA 4B3DA 1ZAKA 4IOKA 4OQFA 4HLDA 1ZUIA 3JZAA 1DG3A 2QQEA 3L8ZA 3Q85A 3TQFA 2J7KA 4LV6A 3SE0A 1FPMA 5JHGB 5DH9A 1ZM4A 4BFUA 3RRZA 1SXJC 1CLUA 5KNBA 1LVGA 4Y0VA 5CM9C 3RS0A 5ELXA 2O8BA 2ZSBA 1KTVA 5EXXA 5BN5A 2LCFA 1D9XA 2ZE7A 3SU8A 2HCJB 3BRWD 4JYBA 4NZYA 1OB2A 2CK3A 2IUUA 4B3CA 4EFLA 4TYPA 1RE0A 3MGCA 4W7SA 4A9AA 3P1JA 4WOPA 3U61B 1Z22A 5E7MA 3SBDA 1PVOA 4Q1EA 1XXHE 4MH0R 4V0ME 5D3QA 4QM7A 4MQBA 4Q1FA 2FGJA 4YQFA 5AJWA 3KUCA 2WJVA 4XJXA 4DKXA 3EWAA 1R5NA 1JPNA 2VHTA 3KTAB 2ASEA 1HV8A 4JVLA 4WVFA 1RRFA 4EJSC 4X8MA 4G5QA 1VG1A 4Q7JB 2V4ZA 5KPDA 2G88A 4IDQA 1GRNA 3E5HA 4WIAA 4NCIA 4C4PA 3VR4A 3Q7PA 1SXJD 3BK7A 3OAAD 2HYIC 3QPVA 821PA 4UQOA 5TMPA 4JJZA 3QSYA 3P26A 3CZPA 1G17A 1Y63A 2PX0A 4LPSA 4OI0A 4OK5A 3K0AA 1N6NA 4DIEA 3U6BA 3CX6A 4BFSA 1BH2A 3MLEA 3O8RA 1JR3D 4ESVA 1OV4A 4POAA 1OSNA 1W0KA 4YDSA 2GJAA 4OYHA 3H84A 4BFVA 1T5IA 5KPJA 3LW8A 5FUWA 4PC3A 2ZEJA 4QKQA 1DARA 1UBFA 4Q1AA 4GSYA 2BBWA 2FPLA 1LTQA 3CRVA 4RFSB 1IN4A 3KFVA 4MKGA 4A0FA 3Q5EA 4M1OA 2BJVA 4HLQB 4TLDA 3IO3A 5EE5B 3WMGA 1UBGA 4B71A 5AWFC 2DFTA 3VKWA 3W9YA 3A4MA 4QJ5A 3SI7A 1GP2A 2F1HA 3CF6R 3JVVA 3MWKA 4FMDB 2YNMA 5J4VA 1LW7A 4I1OA 3NWJA 1FW6A 2ZJZA 4YLGA 5FOXA 3SR0A 2PCLA 2X77A 3DKPA 3SDZA 1UEIA 2A2ZA 1E9DA 3C5CA 2PLFA 3RWMB 2ZRJA 3KQLA 4LJ9A 2ATVA 2XOKD 4R2IA 3GP8A 3WNBA 3FFBA 4PR0A 4C30A 4OL0A 1M74A 1E0AA 4N3NA 2JATA 3QKRA 3U3RA 3U7FB 1P9NA 1G3UA 3QQ5A 5GVSA 2QTFA 1ZNYA 2GK7A 2ZREA 2B21A 2ZJYA 3FMOB 3IHLA 3KZ1E 3U7GA 3WBKA 5F9HA 1XEFA 1VG0B 1IN7A 1Z0FA 3A36A 2ZJ8A 3U6KA 2FFHA 4IVQA 1SHKA 4IOLA 4AD8A 4G5RA 1EFTA 2IC5A 2Q0HA 3EG5A 4A2QA 4A4DA 4PC2A 3TR0A 5AR1A 1JXOA 2CHGA 4GI7A 5JCPA 1EGAA 4FW9A 4BZQA 2Z0MA 3EPHA 1XB2A 4NHOA 1NVWQ 2ZI4A 3NBFA 1E2KA 1OXVA 3IDQA 3SZRA 4URVR 4W9MC 3LQQA 4TSFD 4XWOA 2EFCB 3K0CC 4DWJA 1GKYA 3D8BA 4PAOA 4OI1A 2ERYA 4MGYR 2F43B 5DO9A 1X8KA 2FPKA 1ZCAA 3TW4A 1IXZA 2CBZA 2F9MA 1R10A 4LJAA 3CX7A 5TXGA 4AKEA 1W36B 1UBEA 1KGDA 2W2XA 1RYHA 3HDTA 1ZD8A 5FOSA 3ADDA 2VHQA 4LK2A 1TF5A 3SQWA 5E3HA 4KYIB 4LC1A 1COWA 2RGNA 1YZLA 4ZDIA 2ZUCA 3LDAA 3VNVA 4MITA 1Z0AA 4L9WA 1MABA 5JS7A 4HB4A 1FUKA 3QXHA 1QHHB 3W6NA 5SZIA 4BWYA 1Q44A 5KSOA 1JBKA 2J0UB 2F1JA 1RPZA 3TVTA 2G6BA 4RZXA 4V03A 2NMVA 5LD2B 1XU4A 1UKYA 1GVNB 2GAOA 4GL2A 3VU9B 1JQJC 1RVDA 3DZ8A 2C2HA 4JLKA 4GFDA 4C7OB 1N5KA 1DPFA 2VL7A 1BO6A 1WDTA 4PQRA 1XWIA 2HV8A 3CNNA 1DADA 1X8JA 2Q3HA 3ZH9B 1LF5A 2AFHE 5JMTA 4TYQA 4E03A 3CWZA 2GEVA 2CDNA 3OIWA 5KSPA 3RC8A 2GK6A 1JQLB 2VHJA 3S1AB 4C0SA 3A6PC 2MMCA 4YMTA 2CL0X 2O8CB 2QI9C 2J46A 4M9SA 4H1UA 5HZHA 4N0DA 4NP6A 1AS0A 1EK0A 4TYNA 2JJ1A 4FCTA 2REOA 3B2EA 4RD0A 3AVVA 1W5TA 4O3MA 1CXZA 1G3QA 4LC0A 4LYJA 1T8TA 2CK3D 3SFZA 1CJVC 4MRPA 2XZLA 3PENA 4TL8A 5K8LA 3T12A 4GDFA 4QL3A 1SVOA 4NYIR 4R71A 4B3GA 5H1YA 2P3SA 3AUXA 5FUXA 1EFRA 3NBXX 2FNAA 4F93B 1F5NA 1F2TB 1ETUA 1XEWY 4B2LA 1YU9A 4RZ2A 2P5SA 5EUQB 4D2IA 221PA 2EFGA 4HLUC 4N1AA 5DI3A 2XB4A 4HAXA 1M6NA 3KJHA 2QP3A 2O8DB 2VP0A 3RS7A 1TQ2A 2FZLA 1Z0JA 4QBHA 4RVCA 3FHCB 2WWXA 3NIBA 4LHWA 1JALA 1I4DD 1BOFA 4DBLC 1IN6A 1JECA 1GUAA 1KNXA 2GZAA 2N46A 3PEVA 3R9IA 2BEJA 4TYWA 2VHCA 1KSJA 3P32A 2OLKA 1E94E 1HUQA 3EA5A 4MKHA 4MGIR 2E1RA 3QPWA 1SVWA 2VSXA 2VP4A 2WIBA 1BYUA 4K46A 1FNMA 1DAHA 2KWIA 3N2IA 3EC1A 4IW3B 5JZVA 1WA5A 3GLIE 3EPKA 5JEEA 1N6OA 1GKUB 1D2NA 5KSYA 4MYUA 3SS8A 1G291 3W5JA 1KI4A 5KNDA 2IXEA 2PCJA 1TQDA 1W1WA 1J2JA 3H1TA 4FN5A 1SXJB 2W6JA 4AK9A 2IA5A 3WXMA 4ZO4A 2QG6A 4Q1DA 3CH5A 4B48A 3KQHA 2FFBA 1T3HA 4A8JB 3SQXA 2ZRIA 4Q19A 4HATA 1FTSA 4C0BA 1G7CA 3UATA 4AKHA 2ZI9A 4CEHB 2CNWD 1GOTA 1YRAA 1DTSA 1L4UA 2A5FA 1GM5A 2W58A 3TR5A 4NH0A 3CH4B 1N0VC 1S1CA 5E7JA 3QG1A 3KUDA 2B7CA 1NJFA 2KSQA 2ONKA 2QPTA 2C77A 1Y3AA 4RZ3A 3PUZA 2CCGA 1KO1A 1U9IC 4Z8YA 1W46A 1TTTA 5TY0A 4EJSB 1DO0A 4IDPA 4M9ZA 4QFMA 4C0LA 3MUFA 1B0UA 4S2EA 1CF4A 4HAZA 1XZPA 1XJCA 3GMTA 4QGAA 1XNJA 2CCKA 2RGNC 1A2KC 2YWHA 4DDUA 5KNCA 1NN0A 4TL6A 2MMGA 2YZ2A 4A6PA 2ZITA 4GP7A 5SZKB 1T9HA 2G3YA 1YR7A 5FTNA 1W7AA 1IXRC 1MT0A 4EPTA 4DSUA 4CF7A 4A1FA 5L3VA 5F9FA 3RNLA 2VP2A 3GJ8A 1G7SA 2FFAA 2R6AA 4K8OA 1ODFA 1FOEB 1P7CA 3TAUA 3BH6A 1CIPA 3Q5DA 4Q4AA 3ZQ6A 4GZLA 4Z1MD 3IBYA 1SKQA 3UWKA 1ZD9A 1CTQA 3VR2A 3BB4A 4ESHA 1XBTA 2G0NA 1T0HB 1XMVA 2ZETA 4DRZA 5FTLA 2OFXA 1E9SA 2N1BA 1RRGA 121PA 2GESA 2JDID 4HZUB 4L8GA 3RS4A 2JLRA 1ZM7A 5DE3A 3P27A 2X2EA 4EPWA 3GLGA 4WA7A 2IT1A 4QRHA 1HQYE 1O3YA 1V5WA 2AK2A 4XVUA 3QF4B 1ZIOA 1G7RA 3X1WA 4PQYA 3DMNA 4JVNA 2H5EA 1QHHA 5JI3E 4LSGA 1K5DA 3ZVRA 4D81A 4DDTA 3ICEA 2VH5R 1SKYE 1II8A 2IUSA 1R4AA 3L2OB 1QHGA 2N42A 1S8FA 3PR1A 3VU9A 3ZZTA 2RKOA 1ONBA 2H16A 4C7OA 2F1RA 4JBYA 2V6JA 4TL7A 1IAQA 1YR8A 1OIVA 2P65A 2D06A 4ZDKA 5C2JB 2FV8A 2C99A 3IIMA 4JLNA 4KHZA 2VBCA 2ZE8A 3ASYA 3WP1B 5CB8A 1R7RA 2WWGA 2IWRA 2JLYA 3AF3A 2P67A 1S2MA 3S1AA 3VHLB 4OQNA 2WWYA 1TQ4A 1GDDA 2QGNA 5CB6A 2QAGB 1S3GA 3LBIA 4UKDA 3REGA 1VCNA 4TQAA 1M1YE 1GTVA 1NVUQ 1KKLA 5C46F 2IYUA 1II0A 1NMZA 3GLFB 4ZKEA 1ZU4A 2NO0A 3VR3A 3B1VA 3BBPA 1FP6A 5DHAA 3U3KA 5EP1A 3IIKA 1JAIA 4QGHA 2ZRHA 4JSTA 5L3RA 1KI1A 1M8PA 2J87A 3LY5A 4D25A 1NLFA 2EYUA 1R5BA 1KMQA 1MRNA 1R0YA 2ZU6A 1N3BA 5FR1A 1CBUA 1OKKD 1OHHA 521PA 4US1R 5EP4A 2BOVA 2Z6VA 2OUKA 2WV9A 2OLJA 2QL6A 5ANRB 1CJUC 1ZNWA 3V4RA 1ZYUA 5F3WB 4UXHA 3UPUA 1TEVA 4E09A 3BB1A 2O8BB 2O8DA 4DSNA 2C96A 4PPFA 2WAYA 2PLRA 4UXJA 5DN6D 3A37A 4NCNA 4FWIB 1FFHA 4DCUA 4RCZA 2GVZC 4Q21A 1UDXA 3DDCA 1A5TA 4D0LB 5E7IA 2B6HA 1E4VA 4IOMA 4TTQA 2W6IA 1NLZA 4D4LA 4LYAA 3P4XA 3EPLA 2CL6X 2IYSA 1Z07A 2NGRA 3DM5A 3EIHA 3WNCA 4Q7LA 1SVKA 3KXIA 5JS8A 4G5SA 4CVNA 1Z2CA 4CT5A 2W83A 3TRFA 3EW9A 4OBEA 3HR8A 1Z6GA 2ERXA 3I73A 3W8NA 4DT1A 4AI6A 1KOFA 1N6PA 3W3AA 2GVDC 3QE0A 2G1JA 3OAAA 4S35A 1P62B 1BYIA 4ZDJA 1NNEA 1EWQA 2RGXA 5DLQC 4JLDA 3NEYA 4D0NA 2XSZA 1JI0A 5GVRA 2PT5A 2XTZA 4QNMA 3K0AB 4D82A 4CEHA 1Q21A 1XXHA 4V0MA 5FBWB 1KDOA 4M53A 5A0FA 2J59A 4AYWA 1IY0A 2CJWA 3TUZC 2QY9A 4BZXA 2AWOA 2QPAA 1AS2A 3N70A 2OILA 1KK1A 4HB2A 4TTRA 5FL3A 1VCIA 2VSFA 1QVAA 4MDEA 2FJUA 4FINA 4JS0A 4LHXA 1P2VA 4H9GA 3TUIC 4BRWA 3IGFA 5EE9A 4Q00A 1OT3A 2AXPA 4BZPA 1G3IA 1XEWX 3AVQA 3AP1A 4DLUA 4R9UC 3R7WB 4HDQB 1Q1ZA 4QBIA 4XIGS 3L0SA 2YKGA 5JJIA 4DLVA 4GOXA 4QGFA 4TLAA 3KDSE 2YC4C 2OFOA 4EKDA 1KI6A 4DUGA 3RWOA 3GJ4A 1I4TD 3W5IA 2FA9A 2GXUA 2NTYC 3GEEA 1IBRA 4BFWA 2EU8A 3LH5A 3GLHE 3RC3A 1XPUA 5GJCA 4DSOA 1X1SA 2YOHA 5CYOA 1S3SA 3LRPA 3W90A 4V0KA 2PEYA 3QKRB 4NYJQ 2ZYVX 1ZINA 4ITRC 3GLIB 3GJ5A 3R20A 4JSYA 3RRYA 1KZGB 2I3BA 2ZAOA 3RRNA 4OHVA 2VTKA 4HZUA 2JJ8A 1PV4A 1JJ7A 4BFYA 4TTPA 4AIIA 3CNLA 3ZVLA 3WYAA 2GF0A 3CNOA 1AN0A 1AZSC 1ZM2A 2PZEA 4XVRA 3SBEA 5K8IA 2J7PD 1EX7A 1G9XA 1AA9A 1XDBA 3QF4A 1NN3A 4O2LA 5JSZB 1E2NA 4QHYA 5FI1B 1GKIA 4MRSA 4TSFA 3ZQJA 1SHZA 2EYQA 1CKEA 1KI8A 2JLQA 2JLXA 3PUYA 3PJRA 2QM7A 4QXAA 1JEDA 1ZNZA 2QMOA 4WXRA 3NDBB 1QRAA 2ZE5A 2NG1A 4O2RA 4O25A 4M1TA 3THYA 1OH7A 2BV3A 2D2FA 3AVTA 2HLDD 3LVRE 3IEUA 1YKSA 2BKUA 4DCTA 3AVOA 3MJHA 3D6TB 3I61A 5B64A 3GCGA 4YMWA 4NCKA 3EZ2A 5CJPA 3QKTA 4FMBB 3ZYCA 5EZ5A 2GKSA 2K5UA 2WJHA 3T34A 4DHEA 1S96A 1EXMA 3AF4A 3ECCA 3NXSA 1Q1QA 4IRUB 1QHXA 2PZFA 3K0CA 1ZP6A 4M22A 3MWLA 5E4FA 1XPOA 1F3OA 1I2DA 2DHRA 5KDLA 1GAJA 3CRW1 4JYCA 2Q9BA 3HJNA 2ZR9A 2ZTSA 3AKEA 2GWHA 4NPHA 1XJ0A 2XTMA 2UZ3A 4L9SA 2VA8A 1E9BA 3NG1A 4JVSB 2BJWA 4HUTA 2GJSA 4NE2A 2WJGA 3KB1A 4ZCMA 2CHVA 5CK5A 1XP8A 4BEBA 1U81A 1NG1A 2AFIE 3U5ZB 1SKYB 2RB4A 1KIMA 3NHAA 4WZAE 1XD9A 4KSCA 1W49A 1N6RA 3IO5A 1VHLA 3U3OA 3U4QA 3I5XA 2HF8A 2JJ2D 2BM1A 3HPQA 1NP6A 1W4BA 4AY2A 4WW0A 2ODWA 4RY2A 2WMNB 4BFXA 2YV5A 4MA4A 1NKTA 2W6ID 1UEJA 4BGDA 1N25A 2J41A 1N5IA 4ZKDA 4M2LA 4RKFA 1ZVQA 2D74A 3ZD6A 4F4JA 4Z54A 1VKJA 4JMPA 1QHNA 2ANBA 3VR6A 5DI3B 1QHSA 2IEZA 2R62A 4H1VA 2ZS8A 3QVUA 3LQRA 4JZKA 3CRMA 4CGZA 4D4MA 2KI5A 2ZRGA 3HR7A 3EARA 4PZZA 5FTKA 4YC7A 1QHIA 2AK3A 2OCYC 2W0SA 4X8HA 1CEEA 2KE5A 5AUQA 4Q02A 4FI3C 4X8LA 5C18A 2ZPTX 2BEKA 1G21E 1UKZA 2XSZD 4NMMA 4DDVA 2QGZA 1H8EA 5FTJA 1D9ZA 3TSOA 3J81k 3WHKA 3FHOA 3QI2A 4TLEA 1KYIA 3ZS9A 4B2IA 5IHPA 5DYIA 2QN6A 5A5GA 2I1VB 2IYXA 2QEQA 1FQKA 3NH6A 1XTIA 2CLSA 2DWQA 5E95A 2DB3A 2HJVA 2B92A 2Z4RA 2PT7A 3GJXC 1YE8A 2REXB 4ERNA 1KK3A 2D7CA 3I3SR 4HLUA 3OF5A 1KSGA 4RD6A 2JASA 2YC2C 2XX3A 3R7WA 1G3RA 1XF9A 4Z51A 4GMXA 1RKBA 1TEXA 2P6UA 3NDPA 4TN1A 4YDHB 3RSOA 1GILA 2Z5FA 3E1SA 5HE9A 2ZXUA 4YXWA 2C8VA 1P72A 4DUGD 3T1OA 3TQCA 2CNWA 1TNDA 5B57C 4LWZA 4LJ8A 2IWHA 4URYR 1W4RA 1LF0A 1AIPA 2W0MA 4M1KA 5IF9A 2REBA 3M0EA 2KBEA 1GRQA 1ZD1A 1FX0B 2BBSA 3T61A 2C98A 5HR5A 3OZXA 3B9QA 3OIYA 1TPZA 2XTNA 1JAHA 3D3QA 4OKSA 2BDTA 2ODEA 1E2DA 4EQ6A 3GLIA 4L16A 3M1IA 2XAUA 3VAAA 1XPRA 4LPKA 3GJ6A 4B3XA 2DFLA 2ECKA 3IQWA 1PUIA 3GJ0A 4NBSA 2GAAA 4OHWA 1KSHA 4ZI3A 4HUQA 4G1UC 2MSDB 2GA8A 1Z0IA 1Z5ZA 3IBGA 3SNHA 3TJZA 1LS6A 3QXXA 1N6HA 3OESA 5KO2A 2RCNA 1T5LA 4R98A 5TARA 4AKIA 5JSZA 1G7TA 4XVQA 2QE7A 2ONJA 2AR7A 4IEEA 2G77B 1WQ1R 1DELA 3P4YA 4KFRA 1NIPA 4P31A 5AJYA 3THWA 3T1TA 2ATXA 3PUVA 4Q4AB 4Z1MA 2XB2A 3MD0A 2WSMA 4NYIQ 3AF2A 2AKAB 2WKQA 4QJ4A 1N0UA 621PA 4RSGA 4RD2A 4F7WA 2JLWA 2Q6TA 1U9IA 2ORIA 3T06B 3SYLA 4TMZA 2JDIA 4C0QC 2ZRNA 3B1YA 1XCGB 1CRPA 1AM4D 4PSKA 4LJ5A 2WWHA 4B3FX 3GLGB 1QG2A 4TMVA 5LB4A 1CS4C 1T3SA 4Q4JA 2ZRFA 2B8WA 4F38A 4C3ZA 1E2JA 4B33A 3AVUA 4GMDA 3GLHB 2GJ9A 2NQ2C 4QBGB 4Q9IA 5TDHA 3THOA 3CF0A 4JT2A 3U3JA 2J0VA 2ORVA 3QXCA 1XTKA 1U0LA 2Q3FA 4LRWA 5G3YA 1E96A 1II8B 4G3XA 1U0HC 5JCZA 2WICA 5FOTA 4PXAA 2H92A 3EA0A 2GEDA 1PLJA 2ZVPX 4DLTA 4TLCA 2ZI6A 1II9A 1N5LA 1RIFA 5EZ6B 1P5ZB 3C4JA 1M7GA 2O0HA 4ZDWA 2D3WA 1HURA 5KHOC 3NBZC 4Q1CA 3AVYA 4OJQA 4LJ6A 1E9AA 4LYFA 4WZBE 3DO6A 5B30A 3K0FA 2DY1A 2WVJA 2DWOA 2VP5A 1AGPA 3LA6A 4TQ9A 1KY2A 2D2EA 2RGGA 1MV5A 3FKSA 1HYQA 2IYVA 2X8AA 4WXPA 2IBMA 1D2EA 1BMFD 1WRBA 2YJTD 2IEYA 3BC1A 5C4MA 1SULA 2E9SA 3T5DA 1U8YA 2QMHA 1H65A 1OXXK 1XMJA 3CX8A 3K70C 3RYTC 1F2UB 1OKKA 1E99A 1GIAA 1R2QA 1KJZA 4UNSA 5BN3A 5FL7D 3PIRA 3WMFA 2BHRA 3EWSA 4NCHA 4BASA 1WBBA 1S9DA 2AKYA 4KO8A 2AHOA 5F98A 3LW7A 4TQUS 1VG9B 1S9HA 3HU2A 1MKYA 3EZ6A 1D8TA 4DLRA 5CLQA 3UXMA 3QEOA 3ICQB 5J4KA 4QOSA 3ZVNA 5H8WA 2ZM5A 1KAOA 1RW4A 2FFQA 1MO6A 2QMEA 3PUXA 1A1VA 5DN6A 1M7BA 4ZIRA 1VMAA 2ZUDA 4G5OA 3K1JA 3PEYA 3A1TA 3B13B 4Q9LA 4MRRA 4B3BA 3F8TA 1ZBDA 2HXYA 1IN8A 1SVSA 4PZLA 3FYHA 4Z8XA 3UG7A 1E3MA 1R0WA 3PG5A 3K70D 3B6EA 3BIFA 3CRRA 1H8ED 3OE7D 3Q7QA 1P2TA 2CXXA 5DGXA 5DNYB 4LY6A 2R6GA 4BECA 4EPVA 5FI0B 5AJVB 2OBNA 421PA 1UAAA 5C4GB 4DT1B 1OFIA 4LJ4A 1XZQA 1J8MF 4MGKR 2JLUA 1E9RA 2ZRPA 2HF9A 2QTHA 4OK3A 2G0TA 1J70A 1L8QA 2YOGA 2D62A 3TLXA 2DCUA 1OLOA 1CJTC 4M0LA 1R6BX 4MKIA 3BGWA 4QBFA 4DLYA 3PEWA 2P6RA 4YXWD 4FWTA 1RZ3A 3OEEA 5P21A 1XXHB 3ZS8A 3TGPA 1XCMA 2CJWB 4KBFA 1AQUA 5JWOA 1DOAA 5AUOB 2QROA 2QPOA 4KAXA 1T4GA 4JLBA 1FX0A 4PPQA 3SJCA 2F9LA 2OM2A 3RHFA 2ZJ5A 2D4HA 4PTLA 4UNQA 2JCSA 3GFPA 1QZXA 4B32A 4PFSA 3MMPA 4I4LA 4JL5A 4Q48A 1TF2A 3SOPA 2C03A 1RJ9B 3PXGA 3SHWA 3KFXA 1XTQA 2QRNA 2A5DA 1UPTA 2DFNA 1IJFA 5KDDA 2FSGA 2WPDD 1KI6B 1K8RA 5F2EA 4FCWA 1G19A 4C0HA 5EXTA 4M1SA 2PL3A 1G4UR 3DM9B 3LVQE 3L8YA 1ESMA 4FXPA 2XJ4A 4Q01A 3O8CA 2QE7D 2J9RA 2ZUBA 3LX8A 3NVAA 3AGPA 2OV2A 3BERA 4PO8A 5FFMA 1WF3A 3AKCA 4IDOA 4N0EA 4P4SA 5JBQA 4KJZA 3KJGA 2Z43A 1Q20A 4JKIA 1N6IA 3UIEA 2QT0A 1YZGA 1FMLA 2RH5A 3VR5A 2PBRA 3B85A 5TV2A 2G9NA 2VRWA 3L0OA 4PO9A 5FH9A 4KSBA 1YVDA 2J7PA 2J1LA 3MRSA 5BYJA 1NMYA 1CP2A 1TADA 1D5CA 2NOAA 2WAXA 2WSSD 5EQTA 3T5GA 4MYCA 3D7MA 3QPUA 4TMKA 1N6KA 2PMDA 1NBME 3GLHA 4AG5A 2H57A 2Y8EA 4U5XA 5IDVA 5IT5A 2R8RA 3NBYC 2MSCB 4LOAA 1UF9A 2KB0A 3SN6A 1E1RD 1AGRA 5L3SA 1MO4A 2XNSA 2GCOA 2YOFA 3K53A 4KI0A 3SEAA 5G3ZA 4LHVA 1E2LA 4W5HA 1CR1A 4XOIA 4DLXA 1TMKA 3ASZA 4PHFA 3THYB 2RMKA 4ASUA 2HLDA 1GZSA 4KFUA 2JLZA 2XGJA 3BFKA 1ZW6A 4X8OA 1FNNA 4DIDA 4JL8A 1ZNXA 5SZJA 4A36A 2OCBA 2NPIA 2FU5C 2ZSAA 3TE6A 4XWAA 4NDZA 4UNRA 1ZM3A 2VIIA 3FKSD 2V1XA 2W00A 1OIXA 1JJVA 2HEIA 4I1SA 4ZV4A 4L5BA 2GZDA 5KTYA 1I4LD 1GNQA 3FPAA 1Z6TA 1YRBA 3AVPA 3B1ZA 1BIFA 2KBFA 3PQCA 5HKKD 4B43A 1F2UA 1KJWA 2BCGY 1AQYA 1KK0A 1YZTA 3I92A 1AS3A 4LZZA 3X1DA 1GG2A 2OFWA 2J0SA 1MOZA 1DBSA 4PPGA 3MWYW 2C78A 1P75A 2FE4A 2FWRA 2PEZA 2VEDA 5EXSA 1NIJA 5BW8A 4DB2A 1TU3A 2QT1A 3K9NA 3LBHA 2HYDA 3C41J 1XEXA 3DOEA 2WM9B 3H86A 3AQ4A 3AGQA 4GP6A 3AF0A 1YJ5A 4MUAA 1E2QA 1NG9A 4NTZA 4URXR 3L0PA 4UNPA 3W34A 4CDGA 1F60A 4WZ6A 2OBLA 1P60A 2GCNA 4HI0E 2SHKA 3CWQA 4CEJA 1T8UA 1E2FA 2H17A 2IHBA 1R8SA 2JJ2A 5G40A 3U4QB 4V0NA 1Z08A 2VYFA 2O5VA 4IEIA 3RDPA 4QHSA 2FX3A 1I2MA 4Q4LA 2OZEA 3IPYA 1W2GA 1TUIA 2GTPA 4GNKA 3A1VA 3VMFA 2JIZD 1IHUA 1Q1BA 1KDPA 1YZUA 3TH5A 1OH5A 3T15A 4EUNA 2OAQ1 3ZIAA 2IF2A 3X1ZA 1U90A 4ZCIA 1CJMA 3ZGXA 4KITB 5JRJA 3PV0A 3CW2A 3FOZA 4Q7KA 2NPFA 2VQSA 2ZVQX 1Q12A 4F4CA 1XMIA 2ZI5A 4OQLA 4DEYA 4US0R 4I81A 4W5JA 2ZYTX 3AH8A 3G5UA 3ND9A 1XD8A 1KY3A 4FD2A 4OQMA 1OW3B 4PPNA 1F6BA 3ADKA 2ZR0A 3VTKA 3K70B 1Q3HA 2OT3B 2WKPA 3OEED 2GXSA 4EDHA 2A9KA 1S4QA 3AEZA 4O0MA 3ZZUA 5J4YA 1IONA 1JXMA 3Q9LA 6Q21A 3K9GA 4QNRA 5EE3A 4TZ0A 2JLSA 2A5YB 4LCBA 3OHMA 3EZ7A 1R0ZA 3FWYA 1DS6A 2QP4A 3SYKA 2GXAA 2FEMA 4BRUA 1RJ9A 3MG9A 4P4UA 3GFTA 2BMFA 3K8YA 2HT1A 1MO3A 3DHWC 4LX0A 2XEXA 2BMEA 1U94A 4KBGA 4KU4A 1KDRA 2H8KA 4B73A 2AX4A 5JWHA 3GJ3A 1GSIA 3NC0C 1T91A 4EFMA 5B58C 1GL6A 1WXQA 1OXSC 1E0SA 1XTRA 3HPRA 3JVUA 4GRAA 3VKGA 1X3SA 3EZFA 3NEJA 1X6VA 4AKGA 1U0JA 1IOZA 5KSZA 3TIFA 2BC9A 2NO7A 1DAMA 4EQ6B 2JGNA 1VECA 1IQPA 2BIFA 2P6NA 3P20A 4U02A 3C14C 3TBKA 4XSGA 1FL9A 3B78A 3LLMA 3FHTA 1ZJ6A 2V1UA 1GITA 3U60B 4HUQB 4I1UA 4YMVA 3K0EA 1KMHB 4MKFA 4C9BA 2I1QA 5DYGA 1G41A 3MFYA 3H2YA 4XTCS 2UVQA 2RAPA 4U7DA 4OI2A 1R0XA 1OPXA 1QG4A 3MSXA 1UKEA 5LD2C 2NO9A 3QY0A 3RVBA 2WMOB 1DAIA 2HUPA 2RGAA 2QBYA 2QRZA 4IXMA 1MRSA
chains in the Genus database with same CATH superfamily
1U1GA 3WLQA 1ESNA 2H1IA 4YAOA 1QH8B 3NR2A 4LXUA 4R1QA 1SBIA 1XD2A 4W82A 1T8SA 3H8JA 3WGQA 1IHPA 1Z82A 1GPUA 3LT4A 3TTTA 2H9IA 2ZRDA 4H3VA 4EDFA 5FDFA 5JQGF 1BAPA 1K98A 1NBEA 1ORHA 1YZYA 4QPZA 4B6QA 1TGVA 5AFSA 3LWNA 2VNIA 1YBHA 4DCJA 1SC4A 3DHNA 2P9JA 5IDYA 2C9CA 4ACAA 2EKPA 1WB4A 2XE6A 1UOEA 5HRUA 2F3TA 2GD2A 3C16C 1IK4A 5CHYA 2ID7A 1HQKA 7GPBA 3ZLJA 3A1WA 2QVZX 2I6UA 2VPPA 4HVAA 5CX4A 3BFVA 2XMZA 1NJSA 4FYYA 1Z73A 4GAEA 2VF2A 1E6LA 1DEXA 2XGSA 3O8NA 3QNUA 4LGMA 1P1HA 2BWJA 5GADl 2NO1A 1WR8A 5J40A 4ZVTA 1NQXA 1OXKB 3O0DA 4RD4A 3FMGA 3LXRA 2ES4A 1Z83A 2IDMA 1DI0A 2ADMA 4N8DA 3C3YA 2FZ4A 2IEAA 2ZBGA 3FUTA 4X00A 1NVVR 2ODQA 1ZH2A 3RV3A 5EHIA 2IX3A 2C1ZA 2D5AA 2W2VA 2QQ0A 1BS1A 1W5AA 3ONWA 3P9PA 1QHEA 2LNDA 1QO7A 3V4FA 1EP9A 1MV8A 1Y3HA 2DUJA 2O4UX 1EWTA 3PC7A 4IFEA 2WWFA 5C53B 2FB9A 4NPAA 5CBPB 4KPYA 1MEEA 2VUUA 1KYXA 4EMUA 2GCEA 1Y1SA 4P4TA 2ZXFA 4PCVA 2PNJA 4BAUA 1SCUB 1BXGA 4IVPA 1T9CA 1FXUA 4N7BA 1MF7A 1XZDA 1SFRA 5LMNB 3VDQA 2YXPX 4BFZA 5GWXA 4EM6A 3OFJA 3OPYB 1VCMA 1QRRA 1X8XA 1Z13A 2VR1A 1S8NA 4JLVA 4MP8A 1RZRD 1JQ5A 1BMFA 2Q2NA 4C5BA 1E9EA 4EPRA 4M1WA 4JJ7A 4DILA 5FPKA 2UVDA 1YQUA 2OAP1 1UJ2A 1JJBA 1G6HA 3JWJA 5AKGA 1UKBA 3SYNA 2P2NA 3ZV6A 2HSJA 3L6DA 1NZDA 3RQSA 3AR7A 3ZY2A 2JC3A 4ECEA 3ORQA 2DH5A 3BAFA 1NOIA 2FSHA 3R23A 3E9DA 3RVSA 1MGPA 4L51A 5B6IA 1M7HA 2VUHB 3DOHA 4R9VA 2XH8A 1IK6A 2AFVA 1X1BA 5CHEA 3OQNA 3THYB 1U4OA 1AGNA 3TQQA 3V5NA 3VNUA 1SCNE 2DX7A 4O4IF 4F9FA 1Y9EA 1SBYA 1I1QB 1GCOA 2A92A 4FC7A 4DXAA 3LMKA 5A71A 1LBTA 2CEAA 4PO1A 2AQKA 1E6CA 1Q1GA 1C9MA 2OG2A 1NVGA 3ZKAA 4A2WA 4ZMBA 4LISA 3FF4A 2NVUB 4M8SA 3MGBA 4WY2A 1DLIA 3QVWA 5DSXA 1P9LA 4KH1A 5HXAA 3KEQA 1Z34A 2LV8A 4J49A 2I34A 3HWSA 4ON9A 4XYMA 3GPCA 3VZDA 1DRWA 3T9AA 5FOUA 1V7PC 3FLAA 4NAHA 4NFLA 1I1OA 4RKWA 4U00A 4DAEA 2C2OA 4DC0A 1FE8A 1XTJA 2WB4A 1HK7A 2VA9A 3ANYB 3OE7A 4QQFA 3HUUA 4XEUA 1PUJA 1EDOA 2H7VA 5FIUA 4CV0A 2JBAA 4M21A 3VTAA 2BCJQ 4A0FA 4UDXX 3AR3A 4Z0TA 4I4TA 3KPYA 4ZAZA 3CGGA 3TIVA 1O87A 3AUTA 3VUFA 3RBXA 5EJEA 3GGGA 2IYYA 1Y4SA 3ENQA 3WMXA 2HA3A 1NX6A 1UPAA 5B5SA 1OJLA 4GC5A 4TWZA 4Q9JA 3U44A 1YHNA 1RLJA 2GARA 1RBZA 2XBLA 3EY4A 4IDBA 1RKXA 1U7DA 1W0JA 2R7NA 1JDJA 4M86A 1CW2B 4X1KA 4E3WA 2W98A 2PAFA 2O8FA 2O52A 1FQJA 2RHGB 3B3GA 5TPWB 3ZHBA 3HLYA 3QVJA 2AOTB 4KNVA 4DYDA 4L75A 4E2XA 3NDRA 1NJ5A 3IPAA 3LUDA 1Q7BA 2BSAA 2X42A 3NJ4A 5DB4A 2ENWA 3U4DA 2NACA 2O8EB 1WG8A 2EZTA 3LCJA 3D1LA 4MCIA 1HOTA 4I8DA 4CM8B 5AUNB 2PBLA 4X1IA 1CETA 1T6YA 2C5BA 2JFOA 3FCCA 2ZSKA 3FYUA 2HY7A 2P2CA 1PEDA 4UUOA 5E6SA 3CB2A 2VF8A 4R51A 1YQTA 3BFJA 4BMPB 4F4HA 2PQ6A 3JASA 2FW8A 4FHDA 4BMXA 1DMSA 2EWVA 3MT8A 2F67A 1XTTA 4F1KA 3HVHA 1UP6A 2WJPA 3FGNA 2RH8A 1KAGA 1YR2A 3EZNA 1OLSA 3F2IA 3Q7EA 5B1HA 2DY0A 1NP3A 5EOVA 3TXYA 3WY9A 4ENTA 5IM4A 2BD0A 1G8GA 1GN9A 1BSVA 1XG5A 1RXSA 2GZHA 4RVUA 4E1BA 3OZEA 1RRMA 3O8DA 3OFND 1SOUA 1KZ7B 5KREA 3EFOA 2HH9A 4RK7A 1JJAA 1KY5A 3BIOA 3WP0A 3NETA 4KMOA 1XTUA 2YHUA 4QO8A 2Y1WA 1CE8B 1KMCA 3UPDA 3WB2A 5LZ2A 3B7GA 3OETA 5KNBH 1TAQA 1LV7A 1VBKA 1O6BA 5A2QA 3OC0A 3L49A 3RCBA 5DSZA 1AX9A 1CJKC 2IRWA 3D0RA 5F51A 5D3MB 1HTBA 1NI3A 4LDZA 3LL7A 2OYSA 5PNTA 4OXNA 3ORRA 4R2HA 4ZC8A 1G16A 2VDWB 3INNA 5B36A 1BKSB 5BQ5A 1ZSVA 1FRQA 4EHKA 1E1QD 5JO9A 2DRIA 3RD5A 5EP3A 2GF9A 3R76A 1UPFA 2I4NA 1L3CA 1QDEA 4NPCA 4XM1A 4NXMB 4KQKA 1MVLA 3IAUA 3J7TA 2I99A 3LIIA 3NBUA 4CPDA 3LX5A 1OY1A 1J7JA 4L4ZA 2P1ZA 1F14A 4EG3A 4LSMA 4F3TA 5GONA 3GLFE 3RI3A 4E5YA 3G8CA 5E2BA 3AJDA 4ARVA 3OTQA 1PFQA 1Z6YA 4PSAA 2XZOA 1G2PA 1J5EB 1FTGA 3AKDA 1IHYA 1I3MA 4F1WA 4MWTA 1CR4A 2C54A 2C3PA 4OLJA 5B4TA 5HS4A 5FLEX 4LHYA 3SZOA 3KQWA 2P9CA 1IPEA 1BROA 1LFDB 5DM4A 2V8BA 2GCOB 4R31A 5TRTA 5C7IO 5ICFA 5E0KB 5LWQA 3QUAA 1W4CA 3M5CA 5JLAA 1LCIA 4YMUA 1WHTB 4M6WA 5C81A 3B8HA 1TUBA 4HLNA 2B78A 4A92A 3QW4B 1WZUA 2NP7A 4TS1A 4ZZIA 2R5NA 1QCZA 1JBEA 2CCJA 2CZGA 3QLVC 4KGVA 4L95C 2NUAB 2VTDA 3SXUA 2P9EA 3TLKA 4B9AA 4BBAA 4DWOA 1RM5A 3DKVA 2RD2A 4XLZA 4L8YA 4E0BA 9LDTA 5LA6B 4FHGA 2D7DA 2PGJA 3ODPA 1ZRNA 2JA1A 3ACDA 4U6NA 3MB5A 4I6EA 5BN4A 4DCVA 4AT1A 1EGHA 1UDAA 2E49A 1CEXA 3WSWA 1JS1X 4PFQA 4KN6A 1C0IA 5IKEA 3DBRA 4EPXA 1J0AA 2XNKA 3U7QB 2R86A 5EP2A 3FPEA 3CRQA 3RLIA 3DKKA 5A1JA 2I3GA 1U8AA 3LWZA 1BKDR 1E79A 2CMHA 4JK3A 3U7HB 1MEJA 1PNTA 1BDMA 3RO7A 4LBYA 2GHIA 5GM1A 4CIYA 3LSYA 3LPNA 5JSKA 4CIVA 3MC1A 1UBJS 2BFFA 1UFQA 2VYND 3E2IA 1JFFB 3C24A 1AA6A 1JRLA 3ZHSA 1JAZA 3DL4A 2L82A 4BEJA 5BV2P 2W43A 4LWPA 1XLUA 4AJKA 2CFSA 3KB6A 4J0CA 2ZJ2A 3HKBB 5FNVF 1C7IA 4B8WA 1GKLA 2BMWA 2DHEA 3GDHA 2UYQA 5KC9A 5KNBD 5KDOA 1GPKA 2A1IA 2M98A 4OHBA 2W6NA 4O8CA 2EFHB 1N9ZA 3RIHA 3PXAA 2C4VA 3DOFA 4OP1A 3WQSB 3KJFA 5EC8A 1IOLA 2OMEA 3CZ5A 5DNEA 3DZDA 2WYWA 1OTHA 1MQSA 4JXXA 1XCOA 1YJAA 1Z74A 3I04M 4IMJB 4KOEC 4E32A 3EXIA 1ORWA 3BTUA 3KKKA 1X3LA 4C07A 5K0JA 1X9GA 3PUWA 4PLYA 4WFQA 2WHXA 2PO7A 1KVTA 4YDRA 1U6KA 2JF0A 4ZI2A 2J5XA 1B74A 2FWAA 2IXAA 2R96A 4QULA 3G2OA 2OECA 1T1GA 1T5TA 5BUCA 3Q98A 5G02A 1I5RA 1P8JA 1RTTA 3A06A 3DE6X 4JVMA 5D6OA 2PMKA 3A32A 3E22B 5B12A 3LQKA 1LPNA 1K5HA 3WLHA 5I4CA 3LUAA 2ZU0C 1FUUA 4RFLA 3WISA 2ZIGA 1WV1A 4WNYA 4DNQA 5IDXA 1VHTA 4IIFA 2JD1A 2QTAA 2AEMA 2YNMC 4LYEA 5G1PA 1RPNA 2QJFA 4IQFA 3K1YA 3E3NA 3RTCA 3UMMA 1Z25A 2HPAA 3DR5A 1OFTA 4LN1A 4DEXA 1UBSB 4MW1A 4S1VA 1M76A 5HPYB 3EPPA 1WP9A 1OYVA 4I3FA 1M1NB 1X74A 3PHJA 4ZT5A 2O7VA 1EH5A 1L5KA 3X3HA 5K3OA 5CJ2A 2WAAA 3UMCA 4KTVE 1C4KA 2WD7A 2IW1A 2J3JA 1W0KD 3A26A 2PT6A 5THQA 1OE0A 3NP9A 4FIDA 3R8CA 1MNQA 4EITA 2FDCA 4FDMA 5IK2A 4H7DA 3TCXB 3SJZA 4EK9A 5L45A 4D3SA 3G82C 3NV9A 2ODPA 1I3CA 2F6RA 4Z86A 4F92B 4ZRMA 4B76A 1UC5B 1O6GA 3ZTYA 3HABA 3IBCA 3KLBA 3WRXC 1FQWA 4DL9A 1I1HA 2B36A 3M5PA 2JIPA 4AJEA 3TLEA 4IBOA 4EHDA 5LQJA 2VAWA 4CMHA 5JI2E 3F90A 4LBWA 1DBPA 1GYQA 3FZNA 2ECFA 1HDGO 2Y4OA 3HXOA 1N8TA 1EHCA 3H2HA 5EE0A 3R74A 2A78A 2X19A 3EJ6A 5EJ7A 1UQTA 2Q9AA 2R9VA 3VVMA 1E69A 1JMYA 1QYIA 1SD2A 4URWR 3F74A 2FK7A 2JBWA 1JAYA 3PPXA 4KMRA 4L15A 3U48A 2BMJA 4ETWA 5I7AA 2EFDB 4B1FA 4KFCA 2YINC 2WHRA 2Q2OA 2JGKA 2OO7A 1NUAA 1ZM9A 1IZYA 1YIOA 3MM4A 4FKZA 1W8DA 4JP8A 5G2OA 3CJRA 2VPTA 5I9IA 3MAAC 1VE3A 4G5XA 4R5HA 3OMWA 3NS7A 5I8ZA 3TZBA 1C7JA 4JQZA 3BHMA 1SVMA 3HVKA 4E2FA 2Z4TA 4G41A 4BB5A 1P91A 2XUHA 5HCNA 1KQFA 2COUA 4BQSA 1OYWA 3KQVA 1A8QA 3DCNA 4FDAA 1BD3A 5D6NA 3GR6A 3PJDA 1CY0A 5IC4A 3ORYA 1RXWA 1IY8A 3PFIA 4FDTA 3UJCA 1JMVA 1G1MA 1LVHA 1MXHA 2FMXA 2JEZA 3GT4A 2OE2A 3MELA 1DC3A 1FQOA 1AUXA 4YONB 5ILOA 1NVEA 2SKCA 1XQYA 3IE0A 4HGOA 1N2SA 2G4CA 3QVGB 1JDNA 4RSMA 1ZESA 1X14A 5LQRA 3RYCB 1JKJA 2EZUA 3AL2A 3P52A 3CF2A 4WADA 4F4IA 3E0XA 2B9EA 3QKSA 4F9GA 4CUKA 4IVNA 3EH1A 3BTOA 1DHRA 4OHMA 4NVRA 4RK1A 1J49A 5JFTA 2Y1FA 2QBYB 2CB0A 4JOBA 2Q0XA 1AKYA 2F43A 2GI4A 3BL5A 2QTTA 4NBUA 1A4XA 2GPSA 2A7XA 2ZSEA 3PFGA 5JPCA 3Q6MA 4IQ0A 4QOHA 4YRDA 2O59A 1N8SA 5TB5A 4UM9B 2YUTA 2IFTA 4MVJA 2QTZA 4OUDB 3SY8A 3EEOA 4HDSA 1E2HA 1P80A 1SUBA 3I83A 5ALFA 3PLNA 4KO1S 5IW8A 2XZDA 4NBVA 1N6LA 4TV9F 1JZTA 5FBRB 5JW6A 5CNIA 4JJKA 2VNJA 3EZLA 4Q05A 5J4HA 4OUKX 4GG1A 5HZMA 2LW7A 5TLSA 2WB2A 4UHKA 4CR7A 3AI7A 1IEWA 4H7HA 4HMOA 3ZIDA 1I2AA 3GH1A 4DR5B 3SZLA 4GBMA 1Q84A 1P2DA 1XN1A 2C9YA 4GKVA 2ZRCA 5JMPA 5HYVA 1R4MA 1LDGA 4MROA 5HSGA 3QNMA 4YWJA 5JZBA 4PSDA 3R7SA 3V9PA 5KYXB 1CUDA 1QMPA 1KU6A 3SQOA 3NBQA 1GLVA 3DOUA 5AW1A 1L7MA 3IAM1 4G9EA 4X44A 1PP4A 4B74A 4FOPA 3M3PA 2PGXA 4D4GA 2Q5FA 3KR0A 3W2EA 5B1EA 1X7YB 3SZ3A 5JAIA 5CDFA 3OT1A 5FOQA 2AN4A 1RQ2A 4TMXA 1ZVKA 2BM0A 4IOJA 4JCCA 1JEQB 2H1RA 4RA6B 4IG4A 4F6RB 1FTQA 3ETLA 3MJVA 5COBA 2FPWA 2YN0A 3REFA 2PUEA 3R8FA 3OQHA 1QO0D 2OB2A 1P4SA 3GJRA 4G1EB 2EG5A 2NVOA 4G07A 3TOZA 1PV2A 1FLNA 1SURA 3ADOA 2JGDA 5KYKA 5F7XA 4QM6A 5C8YA 3RYIB 5HTOA 2HJRA 5ALZA 1AKVA 1JGTA 3U1TA 4OGWA 4IV0A 4F3NA 5A4MS 1B76A 3WLKX 4U9IS 1A82A 1JHZA 2I7XA 4WN9A 4JBGA 2RH4A 2ZWPA 5JY6A 2C95A 5AVTA 4HAUA 2BMDA 2DUUA 4J4BA 5EJ5A 2BFDB 4HGYA 2OFFA 2GLUA 2ISCA 1BFUA 2YR0A 2ET6A 1U1FA 1ATZA 3FIUA 2VZ8A 3WMEA 1QF6A 2DPMA 2JK1A 4PHHA 1P77A 4TT3A 4LNHA 4MWGA 4WBSA 1L1RA 3RS3A 4ZN6A 3NT2A 1SC3A 2XCIA 1MTZA 3KQPA 3S5UA 3KSAC 5IABA 3TNFA 4QYMA 4D9CA 1XMOB 1XZCA 3SG0A 4HDMB 4OSEA 1QC5B 3CB4A 5FA6A 3BWEA 5BXQC 2C07A 5I5GA 1J06A 3AV0B 1SBNE 3WK5A 3DEFA 5ES3A 3UV6A 4Z53A 1B23P 5FTWA 2O05A 4CKWB 4WZBB 4IWYA 1ONPA 2AVDA 4PIMA 5BN5B 3MWEA 5B55A 4IP0A 2J5RA 4Y0AA 3MQ4A 3PNKA 3TNJA 1L8XA 4TYYA 1V3QE 1Q22A 2PX3A 2FZ5A 3TMKA 3B70A 3E70C 3I58A 5AK6A 1M2OB 1IYZA 1Z2AA 2W8BA 3PDHA 2LGJA 3AEXA 5A4DA 3CLTD 2HC9A 3ZLUA 2GX6A 2IQ5A 1W85B 4KO3S 4M54A 5TGDA 3L4SO 3B6MA 1GLGA 3W9BA 4DCGA 4Y9TA 3JYPA 1Y5LA 5FAKA 3SFVA 3L6CA 2P3OA 3LP6A 3LY9A 5AKKA 4W5RA 3WBJA 1U2GA 3OT5A 2RHRA 3CT4A 1GV1A 4GZMA 4BP8A 4EHBA 4DIMA 3GDWA 4CLDA 5I48A 2YN2A 3QVSA 1XEAA 2G80A 2FFJA 4WFJA 4J1TA 1F2VA 1JWBB 1P73A 2P41A 3FRIA 4JT4A 4QFCA 5COAA 4A0HA 2HIHA 1GAWA 3MTBA 3HY4A 3OMLA 3DDOA 1JEEA 1M34E 1SXJA 2NO5A 2JKVA 2X3YA 3OQBA 2H1CA 4FFNA 4FILA 4K9MA 4MUBA 5BSVA 4EOGA 3CH7A 1WBDA 1FDOA 1ENYA 2HX1A 3BAZA 4FLMA 1DVRA 4A8JA 3TLCA 2VT7A 4W63A 4BBZA 3PE4A 4TX1A 4FGUA 4XGRA 2CXQA 1AKTA 1O58A 2C57A 2F8LA 1CUWA 4RTQA 1G20E 5J1SB 3DBVO 3N0RA 1RIIA 4DLPA 1QIEA 4U6SA 2AC2A 4DLKA 4UBLA 2B2CA 3HYTA 1SZPA 1RE1A 1IMJA 3EC2A 3FBWA 2AF4C 3IV7A 4OI4A 3IOBA 4NJMB 4I8IA 3WJ1A 2OZLB 3W6PA 5CK4A 4MCAA 2C82A 3M3HA 1E58A 2V97A 3A9UA 3HBJA 4FYXA 4B75A 4HMQA 3C8ZA 3PJEA 4PZYA 2C0QA 1HNNA 1WULS 3N6RA 5I47A 3L4KA 3A1DA 2C7PA 2GFIA 3CUEF 3VJKA 2GPJA 3AJAA 1WXIA 1KE2A 3JR3A 3VC1A 3D6NB 1Q5PA 2XXAB 8OHMA 1HZJA 1L5YA 4UREA 2XNJA 5JVDA 2NSYA 4LW8A 3K4HA 1KXZA 4LVOA 3OZCA 1YS1X 3ON5A 5TC4A 6YASA 1NVXQ 1I0LA 1I4OA 1N2EA 1GR0A 2NU8B 3VH4A 3X1XA 4HKTA 1RLUA 1ZKMA 2ODNA 5A9SB 5KQPA 1MR3F 2V74B 4GPTA 3KWJA 3BGVA 3NU1A 4DCOA 1T0JB 3GG2A 4O4LB 1ZJ5A 4DHWA 2GPWA 5FPPA 1LPMA 3ISJA 1VA4A 1I3NA 2BY4A 3L18A 4IDNA 3WYEA 3OCYA 4LFBB 1DO2A 4Q3LA 2R5FA 1FMJA 4N6OA 4KODA 2XD4A 4ARZB 5JLJA 4M8LA 5FI3A 5KU1A 2NZUG 5E9WA 2Q1XA 1CZNA 1TJYA 2IYTA 4JX8A 4RW0A 3UXHA 3LPMA 5C1BA 3VKHA 3I4LA 1PT7A 3Q88A 3VH1A 3WIEA 4D80A 3E6AA 1V5FA 3OJOA 3AF1A 1D6JA 3M4NA 4JVOA 4XYGA 5HQTA 1S1MA 3MT7A 2VP6A 1W36D 2ZQ5A 3HXMA 3ETEA 4MR9B 3RVMA 3Q11A 3UCFA 3O95A 2W90A 1CZRA 4CQMD 3OCJA 3BJIC 2C5AA 4I7EA 1Q1NA 5KJ6A 4X1YB 3A4YA 3F1KA 3HDVA 4QEZA 2BGTA 3CUWA 3FLMA 3V97A 4EY4A 4XJVA 2FPUA 1I30A 2B61A 4AJJA 2AYXA 2OXEA 5B3JC 4YAUA 5FBQB 2IXGA 4RGYA 2D13A 3WB0A 4OP3A 2VHWA 3HC7A 3HJGA 4BFLA 5EHNA 4F9TA 1QQAA 3BCHA 1NSFA 2I65A 2V6BA 4G8BA 4QQKA 4F97A 3VYRB 2QVYX 1C7EA 4XXHA 1OCEA 1V5EA 1XTSA 5JAPA 4RGQA 3HEAA 1C14A 4QYIB 4URUR 4YIKA 5CVTA 5I51A 1ZN2A 4XM2A 4CM4B 3AP2A 4NCJA 3L1KA 5K51A 1OXTA 4CCYA 1SGWA 2GUGA 2BVNA 1M0TA 5LZ9A 3LDUA 3E1GA 2H5LA 1XSEA 4FCCA 1E9FA 2QN1A 4MW0A 3PFHA 1RM3A 4UJ3A 5ADHA 2G9ZA 3KQNA 2VDJA 3E8MA 2WZQA 4MUGA 3UA3A 4BP1A 1BU8A 2ST1A 4XX0A 4ABYA 1DQRA 2ZIVB 4ANFA 1Z0DA 2QLMA 2XJ9A 1GRCA 2LCQA 5HJ5A 1MABB 1C29B 3NI2A 4MRAA 4YRTA 2AQ8A 4ACBA 1NN1A 2VF7A 4PYNA 1EVIA 3DVRX 3T5TA 4HC4A 1V7CA 4MINA 5JCOA 4BTVA 1TZBA 2ZBEA 5I9LA 2DPYA 4YCSA 2JD2A 2G82A 1H8HD 3RJZA 2ANCA 3JSXA 3QIAA 4KBYA 2WUVA 3TNLA 1FYXA 4BV8A 5HMMA 4ZQBA 3HV2A 3F4BA 3OU6A 4FMPA 3HL0A 4XH9B 4LIPD 1U7OA 5UKDA 1UBCA 2IL1A 2WNSA 2PKYX 4PC6A 4MS3A 4UDNA 3OLVA 1E6EA 3TB6A 3RVQA 3A9TA 3MFQA 1JPVA 2C2KA 5FPHA 3KOZA 4EHFA 1H9CA 1RJEA 4JELA 2YUIA 2WOJA 1Z6XA 4AY3A 1E2EA 1OD6A 4BFTA 3WLTA 4LDAA 5FB3A 4B3DA 1OZ0A 1I6KA 1PHPA 3HP4A 3ZXUB 4ALJA 4WJZA 1FF9A 1ZUIA 1ISFA 1NBIA 1X1CA 3H17A 4D3XA 1ZGAA 1I14A 3UGTA 2ISQA 4I9FA 5GZ3A 2B4AA 2PA3A 1ZM4A 2BRUA 1JIVA 4ZAYA 1VSQA 4HNVA 3K94A 3RS0A 2O8BA 3BMNB 4QPPA 2O2GA 5JROA 3AR4A 2YL2A 3SU8A 1IVSA 2LR0A 4CL0A 2HCJB 1OB2A 3AVYA 4EFLA 2WF9A 3LHFA 1UEXC 3MGCA 4OFBA 3I8OA 2JB9A 4MLDA 4N0PA 1KMIY 3RKUA 3TI7A 1VMDA 5KYYB 3T94A 1SCIA 1NJ8A 4HH1A 3RSCA 3RTGA 3S55A 4MH0R 5BW5A 3C5WP 4U2GA 5EYPA 3RF7A 4QM7A 4MQBA 5AQEA 3LUGA 2NSLA 1XI2A 1PEKE 2X1MA 3FPGA 1S8AA 2ZKLA 5AJWA 5EZYB 1GPH1 2WJVA 3CMCO 4H7KA 4UCQA 4L5AA 4DKXA 4FFMA 2YVLA 1WSDA 3K35A 2WTBA 3NHLA 3ZW9A 2VHTA 3KTAB 5HF9A 4D4HA 4FDLA 3VKWA 3KK0A 1OI2A 3MXOA 4X8MA 2FDRA 3L1HA 1TA0A 5JXGA 5B53A 1GAXA 5SY9A 5AQ1A 4Q7JB 5FT9A 3IT3A 4QBTA 3A04A 1LNSA 2Q4RA 3I4FA 5DN9A 1OX4A 1J24A 2OD7A 3RC9A 4JROA 5EI5A 3TLAA 1INLA 4E1AA 4OREX 2XUJA 1IBMB 3P9RA 3SC3A 2V7XA 3OAAD 2BFOA 1A5AB 4P84A 4Q12A 1SD5A 5K0BA 4JJZA 3QSYA 1CNEA 1RD4A 4RV4A 3IAXA 1WQ3A 3QFCA 3DCYA 3E7FA 3K0AA 4ZO8A 1E3WA 4BNNA 4DA8A 5KOIA 4TXJA 3OCCA 3JQ7B 2QUBA 1JR3D 1ZK2A 2HMYB 1OV4A 2C88A 1DKPA 3Q0IA 1OSNA 3EF0A 3GCZA 3AYZB 3MBOA 2DWCA 2ZCJA 2I4OA 2MYUA 1GYPA 4BFVA 4ES6A 5JT1A 4M98A 1E1LA 1T5IA 1OWLA 4CN8A 5KPJA 1VPTA 2CKMA 4PC3A 4QKQA 4IJVA 1MIOA 3IOCA 5T57A 4RFSB 1VL2A 1KH3A 4IIHA 1KQGA 2WD9A 3Q5EA 1S2IA 1V1RB 2BJVA 1L4GA 3C1TA 2VDNB 4HLQB 1UBGA 2WM8A 1QIMA 2AR9A 3DMFA 4JGBA 3FKJA 4QFDA 2EF0A 1A3CA 1TIKA 1HKHA 3SI7A 4BYGA 2Q6VA 3JVVA 1HSZA 2JIDA 3MWKA 4HWGA 4HWOA 1TZCA 4V38A 4WXYB 3HN7A 1XLWA 3HV0A 3UZUA 4C05A 4D8XA 2ZJZA 4FJ2A 4DPKA 3CLRD 2X77A 4XYBA 3QITA 1LDEA 2CHEA 3M9XA 1GO2A 3P0RA 4QQNA 3SDZA 2UXDB 4IF4A 4HNQA 2C9BA 2PLFA 1P1FA 2I62A 2XOKD 3GP8A 1GPYA 2RGYA 4XR4A 3DTYA 3UXEA 3QKRA 3U3RA 1NC1A 3QQ5A 2QTFA 2WVAA 3AY3A 3EZYA 3HGTA 4WCFC 5PGMA 1PBTA 3FMOB 1LJLA 2E4AA 3IHLA 4P92A 4JR2A 2QVLA 2IKQA 3UY4A 2WUEA 4YCMA 3OA2A 1ZXBA 4K8RB 1LLFA 1VG0B 2QTGA 3CN9A 3A36A 4PX2A 3VU3A 4S0ZA 3UBMA 4YP7A 5K6TA 1SHKA 3H3XA 3GL9A 3DVAA 2D0IA 3FPCA 1T26A 1CQJB 1YCGA 5MFPA 4ZYLA 5DLDA 2XQGA 4F38A 3ZGYA 5TJ9A 1EGAA 2K2WA 3G9TA 3EPHA 4LMRA 1O94D 2GZ2A 1ZD3A 1JLHA 2ZI4A 4L0QA 5ENDA 1XIVA 4URVR 2A0UA 1L7EA 1K7XB 3K31A 1L5FA 4TSFD 3KU4A 1JLMA 1SU8A 4HDRB 4QGSA 1GPDG 2VK8A 1P7PA 3D81A 4PLGA 2Q5IA 5DO9A 1N0IA 1X8KA 1GTL1 2FPKA 1QK3A 1BMDA 3TW4A 3CX7A 5TXGA 1BS9A 1KGDA 3AXSA 4EZIA 1HX7A 3RYHB 1YI0A 2ON6A 4YGYA 1G42A 2PRYA 1TTQB 4PSUA 2ZUVA 5FOSA 4N5NA 4DIBA 1QGED 2OZVA 2ZYDA 3BMOB 3G6WA 3U9LA 1ETHA 4LC1A 3ROPA 4ZDIA 2AF3C 3O3NB 5KI6A 3Q8LA 3ZK9A 3PEEA 1G2OA 3PGA1 4GI5A 4M55A 1ZD5A 1U0GA 5KYGA 1HT3A 3FNIA 4IH9A 4W1RA 2WDPA 5TPZA 4P4LA 4K28A 4L6AA 5A7FA 2B0JA 5KSOA 3A9WA 4Q3CA 1JBKA 5BT8A 5GMOA 1RPZA 1WLSA 5IKMA 5AI5A 1P5RA 1NBWB 4RZXA 1Z3CA 1G4HA 1ZVVA 1E1CB 1VJ1A 3R0QA 3NBMA 5JIBA 4I1PA 3VU9B 5LCXA 3QVOA 4JLKA 2VL7A 4TM8A 1Q0QA 5KKCA 1XWIA 1X8JA 5AW9A 2WWVD 4EVQA 4XVCA 3IP9A 2FSVA 1X80B 5JMTA 3PX7A 4BO0A 5CBKA 4E03A 4F2GA 3OLXA 2OYRA 3CWZA 2GEVA 1LWNA 2CDNA 3OIWA 3T7JA 1QX3A 3DF9A 4RVOA 1PX0A 4N5DA 3RC8A 4AQYB 1NUPA 1R0LA 4PYRA 2H2GA 3IQZA 1NWHA 2MMCA 3TTVA 1GZ7A 2A9QA 1YD7A 3JWPA 3RUDA 3F3MA 4BVGA 4DJ5X 2O8CB 3V8RA 1TD9A 4H1UA 3GA7A 4TYNA 3TN7A 2REOA 3B2EA 3DLCA 1EBFA 4EJMA 1UBMS 4RZIA 4R1SA 2B30A 3EGDB 4QODA 2PZLA 1CXZA 3AEQA 1EZZA 1LX7A 1W6RA 2CN1A 3CH6A 4LE2A 2XHZA 5L7WA 5DT2A 3PQ4A 1NW7A 5GP1A 3GA0A 3FZEA 5IBCA 4JNKA 1LFAA 5AKYA 3T12A 1DAPA 2H6EA 3QNWA 1GG5A 2OZKA 3AZQA 3FWNA 1SVOA 4B3GA 2ZJ6A 1ZMRA 2P3SA 2VUSA 2PXXA 2GHTA 4NDAA 4U4AA 2HSGA 1M2KA 4KUHA 2QY6A 3A10A 3GD5A 5DX1A 2HGZA 1F2TB 1ETUA 4LXYA 4RHFA 2P5SA 4RZ2A 5EFOA 3H9QA 4N1AA 3JQ8B 4FEGA 3O8OA 3IIEA 4NCXA 5LQNA 2G7ZA 3AEUB 1TD1A 2G4LA 2O8DB 1TQ2A 3EQ9A 2FZLA 1O54A 3SP1A 1WW3A 2FCAA 1PDWA 1EEXB 2UUAB 5CLIA 3NIBA 1ENOA 2C4TA 2O5RA 4G23A 1JALA 4BO6A 2PY6A 1HDZA 4L74A 2XWJI 3ENKA 1YAHA 4LC9A 4FGLA 4L08A 4ND8A 5TQ0A 4D3YA 1R6AA 1BOFA 1B2LA 1JECA 1LRKA 2N46A 3HCOA 5IJAA 4WNCA 5TS2A 5BSHA 1DQPA 2FQWA 5TQ2A 1ODCA 3RRBA 4MGIR 2OLKA 1E94E 1ECJA 3EA5A 1ABFA 3HCPA 3PFKA 2VF5X 2Q3EA 3MMSA 1QRTA 2C2YA 5EPOA 2VP4A 2WIBA 1BYUA 4HAIA 3R2JA 4IH4A 4R8LA 2KWIA 3N2IA 5JV5A 2HNBA 3K9FC 1VSTA 3G88A 2L17A 4DADA 3DOIA 4A8PA 4FS8A 5JEEA 5LQDA 4NCAA 1D2NA 3V8QA 1JYFA 3F67A 2XRZA 5KNDA 5LMZA 1KI4A 1RAAA 3B1KA 3P4UA 4A6EA 1WY7A 4E5MA 1YIAA 2PCJA 1TQDA 1ZEMA 3CPSA 1W8IA 2W6JA 3OM1A 2IA5A 1GEEA 2H08A 4Q6BA 1Z7EA 5EHQA 2EP7A 2CXTA 3GRPA 1J23A 2AQIA 2G28A 5EMKA 3WWOA 3G5MA 3QYJA 3QBJA 4RM2A 3R24A 3IUEA 4Q19A 2ZLBA 4UTZA 5H9WA 5F5NA 2MSNA 4P08A 1XYVA 4CEHB 4F6LA 4K1LA 2DR2A 5FWDA 1JHVA 2GQ0A 1FPQA 1QVWA 2CBXA 1ZJZA 3WZ2A 1S1CA 3OZGA 4RGVA 2VBGA 5K5EA 1A9RA 2ONKA 2Q1WA 3IQDB 2F3SA 1XR3A 1ND6A 3T95A 3VZRA 3PUZA 3AR5A 2CCGA 1O5OA 4IHJA 1D2RA 1W46A 3T7AA 5TY0A 1BJTA 4P3OA 4E6EA 2HEGA 3PT5A 1H6DA 1DO0A 2H65A 4QFMA 2VI5A 1B0UA 3B6KA 1XJCA 3H18A 2IIVA 2V9CA 5HDQA 3GCWA 3VO2A 1NQAO 3EXEA 3MBKA 4M49A 2MWMA 1NJ1A 4A6PA 4MV9A 2DJ5A 4KQJA 2D1SA 2H9YA 2WU4A 3P19A 1NBAA 2G3YA 4M99A 4O1MA 4QYXA 4XUEA 4PAGA 5FTNA 3DG9A 2GAFA 5BO5A 4D25A 4CMGA 1SC1A 4ZVUA 3RNLA 1L5OA 1DG9A 3KKLA 4K8OA 2OG1A 3IEKA 4HJRA 3WIOA 4QZVA 1P7CA 4O4JF 1DFIA 1LRLA 1UFVA 1CIPA 2H0RA 1V47A 3TAUA 5JJ5A 1AO0A 3G9UA 1V8BA 4GZLA 2VNAA 4PS0A 3ZE8A 2GD1O 1SKQA 4DMHA 4M60A 5EIBD 2XNHA 3DB2A 1G66A 1M75A 1YVEI 2G06A 3GMDA 3KHKA 3MPOA 5H02A 2I4MA 3MRTA 2HA0A 1BCRA 2VT2A 2ZETA 3HXLA 1WQ4A 2MYTA 1PJCA 1OX6A 121PA 4LZPA 3PKJA 4RABA 4EPWA 1D07A 1ZM7A 2PUWA 3BSWA 3P27A 4WGGA 1TM1E 3ZV7A 3R0JA 3FIJA 3I37X 2GZ3A 4OA8A 5BSRA 4QRHA 3UEOA 3ZWKA 5LDHA 2ZYAA 5F2KA 5DXJA 1V5WA 4EO7A 2AK2A 1ULTA 3GU3A 4NZPA 2B94A 1FVXA 1ZIOA 3E05A 1G7RA 4HWPA 3RSSA 4D44A 4RHCA 2CLEB 2R79A 4LSZA 3X1WA 1NI4B 2D3TA 2I3ZA 4NNJA 4TWJA 1I7QB 1QHHA 2QB5A 5JI3E 3H8SA 1T8PA 1J00A 2APJA 4JD5A 2VH5R 3BHIA 4U2DA 2IUSA 4DA0A 4BY9E 4K0RA 5ELMA 1R4AA 4Q7QA 1QHGA 2A67A 4ZOAA 3ZU6A 2PJDA 1S8FA 4YUXA 3KEGA 3MGKA 4AMZA 4NBKA 4C7OA 3FN4A 2AI3A 2XXBA 2V6JA 3Q3CA 4WCFB 1M2FA 3P0HA 1EG2A 4HN2A 1MVNA 4E7OA 1HXHA 1GT91 3KHTA 1YOVB 2IZZA 1Q50A 1NNUA 3K6SA 5F5LA 2ZE8A 1U2SA 3DXXA 3WP1B 1R7RA 2WWGA 3BULA 3PD7A 3KZKA 1Q0HA 1GNVA 2B2XA 2C58A 3RBZA 4D9IA 4PIVA 4XB1A 3AF3A 2JLYA 2DFVA 3R6TA 4HZGA 1JLLA 1U0RA 2WWYA 1TQ4A 2PUDA 3G0DA 4HWTA 2Y1CA 1X39A 2QAGB 3ZWBA 3K1TA 2H52A 3QU2A 3DDZX 1J4AA 2IEBA 2Y27A 3PU6A 5FXMA 1CUFA 1E20A 3TTYA 1Z0SA 1D6SA 1ZU4A 3LC0A 4MB2A 1GSOA 5ALEA 4ZKEA 1KPHA 2FRDC 9ABPA 3E03A 2R2GA 1KI1A 2CJXA 2H4FA 2E3JA 1FFXB 1M8PA 2PR7A 2J87A 4JUIA 1P3DA 1NPYA 4FSDA 4HR7A 4J1QA