1PUJA

Structure of b. subtilis ylqf gtpase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
273
structure length
261
Chain Sequence
b'HMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKNKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSGGLINYDKTTEVIIRDIRTEKFGRLSFEQPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein ylqF
molecule tags Signaling protein
source organism Bacillus subtilis
publication title Structure of the YlqF GTPase from B. subtilis
rcsb
total genus 94
structure length 261
sequence length 273
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1580.10 Mainly Alpha Orthogonal Bundle Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 Conserved Hypothetical Protein Ylqf; Chain: A; domain 2 1pujA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1pujA01
1W0JD 3BFXA 1D2EA 4TQ9A 4ACAA 4R2HA 1PJRA 1E2JA 2PH1A 4PZYA 5CYPA 4MRPA 2ATVA 4E09A 3PEUA 1W4CA 4URZR 4QJ4A 2AK3A 2O8FA 1GNRA 1NLYA 3RC3A 2GHIA 3SJZA 3FGNA 3U3KA 2AK2A 5FL3A 3SR0A 2MMCA 4NE2A 1EK0A 2F43B 4XVUA 1X8KA 4AG6A 3F3YA 4PR0A 4FW9A 4A8JA 5J4VA 2B7CA 3NBZC 4JLKA 3NBXX 4X8MA 3DKVA 1EESA 2DHRA 1U81A 4HAYA 3GP8A 1X1RA 2FFBA 1AZSC 1KGDA 2GESA 4ESVA 3ICEA 3EARA 4TL6A 2VL7A 4UXHA 3U4QB 3VR1A 3ND9A 1E0AA 5HE8A 1CKEA 1T5LA 4TLAA 3UATA 1LVGA 5FTKA 4DSNA 3VNVA 1E9SA 1N5JA 1OH6A 1Z06A 2FEMA 1RRCA 1AZTA 4V0ME 4PC6A 3AKCA 4RFSA 1YR7A 3QY0A 2DWPA 4TWZA 2L0XA 1DOAA 3EIQA 3W90A 2CLCX 1Z6YA 3FWYA 1MABB 3THOA 3PQCA 4KLZA 2IS4A 3KXKA 4RZ2A 2VPPA 4TMXA 4UKDA 4HI0E 3MCAA 1IY0A 2CJWB 1VMAA 4MRNA 4HSEA 2F3TA 4M1MA 4PC3A 1ZC4A 1FOEB 1EXMA 4B33A 821PA 2R65A 2O8DA 5KSYA 2NMVA 2IX3A 5FBLB 3M6AA 1LY1A 2W58A 2WOJA 2WWFA 4LBZA 2XJ9A 4XWKA 3O8CA 1OFUX 2BBSA 2G0NA 1MO3A 3WHKA 3GJ6A 4NU0A 4OQXA 4BLTA 3HU2A 3OIYA 5H1YA 3ZVRA 4XIGS 4LI0A 3TMKA 1SVIA 3C7KA 4AK9A 2QMUA 1G4AE 4GPTA 4PXAA 4AD8A 4QGFA 3U7GA 1UF9A 1P9NA 2ZU6A 3K0FA 1G7CA 4B3GA 2CMKA 3A58B 5KSZA 3UPUA 2C98A 2OBMA 2WJYA 1II9A 4LV6A 5TY0A 4B32A 3AF0A 1R0WA 3OAAA 3NTUA 5EXSA 3MD0A 4G5QA 3IO3A 1E2PA 3Q7PA 2PZEA 3LNCA 5GJCA 3ZS9A 2NO0A 1R2QA 2R6DA 3EPKA 1OB5A 1G20E 1E94E 2JGNA 2WMNB 4IDNA 4F4IA 1OKKD 3W8NA 3AUYA 3KTAA 2RCNA 2H7VA 4TYWA 5C4MA 3K09A 3UXMA 2WKRA 2B6HA 3P27A 2AN9A 1KIMA 3CZQA 4JZKA 1SHKA 1M8PA 4F38A 3AF1A 3WXMA 3PR1A 5TVKA 2J45A 4MYHA 1KI1A 1EWRA 4DKXA 4LOAA 2XTMA 4QJ5A 4E03A 3C15C 2WPDD 1KMHB 1O87A 6Q21A 3E1SA 1VECA 2P5SA 1WRBA 3P20A 3U3JA 4Z51A 3ZZ0A 3OIWA 4N3NA 1FQJA 3HU1A 5E3HA 4OL0A 2RGNA 5IK2A 1QVAA 3B9QA 4EAQA 3EPHA 3B1XA 1IN5A 2X77A 1XXHE 3NEJA 4OHZA 4QFMA 1Y3AA 1G7SA 1N0VC 2QQEA 3KXLA 4S35A 3RANA 4AKHA 4B3FX 3U60B 1A7JA 4UNNA 4MKHA 3B1WA 5DI3B 2WSSD 5FI1B 2DFNA 4I1UA 2J0QA 2KBEA 2QP9X 4IW3B 5JJLA 2P5TB 3K9LA 4CEHB 1GNPA 1E9DA 1YZKA 1GKUB 1OYWA 2DWOA 2ZR9A 1CJUC 3HJNA 4DUGA 3BORA 1Z0AA 4ZI3A 4KVAA 3MLEA 1DAFA 1NVUQ 5CJ2A 2WOOA 2VEDA 2ZU0C 4OJQA 3L8ZA 4RSGA 3RS2A 1H8EA 1KK2A 3FOZA 3TK1A 3IEUA 2YC4C 4C2UA 4WAUA 4LX0A 2GWHA 2FOLA 1RRGA 1NKTA 4D6PA 2CEAA 2LKDA 2GETA 1T0JB 1KI6B 2YWHA 1FUKA 2ASEA 1NBMA 1FTNA 1XB2A 5KSPA 3CIOA 1GNQA 2GA8A 4LPSA 3KZ1E 3KQNA 1SKQA 1TQDA 1G16A 3QXCA 3W3AA 1CRPA 1CXZA 5BN4A 1OFTA 4PC2A 4TSFA 5D3MA 1Z0FA 1ZU4A 1CJVC 2QY9A 3GJ8A 4LC1A 5AWFC 1Z22A 1QHXA 1ONBA 1PLKA 3AGPA 4TYPA 4UXIA 3KUCA 1J2JA 1E1QD 1CIPA 2A5GA 2IWHA 3ONWA 1Z5ZA 4A82A 2CCGA 2NOAA 1MKYA 2D3WA 1XEXB 1LF0A 2WJJA 3MWYW 3R7WB 4N0EA 2F9LA 4CGZA 1AIPA 1NN3A 5GVSA 2D4HA 2XNDD 4QGAA 5FBQB 2D7CA 2A30A 2EVWX 4HZIA 1FNMA 3DMDA 4D81A 2R62A 3SI7A 4DLTA 5B30A 1EX6A 2RH5A 3THWB 4PX9A 5JS7A 1E2IA 1Z83A 3K0CA 4C2TA 4OQLA 4HZUA 4RVCA 4RD1A 3MAAC 5FTNA 4NHOA 4CVNA 1MO5A 4RD6A 1Q1EA 4QKQA 2XOKA 4V0LA 5EE3A 3PITA 2J7PD 4R7ZA 5EE9A 1Z0JA 4TN1A 2KSQA 2P65A 1E98A 3UMRA 1Z3IX 1D2MA 2BVNA 2PEZA 2ZR7A 1KZ7B 4IXMA 1DG1G 4HUQA 4IRUB 3TQCA 2O0HA 5BN5A 1NN1A 3GQBA 2R6GA 4F7WA 3AVYA 2WM9B 2RKOA 4BZPA 4W5HA 5KOYA 4NCIA 3FMFA 2PJRA 3RC8A 1Q1QA 2O8EA 4NPHA 1G8GA 3GPLA 1JNYA 4O25A 4BLQA 2VF8A 3IILA 4B3DA 2IS2A 1DAMA 3X1XA 1OLOA 1DAEA 4HEJA 3AVTA 4Q4HB 4BWYA 4LSGA 5FTMA 2C5LA 2ZSFA 3TNFA 3L2OB 4OHXA 2C99A 2QAJA 4XSHA 1Y63A 2Q3HA 3TE6A 5HE9A 1YR9A 4WOPA 2O52A 5EP4A 4ASUA 3KQLA 1R8QA 1BYIA 2GCOB 1F2TA 3Q8XB 1PUJA 1I4DD 4TQAA 3L0IB 2JIZD 3N2EA 5FPSA 3R9XA 2DR3A 221PA 3L43A 1H8ED 4HAXA 1P9WA 3BAFA 1KO7A 2ZE5A 3P26A 3ZQJA 1W1WA 2YZ2A 4P4UA 3T1TA 3Q85A 4ASUD 3SC3A 1SGWA 3V4FA 2EFEB 4RFSB 1S9DA 1MH1A 2R9VA 1IY1A 1FMLA 3QE0A 4FCTA 1P72A 4A9AA 5J40A 1VTKA 1WBBA 1HT1E 2G83A 1WP9A 1EG7A 3LRPA 3PUWA 2KJQA 3ZIAA 1FW6A 1K6MA 1OXTA 4E5UA 2BIFA 4A8JC 1OT3A 4I1VA 2BMDA 2BV3A 1CR2A 5KNBA 5CM8B 2RGGA 2ZRCA 3CM0A 2CE2X 3RDPA 1J70A 1Z2AA 3NH6A 5JZVA 4RZ3A 2C03A 2FZLA 1P2VA 1YHNA 1IM2A 4D4JA 2GRJA 1G3IA 2VQSA 4W9MC 2LWIA 4A2QA 5D3QA 3RABA 1IHUA 2R44A 2GVDC 2X19A 1T9HA 3PEVA 1MRSA 4JSYA 2OCBA 1XTSA 2ZEJA 2J41A 1LS6A 3AF4A 1N6OA 2DBYA 3QKSA 1KI3A 3BFVA 3TIFA 1KHTA 3GLIB 3GLHE 1NG9A 2E9SA 1J90A 1YJ5A 1KSHA 2I4IA 2EFHB 2EQBA 2IYZA 3HWSA 4KLNA 4TT3A 3U3RA 4A15A 1ZMXA 1VHLA 2X2EA 2SHKA 1N6KA 4M0LA 1SVMA 3TUIC 3FHCB 3REGA 4NP6A 2IYQA 3A8TA 4KYUA 5FH9A 4EIWA 1COWD 3A1TA 2Q6TA 3W3ZB 1J8YF 2VP5A 3C14C 3L0SA 1XP8A 5FOWA 4ABYA 2OCPA 3RWOA 2F7SA 3REFA 1E79A 2BMEA 4MH0R 2NO1A 5SZIA 1OHHA 3QVUA 3ZLJA 4XOIA 1QHSA 4QNRA 2ZYTX 3CLVA 3LLUA 1IJEA 3GD7A 1U0LA 3NWJA 1QVRA 2BCGY 2ECKA 3LH5A 3D6TB 3FVQA 2O8BB 1CEEA 4Q9LA 1R5NA 1IOZA 3V00A 3UWKA 1U90A 4DCTA 5JEEA 1E9AA 2ZS9A 1OIWA 3NDBB 5DIFA 2VHCA 4FMBB 5KUTA 1UM8A 2NPIA 4V0NA 4OHYA 3T5GA 1SQ5A 1DO2A 4E22A 1KYIA 5EP3A 4JS0A 3LWNA 4F91B 1TPZA 4A0HA 1US8A 2UZ3A 3SE0A 2WWXA 2XZPA 2XGJA 2TMKA 1IN7A 1UKEA 3AB3A 3AVOA 3WP0A 3BJIC 4Q7MB 3A1SA 3IIMA 1ZCAA 1N6IA 1XTKA 1OW3B 3OEHD 3D7MA 1GIAA 1COWA 4MUAA 2VBCA 3CPEA 5IDVA 1XFAA 1Q21A 2FE4A 5IHPA 1TF7A 2WAYA 1H8HD 2QP4A 3MMPA 3K0EA 4NYJR 1B0UA 4TMKA 4TYYA 4V0MA 1NNEA 2ZJBA 2JCSA 1D9ZA 3TW8B 2F9MA 2QM7A 1XEXA 2AXPA 4GDFA 1XPUA 1NMXA 1AM4D 5L3SA 1KI8A 3H4MA 4XVRA 2XSZD 3U4QA 1JAHA 3K70C 4TSFD 4BRUA 1DVRA 3MWKA 4P4SB 3SDZA 4IOMA 1U8ZA 4CF7A 3WMGA 3CWZA 5E7JA 3TAUA 4MKGA 3VR4A 4HB2A 4OI4A 2F1IA 2BWJA 3KUDA 1WXQA 1Z0IA 1N5KA 3I32A 4QL3A 3FHTA 2JJ8A 3CNLA 5FOSA 2QPTA 3G5UA 4TMWA 1G9XA 1ZNWA 3ZJYA 1XD9A 1QG2A 2OILA 4FXPA 1NLFA 4US1R 1NSFA 2WAXA 3FFAA 3RHFA 4K46A 4MDFA 2D7DA 4PHGA 2XB4A 1UJ2A 2IW3A 3AP2A 2FN4A 4LJ4A 3SBDA 2OCAA 4FINA 3WNCA 3ZIAD 2BOVA 1KTVA 4GRAA 4DIDA 3THXA 2GK6A 3P4XA 4PANA 2F3RA 3GLIE 4PO8A 1SKYE 4BEJA 2QSZA 1AKYA 3O8DA 1E6CA 1WE2A 2ZYUX 1ZIOA 2W00A 1JPNA 1EFRA 4TQUS 4Q4AB 1KDPA 4LV5B 3PENA 1U94A 4FCVA 3L82B 3K53A 5TARA 1JR3E 4B3BA 1E2GA 4DVGA 2QSYA 3CRRA 4C3ZA 3GLGB 1XU4A 3UMFA 3RS5A 1MRNA 5A5GA 4EPYA 1HV8A 2HYIC 4DLVA 1G6HA 1Z6AA 2V8OA 1P4SA 2WICA 4Q66C 1P2SA 3EWAA 5FPHA 1U99A 3TVDA 1JQLB 5EUMA 2ZM5A 3TQFA 1NVXQ 5DI3A 2ZJOA 3TSOA 1NN0A 4PHHA 4TLBA 2A5YB 3I72A 2PBRA 1T5IA 4JLNA 3AH8A 4OQMA 4XTRA 1W5SA 2HXSA 1NY6A 4URVR 1AA9A 4UNSA 1OV4A 2CE7A 3QXSA 5JI3E 1P7CA 4KJZA 5ANRB 1II8A 4CRWB 2CLDX 5HTKA 2GJKA 2ZRKA 3UIEA 4BLRA 4I1SA 1JB1A 2OV2A 2AX4A 4B76A 2ONKA 2QG6A 2QZ4A 1GUAA 3SEAA 1M1YE 3LV8A 1GFIA 1KO4A 3N5CA 4U00A 5JJIA 3EPJA 4IFEA 2I3BA 1XEFA 2W2XA 1XEWY 1G6OA 4NYJQ 5K8TA 4NONA 2FJUA 4DDVA 1VG0B 5CIQA 1OIVA 3ZZUA 1XTQA 4EQ6B 1T8UA 1LTQA 1Z0KA 4ZDWA 1PLJA 2ANBA 4Q9JA 2GXSA 2QE7A 2PCLA 3NC1C 5SZHB 3AVVA 5F9FA 1FFHA 1NL3A 4EUNA 4URUR 1XDBA 4Q18A 5JHGB 1I2MA 1OYYA 3GLFB 1P2TA 3B5JA 3IHLA 3EZ6A 5DHAA 1P60A 4BUJA 3X1DA 1GKYA 1E9RA 2J46A 1YZQA 4P4SA 3FYHA 5FOVA 3B6EA 4MGIR 4B44A 5FBRB 3QI2A 3BFKA 3GCGA 2ZJZA 3X1YA 2P6UA 1JAIA 3KKNA 1CF4A 1E1QA 1QHIA 2MSEB 3LQRA 1E2MA 3QXHA 2EU8A 1JBKA 2PX0A 1Q20A 4V02A 4ZO4A 1NIPA 2KI5A 2CHQA 3C5HA 1DELA 2W0SA 3SBEA 2ZITA 1XBTA 2B7BA 4KODA 4M9ZA 4M9SA 5FPYA 4B73A 2YKGA 5JWHA 1X8LA 3PCRB 3TVTA 2C8VA 3CZPA 4B71A 5JWRA 2V6IA 3KKMA 2VSOA 4RZXA 5LB2A 2IT1A 2ZAMA 3DMNA 2OBNA 5AUNB 4NH0A 4PHTA 2QTHA 3QKRB 4QGGA 1A82A 4TTQA 1IXZA 2WMOB 2FH5B 3RRMA 4EJSC 4FN5A 4WXRA 1J99A 1TU4A 1P62B 1UKZA 1HY3A 4Q1FA 4ZIRB 5JRZA 3EA5A 4WXPA 2FPMA 4LGMA 1KK0A 4LY6A 4Q7JB 4QG7A 3CX8A 2WJGA 3A4LA 1QDEA 1GM5A 4JJZA 1N25A 1NIJA 3IHWA 1NLZA 4QBGB 3T15A 4Q21A 3KXIA 4JT4A 3TH5A 1BKDR 5JSZB 3TLXA 2GK7A 4IVRA 2ZRNA 3BB1A 3HYTA 3IPXA 2A7QA 4KFUA 1ZM9A 2BDTA 2J9RA 4GI7A 5EE1A 4RY2A 4QHTA 2OAP1 4EKDA 3LA6A 3K09C 2YNMA 3ZS8A 2J0UA 4LHXA 4KO8A 4OQNA 4PPFA 2XSZA 2G77B 2V9PA 3QNUA 3J81k 3CO5A 2ERXA 1W47A 2ZRLA 3DOFA 2JLWA 1ZNYA 3LXRA 4W5JA 2JLSA 1KJWA 2A5JA 1AS3A 2Z83A 5IRCD 4LHYA 2YV5A 3LVRE 1FUUA 2QT0A 1BH2A 1T6NA 8OHMA 2EFGA 1U9IA 2VHTA 1A4RA 3ADKA 1T0HB 3FHOA 4WZ6A 5EE5B 5A0FA 4LK2A 3GJXC 4IOLA 3TSWA 5B64A 3FDIA 1II0A 2VP6A 2QEQA 4HB3A 3SZRA 4JBYA 4Y0AA 1P3JA 1IQPA 4KU4A 2FSFA 2VF7A 4WZBE 3EA0A 1KI9A 3L0OA 4AY2A 2NQ2C 4LYFA 1OXSC 2GAAA 3WNDA 2V7QD 1JXMA 3AEZA 3EXAA 1NVVQ 1OF1A 2D2FA 4M1TA 4RD0A 4CEHA 2B8TA 1P5ZB 3QPUA 4JYBA 4EJSA 1PVOA 1M34E 4TMTA 2ZVQX 3BRWD 3X1WA 1CJKC 2VTKA 5TMPA 2FFAA 3A1UA 1JALA 1IONA 2XXAA 2IWRA 3K1JA 2GCPA 4RFVA 2CVHA 3A4NA 4LJYA 4Q03A 1V5WA 1EFHA 2PT7A 2ZE6A 2P2LA 2ZROA 3BH7A 4LBYA 5FPKA 4TZ0A 3M4YA 3BERA 3NG1A 1G1MA 1S3GA 1CTQA 4IOJA 1NP6A 1OHHD 3R8FA 3TGPA 1E3MA 2O0JA 3K9HA 1E79D 1DARA 121PA 4QRHA 3U2QA 1W7AA 4L4UA 1TTTA 2WJHA 5FR2A 3WYGA 4XSGA 3PEYA 3VKWA 4EFMA 3CX7A 1R5OA 3A1WA 4WZAE 4LPKA 3FMIA 4OKSA 2RGNC 5FOTA 3G82C 3WY9A 2CL0X 4U5XA 2AWOA 3T61A 3MJHA 4A0RA 2RGBA 4V0KA 1IN4A 4KYIB 2ZI4A 4TL8A 5H70A 5KO2A 1X86B 3IBYA 2ZYVX 4HUQB 5CM9C 2RGDA 1S0UA 1RJ9A 4TL9A 4BQSA 5BN3A 3SHWA 2A3RA 2ODWA 2DCUA 4OHWA 1T3LA 1TADA 4IDQA 3NKVA 4JIMA 4Q47A 3W6OA 2ZSBA 3CPHA 5IK2D 1QHYA 3QBVA 1L7VC 4Q7KA 1ZP6A 2HJGA 4JBWA 3SJAA 3SN6A 5DN6D 5LPNA 2O8CB 3H2YA 4M8NE 5K8LA 4AG5A 3AGQA 3LX5A 2FNAA 4IHQA 2ZUBA 2QRZA 2BC9A 1CR1A 2V1XA 3VR6A 1YVDA 2OUKA 3GLHA 5KPJA 1G21E 2GEVA 3DKPA 2QBYA 4ERNA 3ETLA 1Z28A 4BASA 3EC1A 5EJEA 1M7GA 5EXXA 4ZCIA 2QL6A 2OLKA 3QQ5A 4J0QA 2V55B 4IJMA 2HV8A 4IXNA 4F92B 1OPXA 1IBRA 1OIXA 2HCBA 2CLSA 2IUSA 3U44B 4LUCA 4POAA 2IYTA 1KK3A 5B2ZA 4HLUA 4MRSA 5J5CA 1P9RA 1G8HA 4KSBA 2GZAA 1GP2A 5D3MB 3AUXA 2PL3A 1E0SA 2H18A 1JJ7A 4WIAA 1RRPA 2ZVPX 4ZV4A 5H8WA 3M0EA 4NCHA 3GJ5A 1DADA 1TQ6A 3K8YA 4JKYA 3CKLA 1X6VA 3CH5A 2JATA 2QGZA 3D8BA 3SQXA 4DDTA 3EZ7A 3I92A 4DT1B 4L16A 1KI6A 2G88A 5JS8A 2A5DA 3H1TA 3NBFA 3L0PA 1LB1B 1G3QA 5FUWA 1T3HA 1JEEA 4C7OA 3NHAA 1XZPA 4JL5A 4S2EA 1U8AA 2A2ZA 2ZRMA 2CK3A 2ZJ5A 3Q3JB 1UDWA 3T35A 1Z07A 1G8FA 4M1YA 1GILA 5B57C 4B74A 3D3QA 4DLUA 3WYAA 1ZM7A 2D2EA 3ASYA 3VR5A 1ESNA 3ADBA 2F43A 2WHXA 3AVXA 1R10A 4MKFA 4Q4HA 2KWIA 4XTCS 1E2HA 3KDSE 1WB9A 3LAWA 4ZDJA 2QE7D 1MO4A 1WDTA 4TMZA 4JT2A 4URYR 4TTPA 1Q12A 4I4LA 4A0GA 3GJ4A 4ZKDA 3UWOA 2O8CA 4KI0A 2QAGA 1XNJA 3TW4A 1JXOA 4Q19A 2J0UB 2QM8A 3DL0A 1UEIA 4IVPA 3EPLA 4BRWA 1FL9A 1G5RA 1BMFA 1TEXA 3I1FA 1XD2B 4IVQA 4DLYA 4DIEA 4UJ5A 2YOGA 5FTJA 5KDLA 4IEIA 3U6KA 5HKKA 2BM1A 2I1VB 1GL9B 4C9BA 4A6XA 4B35A 2HLDA 4HB4A 4G1UC 3MRSA 1V43A 3EWSA 4I99A 4M53A 3TUJC 2XZOA 2B21A 2V6JA 2R6AA 5FUXA 2OM2A 3GLFE 3OE7A 4B47A 4BFSA 1E2QA 1KMHA 4Q48A 3H84A 4HZUB 3CRW1 1MABA 2VSXA 5AJYA 4AKEA 1O3YA 2NO9A 2WWIA 5L3QB 3OESA 3EZFA 2IXFA 4WBSA 4Q4LA 3AF3A 2C9OA 4YONB 3LXXA 1OH8A 2V54A 4HB0A 4PO9A 4B75A 3KL4A 2DY1A 4BLPA 1ZNZA 2DFKB 1VHTA 1U9IC 4YMWA 3S1AB 1TU3A 3ZVMA 4AYTA 2C04A 1ZYUA 5M04A 4IEEA 5KYKA 2YVUA 4KSCA 4Q1EA 1W0JA 1T8TA 3OFND 3HDTA 1DAGA 1XD8A 2HYDA 1M74A 1KJYA 1QZXA 2GZHA 1IXSB 4E07A 2ZETA 4PPGA 4ZCLA 4G5OA 3K0FB 3ICQB 2GXUA 4O0MA 4ZPXA 3RS4A 1PZNA 4GOXA 1N0WA 2GF9A 4M21A 5JCZA 4H9GA 3AKDA 4DXAA 1QHNA 4M1SA 1KDTA 2IS1A 2JIZA 4URXR 1F6BA 3OIUA 5FOUA 2VP9A 1CJTC 3KB2A 2QPOA 2WSSA 3MSXA 4LCBA 2ZTSA 2CNWA 2AD1A 1NJFA 3UG7A 4CYMA 1LF5A 2WJIA 3LDAA 4U02A 1SXJC 5JRJA 2QQ0A 4EPXA 3EG5A 4O3MA 2IF2A 3BE4A 4NYIQ 1EFUA 4OI0A 3QF7A 1NSTA 3KQUA 4C7OB 2AKYA 4L9WA 1JI0A 4JBXA 4Q9KA 4R9UC 5DYGA 1L4UA 1NRJB 5HCIA 1DEKA 1WF3A 4DT1A 3I3SR 4ZDIA 1DAHA 1GITA 2QORA 2PCJA 3LBHA 4HLCA 3RS0A 3THXB 4P3YA 4LJ5A 1M6NA 3R7WA 2C77A 5CDFE 2FWRA 4Y0VA 1ZRHA 2EWVA 3U7EB 1E4VA 1KI7A 1YU9A 4P0TA 2JAQA 4A6PA 1RVDA 2XEXA 3HU3A 1YZLA 4Q01A 3UG6A 1ZM3A 3HPRA 2VIIA 1VG8A 2FZ4A 1D8TA 3B60A 1KY3A 2KB0A 2IEYA 4N1AA 3PVSA 3VX3A 5GJBA 4DLRA 4A2WA 3SU8A 3U7HB 4OQFA 3FKSD 4V0OA 1VCOA 2J0SA 2R2AA 5J4LA 5AUOB 5LD2B 5C2JB 4BFYA 4GSYA 1KDRA 1DG3A 1NVVR 4R2IA 3W5IA 4EFLA 3E2IA 4LYJA 1W36B 2Z43A 1XCGB 1OXVA 5AR1A 4QM7A 1IN8A 5FBWB 3LD9A 5EZ6B 2HXYA 1FZQA 2EYQA 1HYQA 4AIIA 3QPVA 3IQWA 2WWHA 3NC0C 2FSHA 1E1RA 2ZJYA 3ZGXA 2H8KA 4A36A 1DPFA 4GOKA 2BJWA 2JJ2A 4HLDA 4QHYA 1JQJC 4Q4AA 1G7TA 4MGZR 5AK0A 3KX2A 3RS7A 1S1CA 1UBFA 4P33A 2P0EA 2ONJA 1Z63A 4Z1MA 4NL4H 2REXB 4Z54A 1BIFA 4FWIB 4D0NA 1W0KA 2REOA 4EDHA 1VCIA 3AV0B 2JLVA 1W4RA 2WVJA 4PZZA 4KCGA 2J0VA 3GEHA 3VU9A 4ZCMA 2XZLA 3CX6A 2FSIA 2FGJA 5KDDA 1YQTA 1XJ0A 2ZUCA 1OXUA 4NCNA 2YC2C 3AP3A 4YMVA 1KI4A 2IEZA 2UZIR 1ELOA 3QENA 4Z8YA 3SHFA 1ZM4A 1HQCA 3GFPA 4NDZA 4QNMA 2O8DB 2W2VA 2ZRAA 4EPVA 3T5DA 2PMDA 4BFTA 4C0HA 5A4JA 5K8UA 2G1KA 4TYQA 4TL7A 4KVGA 1NJGA 3IPYA 2BBWA 1Q0UA 3C4JA 3AVUA 2QAGC 4PQYA 3IDQA 2W6JD 4UXJA 2WIBA 3BH0A 3CR7A 5DO9A 1VIAA 3MFYA 2G1JA 4Q1DA 3C16C 4LDJA 1G5PA 2HEIA 1YR6A 1LS1A 1QG4A 2ZIAA 1W44A 2IXGA 4DCSA 4WVFA 1HH4A 5L3QA 2XXAB 4M9QA 5GJVC 1KAOA 1KSJA 3A36A 4M1OA 3GLGE 3PIRA 2JEOA 4C0KA 4H1UA 2HJVA 2CNWD 3UMSA 5E7MA 1R0YA 1S4QA 3W9YA 1AKEA 4TYNA 5CB8A 1II8B 1XEWX 3TJZA 1XMVA 2BBTA 1E2FA 5EP2A 4B2LA 3K0SA 2OFWA 1F3OA 4XD7D 5C46F 3QIAA 2Y8EA 1G3UA 4NYIR 2ZYWX 5KDOA 2C78A 2GVZC 4NYMR 4RJLA 3VKGA 3DM5A 4A8JB 4ON9A 1BYUA 2FPKA 5G41A 3JVUA 4B2PA 4BFVA 3P1JA 4HLQB 4XH9B 3BOSA 2HT6A 2H57A 3FB4A 4AKGA 3BXZA 5G53C 4KFTA 1OSNA 4OK6A 3T1QA 2WWYA 1R4AA 421PA 3SYNA 1ZU5A 1M2OB 1KKLA 3Q5EA 1N5IA 1WA5A 4JLDA 3W6NA 2CDNA 2OT3B 4YQFA 4URWR 1Z0DA 2W83A 1ZIPA 1KI2A 4D25A 3OHMA 2REBA 2ZRDA 4DEYA 1E9EA 3LLMA 4LYAA 2ZANA 5JFGA 4HDCA 4KBGA 5JBQA 1E2NA 3FE2A 5G3ZA 4C0LA 1XMJA 2OO7A 3BC1A 1JR3D 1A2BA 2OSBA 1GRRA 4HDOB 1DBSA 2GCOA 2QROA 3BBPA 4QM6A 1AQUA 4PPQA 1XRJA 1ODFA 3GFTA 3Q5DA 3EIEA 3M1IA 4KFSA 4MRVA 1L2TA 3NEYA 4UNQA 5CDFA 4ACBA 1QBKC 3CRMA 3CH4B 2KBFA 4MITA 4LJ9A 1Q1BA 4AKIA 2UVQA 4MQBA 1JECA 3QOFA 1I4LD 2WBLC 4UQOA 3VNUA 1UDXA 1PLLA 3U6BA 5HKKD 4ZDKA 4D4KA 4JKIA 2WKQA 1TUIA 2JDIA 1JEDA 2PZGA 1XTIA 2IYXA 1CR0A 3I73A 5AJXA 5J4KA 1KO5A 2YOFA 4X8OA 4X8LA 4XWAA 1W36C 1MOZA 5LDDC 1E2EA 2XTZA 2GJAA 3KJGA 1E9CA 2WJVA 3ZVLA 4YMUA 3QF4B 5KSOA 2AKAB 5DH9A 3TRFA 1E2LA 3LFUA 4FCWA 4BGDA 2ODEA 4HAZA 3SS8A 2UKDA 3EZ2A 2OE2A 3WBKA 4ZI2A 3I62A 2V3CC 4HDQB 1G8PA 4P32A 4W7SA 3GLGA 1UEJA 3TAHA 3THWA 4AI6A 2GNOA 3QEJA 1XTRA 2MMGA 2IYLD 1NMZA 5CJPA 4OYHA 3UKDA 1R0ZA 2AFIE 2JLXA 4LHZA 2X8AA 5SZJA 2GEDA 5TV2A 1IN6A 1U0JA 1YZNA 5GVRA 4AWXA 4CZ2A 5HR5A 5JMTA 1AK2A 4GP6A 5KHOC 1KAGA 3B8HA 3CONA 4HATA 4AYXA 1XPRA 4FMDB 1Q44A 4AYWA 3PJRA 3IEVA 2RB4A 1AN0A 3DPUA 4PAOA 1GG2A 5IT5A 5DNYB 5F2EA 3GLFA 4I1OA 1P6XA 5EQTA 2NIPA 1E9FA 2Q9BA 2YWGA 1RW4A 4JL6A 1SVKA 4M22A 3P4YA 4MGKR 2JLUA 2XB2A 4JLAA 4R98A 3E70C 1VIYA 1LNZA 4FMCF 2VRWA 2ZRFA 1DS6A 3FPAA 3GJ0A 1G5TA 4UNRA 1KZGB 1RKBA 3QKUA 4QJ3A 1U2RA 4LJ6A 3RNLA 2OCYC 1XJQA 3LBIA 4GT1A 2PEYA 1ZD9A 2DFTA 2VP4A 4JLOA 1SVOA 2X2FA 1TMKA 4KXFB 2OFXA 2PX3A 4PAMA 2QNRA 4DDWA 2C96A 5JHHB 3GJ7A 2Q0HA 1A5TA 2R8RA 1YRAA 3RYTC 1ZUIA 2AR7A 4KBFA 1GRNA 3WMEA 2YOHA 1C1YA 1GVNB 2BKEA 4A92A 1VCMA 3WYFA 2JLZA 2WV9A 3OE7D 2VP2A 2FX3A 3AKYA 2OEPA 1IXRC 1VYVA 3HR8A 2B92A 5DLQC 3KQHA 4EJSB 1DTSA 1GAJA 3MJRA 3OZXA 4MUBA 1YR8A 2H1LA 2IYWA 3RVBA 2GJ8A 5G40A 2MSDB 2IF0A 4P31A 1FNNA 1FX0B 2ZRGA 2CCJA 2OBLA 2PLFA 5FL7A 2ORIA 3AP1A 5E95A 3WRYC 1KO1A 1BOFA 5KTYA 2ZJ2A 3SYLA 4BFXA 2XAUA 4NZYA 2AXNA 2XNSA 5F98A 4QHSA 4Q9IA 1K8RA 1XCMA 5DGXA 2BM0A 2WSMA 4XWOA 4DCUA 5F9HA 2WIAA 1H8HA 3GMTA 4GL2A 4NYMQ 1X8JA 1F2UA 5J4HA 4PSVA 2GDJA 1CULC 1NY5A 4JVSB 2IL1A 2R6CA 4G0NA 4BPBA 4Q1AA 1E2KA 4O2LA 3MWLA 3WHLA 1SHZA 1IAQA 3ADCA 2GCNA 1ETUA 3FFBA 5FOXA 2HF8A 4NBSA 1OFIA 3FTQA 4DCVA 3QG5A 3IQXA 1RZ3A 3VR2A 2Z5FA 4KFRA 4F4CA 1GDDA 3ZYCA 3DVLA 4RKFA 5DSZA 4Q00A 3F5FA 1I2DA 2F6RA 2IBMA 4BZQA 3DO6A 2Z4RA 2ZSAA 3QPWA 4D80A 1NBME 1E32A 3ZZTA 2CHGA 1MO6A 4MA4A 1RPZA 1EX7A 1ZUNB 4ZIRA 4JVNA 5J4YA 3NH9A 4Q02A 3K70D 1S2MA 3DOEA 2A78A 2IK8A 2NTYC 3QKRA 4L15A 5CLQA 1G64A 2ZSEA 4D4LA 3GJ3A 1NKSA 2N1BA 4D2IA 1XF9A 2ZR0A 3TR5A 5DISB 2GJ9A 3O8BA 3SYKA 1M7HA 3PUVA 1AS2A 4FIDA 2EWWA 2VP0A 5CITA 3EX7C 3X2SA 4LBWA 2VLIA 1FX0A 5GJWC 4TT3D 3OFNA 1ZD8A 5CIWA 4CT5A 2F55A 4Q5IA 4TMVA 3LW8A 1MT0A 3T1VA 1XX6A 3KKPA 4M1WA 3N70A 3DDCA 4CEIA 4DCNA 1VYUA 1KK1A 3R8CA 3SQWA 4A1FA 1LV7A 1SXJE 1UAAA 2G0TA 1G17A 2EFDB 1XPOA 5LBIA 4EPTA 2V1UA 4PHFA 4QBHA 1NVWQ 3PG5A 4IDOA 4TTRA 1F5NA 1TF5A 4DWJA 2G6BA 2YWFA 3NBYC 2J1LA 2OG2A 3QVVA 4M4SA 3CWQA 4PZLA 4QOSA 3WMFA 1T3SA 2ZRIA 2QMHA 5H68A 3W6PA 1VG1A 1W49A 4R71A 3FKQA 3AKEA 4DC9A 4YDHB 2E1RA 4KITB 1NG1A 1TQ2A 1UBCA 1S96A 2WPDA 1HEIA 5EUQB 1E69A 2C9CA 2XJ4A 3AVQA 2QN6A 2HLDD 1HT2E 1W5TA 4QBIA 4BZXA 1E9BA 3Q7QA 4F4JA 5GADl 2XTNA 1A2KC 5EZ5A 3DZ8A 1E4YA 3F0TA 1RC8A 2OXRA 2QAGB 4US2R 1G19A 1N6NA 5CK4A 2YINC 3HP1A 2JLQA 1A1VA 2AFHE 2FEOA 1WQ1R 2Z0MA 3VX4A 5TB5A 2O8FB 1CLUA 4W5WA 1VDZA 2ATXA 5L3RA 4N0DA 3RRYA 1FMJA 4D0GA 2ZSDA 1I4TD 2RMKA 1ZCBA 4H1VA 5BW8A 3TUZC 2QTFA 4G5SA 3EC2A 1E0KA 3B2EA 4BEBA 4CT4B 2HT1A 3EIHA 5BXQC 2GTPA 2QGNA 4JLJA 2CK3D 3B1ZA 2JJ2D 3WBJA 4GBMA 5KPDA 1R6BX 5CB6A 4CW7A 2QRNA 5EXTA 1G291 1JJVA 2J3EA 2DFLA 4JL8A 1OH5A 4CEIB 3A1VA 3PUYA 2BCJQ 2B8WA 1MV5A 3SFZA 4LBVA 2ZI6A 2GKSA 4NCJA 3RSOA 1RYFA 5FFMA 3VMFA 5KNDA 1SXJD 2FF7A 3QF4A 3QG1A 2W0MA 4LHVA 1UBGA 3DHWC 3WRXC 1R7RA 1HUQA 3ZD6A 3NDPA 1BMFD 1RRFA 2AHOA 4JLPA 2XOKD 3W34A 2H17A 2BEKA 5AJZA 4ARZB 2F1JA 1F2TB 1KMQA 2BJVA 2J5XA 5FR1A 1GOTA 3CBQA 3BD9A 3ZDQA 5ELXA 3FMOB 4BLSA 2J7KA 4DSOA 3AVWA 1KO8A 1HE1C 5FL7D 2ODNA 1G41A 1RFLA 2MSCB 4HAVA 5FBVB 4DB4A 4D26A 1U8YA 2ZAOA 1Q57A 1QRAA 3IGFA 3ZQ6A 1GWNA 3KJIA 3O8RA 2V4ZA 3BK7A 4ITRC 1KOFA 3LY5A 2IA5A 1OFHA 3NVAA 1YRBA 3QKTA 3HYRA 4B3XA 3TSZA 2QT1A 4AC9A 3GFOA 4PQFA 2IYRA 1C9KA 4MGYR 3QEOA 5DN6A 5AUQA 3RLFA 4LJAA 4Q1CA 3DZDA 1D6JA 5E4FA 3G0HA 2NPFA 3K9NA 2W6ID 4HAUA 2QMEA 1G7RA 1FP7A 4P4TA 2IHYA 2J59A 5L8VA 4Q4JA 1XMSA 1EWQA 3CR8A 2GXQA 1FPMA 2OAQ1 1ZJ6A 3JZMA 1J8MF 1ZVQA 1NBMD 4UJ3A 3QBTA 3U3MA 4IFBA 1UPTA 4YMTA 2E87A 3BS4A 4B34A 2VA8A 1SVWA 1VCNA 4NKRA 3K0AA 3X1ZA 4LV8B 5HZKA 5FPTA 5FUVA 5HPYB 4JMPA 2I1QA 4C0BA 3TBKA 2OLJA 3U7FB 1HTWA 1G3RA 3CUEF 5F3WB 1GSIA 5UKDA 2NGRA 4Z1MD 3LVQE 5LB4A 1ZD1A 2ANCA 4TLDA 4C0AC 4FMCB 1C4OA 1FTSA 1GKIA 1TAGA 1VG9B 2Z6VA 2ZI3A 3K0CC 4US0R 3S1AA 2W6IA 2GILA 5L3VA 1S9HA 4GMDA 1ZUHA 2QBYB 1KY2A 1RYHA 1QHGA 4OI1A 1S3SA 1OJLA 2WZQA 3I5YA 2QP3A 2NO7A 4B3CA 4DZZA 1E1RD 2F1RA 4RKEA 4BFZA 1L4YA 1N6LA 2ZJ8A 3K70B 1N5LA 3OIVA 4PQRA 4IDPA 2W6JA 1JR6A 3VKHA 1S8FA 4PFSA 3BIFA 3PXGA 1Z2CA 3P32A 2WWGA 1AJEA 3CPJB 4IOKA 2JLYA 4JJKA 4HAWA 4D82A 4A0FA 2A9KA 1HQYE 1G3MA 3W5JA 1RJ9B 4CIDA 1TX4B 2CXXA 1XJCA 1EFCA 1SKYB 3WP1B 1Z6XA 2ZUDA 2EFCB 2V7QA 4OHVA 3AQ4A 1FQKA 2Q9AA 5TXGA 1WCV1 1XCPA 1PUIA 2ZS8A 3T12A 2FDCA 4G3XA 1Z47A 1G18A 2AWNA 5EP1A 2JDID 3C8UA 2GJSA 2FV8A 2R6FA 1JPJA 2CL6X 2QTVB 4KHZA 3VU9B 5BWMA 1K5DA 1SXJA 1ZC3A 2FA9A 3BH6A 3QKSB 1U0HC 4DLZA 1HA3A 4L9SA 5B58C 2FSGA 2JASA 4GFDA 1Q22A 4PO1A 4PAQA 521PA 4CDGA 2ODBA 3EASA 4QBFA 3SFVA 2GXAA 3I8SA 3GEIA 3B13B 3KJHA 4JSTA 3RRNA 2ZRHA 2Q3MA 5CLLA 2PMKA 2PJZA 2CJWA 5G3YA 4OK3A 2D06A 3ZD7A 1UADA 3NXSA 1CJMA 5SZKB 3K0AB 4BE7B 2ZE7A 2BEJA 3CNNA 1UBEA 2Q3FA 5JSZA 3ADDA 3B1VA 2IUTA 4OI2A 1T91A 4DLWA 2LCFA 2VH5R 2VSFA 1VPLA 4C0JA 3FKSA 4TLCA 2YWEA 4B43A 1N6HA 1W4BA 4NCKA 2ORWA 4I81A 4FMDF 2C2HA 4O2RA 5BQ5A 1MR3F 2RGEA 1L8QA 1DE0A 4GP7A 1LW7A 1TL7C 2Q21A 3KKQA 2VHQA 3OF5A 5CYOA 2IHBA 1R5BA 1ANKA 2NO6A 2IS6A 4WA7A 3U44A 1G8YA 4GMXA 1FP6A 2CL7X 1OH7A 5AUPB 4DB2A 1UKVY 2IC5A 2WWWA 3R20A 2CVFA 2VYFA 2FPLA 5KNCA 1CU1A 4KAXA 3CF2A 4RCZA 2W2TA 1KSGA 4C0QC 5JEDA 2WTUA 1J7KA 2IYUA 3IIJA 3BB3A 3THYA 2DB3A 3ND8A 3GLHB 2XITA 3U3OA 3KB1A 4V03A 4DDUA 1TF2A 3O47A 4MYCA 1AS0A 3AF2A 2D74A 5FI0B 5BYJA 5FTLA 1YZTA 2AD5A 4KV9A 2O8EB 1TEVA 3CRVA 1GTVA 3KFVA 3MGCA 2KE5A 3V9PA 2IYVA 4AURA 5JECA 2EW1A 4LJ8A 3WNBA 4BLOA 2ZXUA 3VTKA 1N6RA 2OESA 1ZW6A 5AJWA 4EPWA 1ESMA 1XXHB 1UFQA 3ASZA 5KU1A 1P61B 2P67A 2ZRBA 3RAPR 3MG9A 1AQYA 3F8TA 3PFIA 1KDOA 4GZMA 4PSAA 4QXAA 3B78A 3H86A 3T1OA 4DLXA 1Q3TA 4D4MA 1W36D 1R8SA 4HLUC 4YXWD 4LC0A 5DI9A 1W2HA 5P21A 3RSLA 1NI3A 3CW2A 4HYYA 2VHUA 2QU8A 1Q3HA 1PV4A 2QUZA 2J7PA 2P6RA 4YMSA 1VYTA 4BFWA 2RGXA 2JA1A 4BECA 1Z6TA 4FWTA 4OJKA 4RD3A 4LWZA 4RD4A 1R0XA 3I4LA 1F60A 1HE8B 3DM9B 4OBEA 4D0LB 1W4AA 1D2NA 5C18A 1W2GA 2ZE8A 3JVVA 5EE0A 5DYIA 4MKIA 3SOPA 2CCKA 2J87A 3BGWA 3RWMB 1W0KD 3CNOA 2Z4SA 3FMPB 3OAAD 4YC7A 1QHHA 3Q72A 1N0UA 2OXCA 1E0JA 2ERYA 4NTZA 3OEEA 4A4DA 1K5GA 3QUSA 4U7DA 2YJTD 4LHWA 4B48A 4RZUA 3AVPA 5EXPA 2FGKA 4EFNA 2GAOA 3DEFA 1AGPA 4UNPA 2FU5C 5TDHA 3B7GA 1OB2A 2Q9CA 1GZSA 2BHRA 3OEED 2G3YA 2BMFA 4F93B 1Z8FA 3IO5A 1OXXK 3PUZA 2C95A 3PUXA 2DWQA 1BO6A 1IJFA 4PC7A 4WW0A 4DRZA 4BFUA 4II7A 2XX3A 1WMSA 2N46A 2NZ8A 1H65A 1W48A 3QXJA 3L8YA 2PZFA 2ZRPA 4ILEA 4K8OA 4YLGA 3B85A 3MUFA 4XD7A 2YYZA 1XXHA 3KJEA 3IIKA 2H92A 1GRQA 1ZINA 1SVSA 721PA 621PA 5JI2E 1W46A 2LKCA 3CF0A 1EGAA 2RAPA 3A4MA 3I8XA 4GNKA 4LYHA 4EQ6A 4CEJA 1ZNXA 2GEUA 2XNDA 5BYKA 4QC2A 1F48A 3LQQA 5JLJA 2FFQA 3UANA 1YE8A 2ZREA 2O0KA 4ZKEA 4QGHA 1DO0A 1F2UB 3RS3A 4Z8XA 4EPRA 2H16A 1LFDB 1CR4A 4YXWA 1RE0A 2NZJA 1UKYA 2HCJB 3RRZA 2OHFA 3QJYA 4K81B 1CS4C 3THYB 4FI3C 3QXXA 3CF6R 3W8RA 1XZQA 2BMJA 1KJZA 4NMMA 2QI9C 2AL7A 4MRRA 2PLRA 4L8GA 4PC1A 3N2IA 4PTLA 2VO1A 4Q7LA 3R9IA 1E99A 3KKOA 1GL7A 2CBZA 4DSTA 3B1YA 2CHVA 3C41J 1XTJA 2GF0A 2RHDA 3C5CA 3ECCA 3AM1A 1Q1ZA 2A5FA 1NF3A 1SZPA 1XMIA 2IYSA 4IKEA 5DE3A 3UK6A 5HCNA 1NN5A 1BS1A 1YZUA 5JWOA 1P75A 4GZLA 2O5VA 5J47A 4DJTA 1QF9A 2C9YA 2JJ1A 2F1HA 3A6PC 5CK5A 1XWIA 2ZS7A 5LD2C 3SJBA 1EFRD 1KNXA 1HURA 3H0KA 3KTAB 1Z6GA 3VHXA 4DEXA 5C1BA 2ORVA 3CB4A 1VKJA 1Z29A 1QHHB 4DUGD 2GBLC 2IYYA 4Q9HA 4IDHA 1X3SA 2HDNB 3OEHA 4FD2A 1YKSA 1ZM2A 2N42A 4PPNA 2JJ1D 4HUTA 2DPXA 1OKKA 3JZAA 4RD2A 5E7IA 1TUEA 1US8B 3MWJA 4JLBA 3EW9A 1IY2A 4TLEA 4JLVA 3VQTA 1M7BA 3V4RA 2GZDA 3LO5A 2ZI7A 2JLRA 3KFXA 3T34A 3TR0A 3ZVNA 1E96A 4LRWA 1P73A 3VAAA 3BWDD 1SXJB 2FG5A 2G9NA 4LZZA 1EFTA 1P2UA 4DLSA 4CEJB 3LW7A 1T4GA 2VHJA 3B9PA 1D5CA 2QENA 4DBLC 4OK5A 1DAIA 1N3BA 1ZAKA 3LX8A 3EAQA 5C4GB 4GOJA 3QSYA 1N6PA 1AGRA 3IKJA 4C0SA 4Q4JB 4C4PA 4MYTA 2X1VA 4JVMA 2WKPA 4MYUA 1S1MA 1YZGA 5L3SB 1GL6A 4B6FA 3SJCA 1D9XA 4M1KA 2EYUA 1KKMA 4PSKA 1SULA 1N2CE 5JCPA 1CBUA 1Z08A 2BKUA 1ZBDA 2BBOA 4ESHA 4YDSA 5HZHA 3PEWA 1SVLA 2ZPTX 2GBLA 2P3SA 1OE0A 2QA5A 4DHEA 2ZJAA 2FFHA 2IXEA 3GLIA 2OFOA 1KSFX 1NMYA 3U5ZB 1B23P 4G01B 4JVLA 3NHBA 2H5EA 4G5RA 4X8HA 5FUYA 4RCYA 4A2PA 4Q1BA 2DYKA 1RIFA 3TKLA 3VR3A 3K9GA 5K8IA 3I61A 2QMOA 5IF9A 1E2DA 3T06B 3I5XA 4ARZA 4MDEA 1TQ4A 2RGAA 3U61B 1JR3A 2ZRJA 2NG1A 2YHSA 4XVQA 4DSUA 4C30A 1WBDA 2O8BA 3EZ9A 2FMXA 3D31A 3ZH9B 2K5UA 3IUYA 4B2IA 2PT5A 2D62A 3LBNA 2HUPA 2OZEA 4JLMA 2ZI9A 3SNHA 1CP2A 1CRQA 2IUUA 3HR7A 3VHLB 4XJXA 1X1SA 3R9WA 3HPQA 3B82A 2ZQ5A 4JYCA 1TNDA 4TZ6A 3Q9LA 3KQKA 1DAKA 2HF9A 4M9XA 1KNQA 1U98A 4LJ7A 3E5HA 5JJKA 3NIBA 2QPAA 2ZI5A 3VFDA 3PV0A 2RHMA 3GEEA 4G5GA 5DHFA 2P6NA 1XD2A 3BB4A 4L5BA 4B6EA 5AJVB 1G4UR 2RGCA 3CRQA 3IBGA 3A37A 4M2LA
chains in the Genus database with same CATH superfamily
1RI2A 1W0JD 3MJDA 3ZHRA 4ACAA 3KDPA 4R2HA 1PJRA 1E2JA 4WDRA 5CYPA 13PKA 4E09A 4TRMA 2J08A 4G09A 4QAJA 5EJ4A 5KX5F 2AK3A 1FSSA 2O8FA 1NLYA 3SJZA 5K09A 4Z4QA 1JZTA 1SUCA 4HWTA 5EQFA 1TVKA 2F17A 2MMCA 5ALUA 4BB5A 4NE2A 1EK0A 3OOJA 4KL8S 1ZK1A 5BV1A 2QX6A 4L5JA 4BKOA 2WUEA 1S7GA 2PX8A 3F3YA 4BTVA 1NW3A 3IUSA 4BBAA 4MQFB 5AVWA 1CJSA 3FPKA 4ZV7A 3NBXX 4L85A 2AZDA 4O3FA 2F64A 1BXRA 3MHTA 2DH6A 2DHRA 5KYUA 3QVGA 3IAXA 4CL2A 1X1RA 1GSAA 1AZSC 2GESA 3JWIA 1XVLA 4XE5A 2IHJA 1XRQA 2CGEA 1NX6A 3EARA 3O0DA 3ZDYB 1GO2A 2VL7A 3U4QB 1TO1E 4MMXB 3ETCA 1DG9A 1SXIA 3GHHA 4N4AA 1CKEA 1T5LA 2JARA 4TLAA 2OK7A 5DU2A 4DSNA 5TT1A 3NDRA 1NE2A 4RLHA 5CFZA 4WFKA 2FEMA 5FWAA 1PJ8A 1AZTA 1RCTE 4X6LA 4V0ME 4PC6A 4DE5A 2W11A 4PCAA 2OPHA 4RPCA 4BO1A 4F3YA 5KTMA 3GLGA 3P2YA 2L0XA 1ORHA 4XUDA 2XQVA 1XZ8A 3OOWA 3F1LA 4C1NA 4GW3A 3W90A 5LL6P 4IVNA 1JAXA 1MC5A 4Q3NA 4PGMA 4BCCA 1K63A 5SYNA 3THOA 1MABB 4PGAA 4KLZA 4QTZA 2IS4A 4RZ2A 4TMXA 1DEAA 5AKKA 2H51A 1O08A 2WR8A 4YUZA 3B3AA 5IKEA 4K87A 1VMAA 1DAOA 4HSEA 3CH6A 1E6UA 3M4JA 4KLCA 3BYZA 3WWZA 3LCVB 3PD0A 5T4FA 3JU3A 2O8DA 1M8KA 4YS6A 3F7TA 2YQ4A 3O73A 3F6EX 3UWDA 3M6AA 1FK8A 2W58A 3ZY6A 2WOJA 1RAGA 2WWFA 4MLCA 5DBHX 2OO5A 3ODGA 1FSGA 5AM1A 2BBSA 4XWKA 1HYHA 1MO3A 1RP7A 3KWLA 3PRJA 3VJLA 2WPNA 1NQUA 4WCDA 3SIRA 1O97C 2G82A 1DFHA 1Z74A 4NZ9A 4LWQA 4AY5A 3GGJA 3A9SA 1GEGA 1NJ6A 1SBCA 2CUTA 2E4WA 3DT8A 3GA5A 3Q98A 5DLYA 1SVIA 1WD7A 3C7KA 2XWJI 4AK9A 4GPTA 4PXAA 3F1KA 1UF9A 1Y5LA 4L2IB 1XDZA 2ZU6A 3RC1A 3K0FA 4B3GA 1FTGA 2PR7A 1O9BA 2C98A 2QD3A 3IV9A 5B4VA 1R0WA 4Y2QA 2FZKA 2QWXA 2WF7A 3OAAA 3NTUA 3OP1A 5F3DA 2O3TA 5TX7A 3ETGA 1HFWA 3KJFA 2NO0A 3WBKA 1H6CA 5B4TA 1Z5OA 3H04A 4RJIA 1B00A 5DBEX 3RH0A 1WXGA 1KQGA 1OC2A 3NW9A 4IDNA 4ND4A 5JZOA 4UAVA 3AUYA 1UZLA 1ULUA 2VH2A 5C4MA 1EFVB 4MUNA 2B1GA 1K08A 1SKAA 2WKRA 4J0EA 3UFXA 3CZQA 1C8KA 2CF6A 2VJPA 1V8BA 4Z4IA 3AF1A 3FFTA 4TVSA 4EW6A 1HR0B 1HE4A 5HDQA 4DKXA 1EE9A 4LSWA 3HN6A 1P0MA 1GGKA 5LSAA 3OLYA 4G5XA 3STHA 2WPDD 2NTNA 1O87A 4G84A 3A3KA 2CN1A 3BILA 6Q21A 1YA8A 3R3WA 1VECA 2NQTA 2P5SA 4J9VA 2IV7A 5L9AA 4F9GA 3ADOA 2NUBA 2PVSA 3RFFA 4DYHA 1U1IA 2VPQA 3FA2A 3ODPA 2WA2A 4HKTA 4KGXA 4Y2HA 4B4WA 3UCFA 5F5LA 1XU9A 3GLRA 4EAQA 4NLLA 3B1XA 3DBLB 3JD3A 2X77A 1RBMA 3NEJA 4PLGA 5CT9A 4P84A 4QFMA 1Y3AA 4C0XA 1G7SA 3ORFA 4AKHA 5ALVA 4DR1B 4Z2YA 1ZO8A 2QZSA 1MC4A 1O58A 4UNNA 4MKHA 4H7KA 3OKPA 2QTNA 5J5VA 2QRVA 3EGDA 4EJ2A 4XZ3A 5DI3B 3LC0A 2WSSD 2DFNA 4I1UA 4KYTA 1HDZA 2KBEA 4P3XA 4IW3B 1S7CA 2EFYA 3SSAA 4ED9A 2W37A 2FPPA 2X15A 4N82A 4C21A 3QQPA 3IT0A 4MO9A 2FZVA 4Q37A 4MQUA 3NGMA 5EKDA 1ZH2A 1RC1A 2HO5A 1GKUB 1Y5RA 1ZDMA 2D8AA 1VLZA 3LXUX 4Y1RB 1LNQA 5DX0A 2W9XA 3ITKA 5L7WA 3O4VA 5M5BA 3AUFA 2Q5HA 2BF4A 3Q9SA 1OILA 2ZPAA 1CHNA 3O4GA 4L76A 1RTTA 3WYDA 4OGLA 3ZGVA 1OXMA 1XZIA 1FUIA 3EAFA 5BQXA 2XECA 4G9EA 2WEKA 3Q8LA 5EZYB 2AVNA 2C83A 1N1GA 2VEDA 2ZU0C 3IUMA 3PRYA 4OJQA 1RQPA 5DM1A 1OTXA 1KK2A 3ZKWB 3TK1A 3ZLTA 4XYLA 5IT9A 1I1QB 4WAUA 1YOBA 5FWYB 2GWHA 3P4UA 2FOLA 1U3CA 2GUGA 4D6PA 1HRDA 1EP2B 3WJAA 2NVBA 2CWWA 3B2QA 1B8UA 4GLFA 2W90A 4IL5A 4ES6A 1XB2A 2DPHA 2I1WA 5ES3A 3RF6A 1NI4B 2O2HA 4F5WA 4AS1A 3GDWA 1F6DA 4O4LF 4H4DA 4J8PA 3OCCA 5TNXA 3USCS 1FJXA 2GN8A 2R7AA 3QXCA 2Q0XA 4HFRA 4B6QA 2Y1GA 4FCCA 4RLQA 1GCAA 4REQA 1J07A 4KACA 1QO0D 1D09A 5F73A 3BSYA 2QY9A 1CJVC 1CZOA 4CKWB 5BNTA 1JSCA 2G8NA 2HBYA 2JI4A 1Z22A 1QHXA 2W7TA 4JR2A 2VDWB 2VPTA 2ZTUA 5LYYA 1QFSA 3GT3A 3DAFA 3GL9A 1F8FA 1UOEA 3GBVA 2GZ2A 2XKKA 3NNSA 3U4CA 5CLHA 3TPCA 4NZPA 1VLHA 1W4ZA 5H4HA 2IWHA 4ZZIA 3VC7A 5TPWB 4R9RA 3G9ZA 1YA4A 4EO4A 3BG5A 4A82A 1MKYA 3C5VA 3Q9NA 1XWWA 4X44A 4A26A 1X1EA 1XK7A 2EF0A 1CQZA 2C57A 4CGZA 1OLSA 3FG9A 5AJHA 4IEFB 2D7CA 2AG6A 3GZJA 4M60A 2AHRA 3H05A 4LVOA 3T7AA 4YRMA 2R62A 3NALA 4DLTA 2RH5A 2RIPA 2HHCA 2O3RA 2N75A 4PNPA 4PX9A 3S4YA 2PZMA 1E2IA 5GZ3A 5JS7A 4CNBA 4OQLA 4BJ5A 4C2TA 3MAAC 1Y34E 3SC6A 3RU2A 4CVNA 1MO5A 3NHSA 2BKAA 1Q1EA 4UMDA 3GH1A 2VJNA 4J2HA 1KP3A 5THXA 5AW6A 4C6SA 1Z0JA 2PUGA 2KSQA 1NE7A 3LQYA 2VCEA 2X8JA 2Y9PB 2NU6B 3FYUB 1PSWA 1D2MA 5ALLA 1Q2UA 1H0RA 1WHSA 1F0NA 2H5IA 1SU8A 1CD5A 2HSDA 2PEZA 2FW7A 2PL9A 2ZJ1A 2ZR7A 3M2PA 2RKBA 3N59A 3N2KA 4FMPA 4HWSA 4IRUB 4CKCB 4HYQA 4F7WA 2R6GA 1D1TA 1KPIA 3ILVA 3QE3A 3AVYA 3OQPA 4W5HA 3SZUA 1SM4A 4EEZA 5KOYA 3NCHA 1Z7EA 3QBEA 3QK7A 2HSEA 3C97A 2QD2A 4QOFA 2ABWA 4CETA 2VF8A 2GTIA 2AEJA 3OCYA 2IS2A 4KQXA 3O95A 2X4GA 1OBCA 3BGVA 1DAEA 4H2DA 1YS1X 2VUHB 4Q4HB 3GRRA 1UBRS 1GFWA 1EQAA 2YV2A 3O4RA 1F17A 2C5LA 5K6RA 3D02A 3DB2A 3V8VA 4DJDC 4OHXA 4BNGA 3LGXA 2YZKA 3NHYA 3DB1A 1P0FA 2XYHA 1MEEA 2FLKA 5EP4A 1V8PA 4AF7A 2FP3A 4Y6GB 1BYIA 3DOIA 4TQGA 4U3JB 1K92A 2QLBA 4LXQA 1QV6A 2IEGA 4HNAA 4MV7A 3DHYA 4WH0A 5H3LA 4BTEA 4MZDA 4BNIA 4LGYA 2IOQA 2Q1WA 3PDWA 5FPSA 3UUGA 5LQUA 221PA 3L43A 4HAXA 3ZCPA 3BAFA 1XMQB 3AUTA 1C7QA 1KO7A 3ABRB 2C9DA 2CEKA 2HBQA 2YZ2A 3WV5A 4GBJA 1R18A 3Q85A 4ASUD 1T36B 1HL3A 5BW6B 5LU8A 4RTJA 1SGWA 3T8YA 2RBEA 1YZVA 4LVUA 3L7IA 3WS7A 4DN6A 4RFSB 3JRNA 1S9DA 4HN2A 1LC3A 3JQPA 1IY1A 1FMLA 1NQTA 2R1TB 1UM9B 5B7NA 1DJMA 4CGYA 1VTKA 1XZMA 1PZHA 1BGVA 1VBFA 3L6DA 2G83A 1WP9A 3LUGA 3QV2A 1I4OA 3R7LA 1V16A 1M34B 2X58A 3I01A 1WY5A 4W7IA 4JYAB 3Q7EA 4A8JC 1TJPB 5CFPA 5FB3A 2BMDA 1FQOA 2X7JA 2V98A 2XH8A 3WDKA 2XE4A 2ZRCA 2CMDA 2VWPA 3CM0A 2P7HA 4R0MA 4ZICA 3RDPA 1J70A 3NH6A 4OLAA 5CG2A 3QE4A 3SYTA 4BX9A 4D4JA 1IM2A 4K0RA 3V55A 5A03A 2ZTVA 5AXDA 4W9MC 3E18A 3BWVA 5LQRA 1IHUA 3ZVKA 3TX2A 2GVDC 2DM6A 4E94A 4J43A 3PEVA 3U9LA 3UPDA 4E11A 3UT5B 1XTSA 3EFOA 1JILA 3LFTA 4MW4A 5JPCA 1D4FA 1TJ4A 1W6UA 1LS6A 1QK3A 2VHVA 4KBYA 2ZTLA 4UTZA 3G88A 5FI3A 2DBYA 5I5GA 5FQOA 3QKSA 1UP4A 1KI3A 1NUPA 1Y3IA 2OC9A 3BQ9A 1NXXA 2O6HA 4FDMA 4DR7B 3GLIB 4J3JA 3I37X 3GWZA 3N53A 4DA0A 5K6AC 1KSHA 1P7VA 3WGOA 4DKJA 1GG8A 1Q7BA 4TT3A 4MRAA 2G1AA 4ND7A 4XFKA 1Y5NA 1VL2A 2CKMA 2EW8A 1VHLA 3DDOA 1ULSA 2SHKA 3EEIA 4M0LA 4NFHA 4WX2B 5JTTA 4PHCA 1R8YA 4S1NA 4CCSA 1AK9A 2HA3A 3EEOA 4G9GA 1MGOA 3JD4A 5J2TB 5KVQA 3UGJA 3CE6A 1BW9B 2QZPA 2RK6A 4MB2A 4RFLA 4AICA 4DC0A 3PVZA 1CT9A 1ESZA 1CPYA 4GOMD 4NEHB 1J8YF 2RONA 3C14C 4ABYA 1XP8A 2OM6A 4QECA 7YASA 4PLZA 4DUYB 1GFZA 1BKYA 2BMEA 3X2EA 5TEWA 1OHHA 2OO3A 1JKJA 2B25A 5JROA 4QNRA 2Q0SA 1TLLA 2ZYTX 3CLVA 3LLUA 4KR9A 4E4RA 4TTSA 5GIPE 1WZ2A 1JMKC 1QVRA 2BCGY 2ECKA 2GYUA 1U9CA 3LH5A 4DR4B 4Q9LA 1M2OA 1QR2A 1Z4KA 4LRYA 2B94A 2QIPA 3A3NA 5HA5A 3RIXA 3ZU3A 1E9AA 3GLKA 1XZCA 1OIWA 3PR2B 4FONA 2WTXA 5DNUA 5KHOC 3NT5A 4FMBB 4ID9A 5IFKA 3WA6A 1KAEA 1SC4A 1G9TA 1Y98A 2EQ5A 1NUSA 2O2XA 3L1KA 2ZGVA 3OM0A 4XUCA 3WO1A 4QGSA 4DPMA 1AO0A 1SQ5A 1DO2A 5LBUA 1GKKA 1ENZA 2V7XA 2WYVA 3AR7A 4D43A 2R87A 4F5YA 1TPZA 1US8A 1A9XA 2UZ3A 4G0ZA 3WNZA 2FW0A 1CYDA 1C30A 4RA6A 3OMWA 2BI8A 4OLFA 1BE0A 4FBGA 3CVVA 1A9TA 1OW3B 1P39A 3OEHD 3OX2A 5DHUA 1KFBB 3D7MA 4FXOA 2PUAA 1FP2A 1N2IA 1ZNQO 3BMCB 2AMFA 2ROQA 5IMBA 1DUVG 1YZFA 1P4HA 1XFAA 4N3CA 3SR4A 3WLLA 3TOXA 1TF7A 5IHPA 2WAYA 5EWJB 3MMPA 4XRRA 1GYQA 3K0EA 4TMKA 4D8WA 3VISA 1UH5A 2F4NA 2ZJBA 4KPUA 1J0AA 1VKZA 2JCSA 4DFDA 1D9ZA 2OZPA 3D64A 2DLDA 2C4HA 4MWDA 3ZY5A 4B7ZA 2OCKA 5JJBA 2QI9F 2CB0A 2ZDQA 1XPUA 1J0XO 1NMXA 3MTGA 3TE7A 5L3SA 4ICIA 1UP7A 3DCJA 4I6EA 4ZZ0A 1NJ8A 4MGHA 3TZ6A 3V34A 1VP9A 4IYJA 1JDUA 4PX5A 4LFCB 3ROQA 2FPUA 2QD5A 4J7XA 5LP6C 4IP0A 3K70C 1ISMA 3MWKA 4ZVQA 4BE9A 3VNBA 4CF7A 2QQ5A 4WKCA 5E7JA 3TAUA 4MKGA 3TSYA 4HB2A 2R6ZA 3W2IA 4F9EA 3A1CA 3D8RA 3KUDA 3LLVA 5TQJA 4BKMA 1IUNA 3I6MA 1R12A 2ECQA 3I83A 4PRZA 4QL3A 1CW2B 1U5BB 2JJ8A 4LOLA 4MVJF 3CNLA 3IV6A 5KJFA 3G5UA 4TMWA 4DV0B 3RBVA 1G9XA 2FRVA 1BQEA 1VE1A 3ZQ4A 1ZNWA 2FR0A 3ZJYA 1U63A 5IXJA 3AERA 4MWBA 2WAXA 3RHFA 2OY0A 3TEFA 4EYSA 4MDFA 1MX9A 4PHGA 3NTVA 3WLRA 4YT2A 4R1UA 1E6LA 1E7WA 2ZBUA 1MAAA 1KBOA 2FN4A 3THXA 2V6FA 2XGGA 4WCFB 5KQSA 1F06A 5A06A 2JBWA 2NXCA 2NSHA 2XHZA 3KU1A 2F3RA 1XZEA 2VLBA 2ZWAA 3CLSD 1OAAA 1SKYE 4MZXA 1AKYA 2XUJA 3O8DA 4PO8A 5IDYA 4BEJA 4E70A 3JATB 1WE2A 4BX0A 1CIVA 4CF4A 5HOEA 4MKRA 3OJCA 4OUKX 4PF1A 4Y1GA 3JSAA 3VAYA 1KDPA 3IT1A 3ZNQA 5LN1A 3IVGA 2PKRA 3CLHA 3N3BC 3IQZA 2AC2A 5LZ2A 1IY8A 1JR3E 3EXHA 4UM8B 1QO7A 2R1VB 4B3BA 4DVGA 1IDOA 3GNSA 4OP2A 3VNRA 2QSYA 3RIMA 1Y5MA 1FFAA 2E5FA 3VUFA 2HMYB 1T1RA 3UMFA 4PZ0A 3QHQA 4EPYA 1HV8A 1G6HA 1Z6AA 1NR5A 3GA0A 4QX6A 1P2SA 1SR8A 3O90A 4KN5A 4PO3X 5FPHA 5HUQA 5EUMA 3R3ZA 1ZLYA 2WMDA 3TQFA 4EW1A 1NOIA 3FOWA 1UBMS 3L6BA 3ZCRA 2A5YB 4B3MB 3I72A 5EIAA 2A59A 3AH8A 4JELA 4OQMA 3M1AA 3OEYA 4MKZA 4C05A 1ONNA 3BN3A 1TMGE 3QXSA 2WB2A 3CKKA 4L7QA 5ANRB 4BNVA 4FLFA 4UM5A 4HQKA 4OXNA 5LZ5A 1SEPA 3EVGA 3PQ2A 4I1SA 2VPIA 3LKZA 3NOXA 4XWWA 3MJCA 1GUAA 3EFHA 4YK7A 1K6IA 1M1YE 1V35A 1KO4A 5JJIA 1KYZA 3DMPA 5ICFA 3GLFB 2Z2IA 1UZAA 5DK6A 1G6OA 2GASA 3CC8A 5KCMA 2GAJA 3D59A 5CA0A 4DDVA 1F7UA 1KOJA 3ZZUA 1EFPB 1XTQA 4YLEA 1C1DA 2BDEA 3GG9A 1F5SA 4RNDB 1Z0KA 5IC5A 4ZDWA 2ORYA 4Y2PA 3K5WA 2NSJA 2ANBA 4Q9JA 2YW9A 5CEJA 3E3AA 1OAOC 2IKSA 3KP1A 2XYVA 1FFHA 1NL3A 2RC5A 5FLEX 5LA6A 4URUR 1XDBA 4K9QA 2DC1A 1I2MA 2X2PA 1TAQA 1HT3A 4KQKA 3IT3A 4BGUA 3T3NA 3X1DA 1LX7A 3WL4A 1GPBA 1NVDA 1YZQA 4IHAA 4R9VA 5K3AA 1KZ4A 3M1LA 2YWCA 3M6IA 3GCGA 2RD2A 3ONVA 3AOEA 4X91A 3ZX4A 2B82A 3LYHA 3VU1A 5C9ZA 3D6UA 3KALA 1JAIA 3QXHA 4C2AA 3Q2IA 3LQRA 1T29A 4UUOA 3O4IA 1Q20A 4UHFA 4ZO4A 2IOFK 4ARIA 4WECA 3T3DA 2QTAA 5KS2A 1T4MA 5EC8A 3ELYA 2W0SA 3OECA 3UKOA 4ADSG 2V0GA 2B7BA 2Z5LA 3M6MD 1QAMA 2EJVA 1PT8A 2GM5A 1RWOA 3OX4A 4PCVA 1HLPA 3KPUA 3CX4A 4FFSA 3OZUA 2NTEA 1NRWA 2Q2QA 3RC7A 3AOGA 1TM2A 2J8ZA 4NBNA 5I9SA 2QSUA 1RXUA 2P40A 3D4NA 4LE2A 4AWAA 3RS9A 4EG4A 3MD9A 3LECA 1LK0A 1ONOA 3OLZA 4DMKA 3L8EA 5KWSA 2BMWA 1YQDA 1WV0A 3A1FA 2AG0A 3CZPA 5CX1A 3VU3A 1LLFA 1CUJA 3MJ4A 3G8DA 3ZXYA 4CHTA 4ND1A 5TLSA 3OQMA 2DF8A 1ESEA 5LB2A 5LZ8A 3X1MA 2JFZA 1BGWA 2GEKA 2OBNA 4P3KA 1PNQA 5AUNB 4NMWA 5EPOA 3X43A 4EA9A 4PHTA 3WK6A 1BMTA 4QGGA 2BM9A 1A82A 1I4WA 1Z0UA 2WMOB 1OYOA 4DQDA 4E5MA 1RWMA 5EJ8A 4WXRA 4P5PA 3AL0C 1Z26A 1P6QA 1UKZA 3EDYA 4PZEA 2ZIEA 4ZVMA 2OBXA 4LGMA 1WBBA 4LY6A 3G2NA 5THKA 4Q7JB 3CX8A 4H08A 1OU4A 1QDEA 3OO1A 3WJ1A 1ABBA 1K4KA 1PZXA 3QVLA 5B1YA 2PSJA 3CLKA 1N25A 3IXMA 1NOKA 1NIJA 3IHWA 1NLZA 3KQVA 1FP1D 4QBGB 2V7BA 5K03A 4G25A 4JUIA 2RHTA 4DCOA 1ZJJA 4CM5A 4JT4A 3GA7A 4DBLE 3TLXA 4RQUA 2WF6A 4LCJA 2GK7A 1O95D 1OFVA 2ZTHA 3ESQA 3HYTA 2QQFA 1N2GA 1SUWA 3Q11A 3BA6A 1ECFA 2A7QA 3S29A 3PI6A 3WAGA 3R9XB 3IC5A 3HMKA 3VSCA 1VIVA 3HBAA 4LY9A 5GIOE 5LA6B 4ZEVA 5T6MA 4U2CA 1NAIA 1G2OA 1HZJA 1LQTA 1CF2O 3ZS8A 5AW0A 2J0UA 2AFIB 4KO8A 4RYLA 2B36A 1E7RA 4AJ9A 5DM60 4OQNA 4PPFA 4QBKA 2C1ZA 3RRJA 3QNUA 3WRXA 2ERXA 2ODAA 3AUKA 3TYXA 4F6CA 2X3FA 3DUWA 3I9NA 4J0GA 3SXUA 3BXXA 3NUGA 3G0DA 1M1YB 4RIFA 3TLGB 4B81A 1AS3A 4CJXA 5JXGA 4GSKA 1N33B 1UDBA 3R41A 1UPXA 3AO0B 4N76A 1DDOA 1ULAA 2YJ4A 1Y9DA 4K7JA 1PJLA 3FYTA 4LK2A 1DC5A 2Z04A 3CU5A 4IOLA 2Q4OA 3A70A 1KDYA 1I2BA 1OZFA 1P3JA 2ES4A 4TWRA 1BXKA 1IQPA 4BKUA 1P0CA 2FSFA 3KM0A 1NFRA 5I4BA 4ZREA 3TINA 4D8XA 1T6ZA 4M76B 1JXMA 2XODA 1RADA 3TZEA 3WIDA 2D2FA 1T9AA 2P1DA 4MW2A 4P36A 4JQZA 3RYHB 2A9RA 2VA9A 1JHDA 5JRDS 8LDHA 2B8TA 4UBJA 4PGHA 3QPUA 1ADJA 1ZIDA 5AT1A 1PNVA 3JD1A 2ZVQX 1E3JA 3KBOA 3L77A 3M49A 4NF2A 2XVYA 4KIGA 3AYXB 3T41A 2XXAA 2KPOA 4M89A 3ZE8A 2GCPA 4J4HA 4RFVA 2OP0A 2WT4A 1V5WA 4JGIA 4DS3A 1XAGA 2UZ4A 3UWMA 2ZROA 1IPEA 3BH7A 5HF9A 3NGLA 3C1UA 3M4YA 1F14A 3BERA 3NG1A 4LMPA 3AB7A 3I2KA 5AI6A 1S3GA 3TFWA 5ECYA 4AKTA 1H0KA 1BOOA 5AFSA 4WT7A 4PRKA 3QSGA 1UIRA 1G8MA 5CVEA 1QTNA 2O0JA 3FB1A 1E3MA 1NNLA 1DARA 1UP6A 3P2KA 5CT5A 3HYNA 5GMOA 4LW8A 4JI6B 3VHQA 2ZAGA 4MOWA 2P69A 4YJ2F 4EUHA 4KPFC 3PLNA 3T5AA 1OI3A 2WJHA 3PFHA 4WN3A 3GLTA 1B0AA 3WYGA 1R64A 4WGGA 1W6RA 1B8OA 2X6QA 2YWXA 5ERYA 1T2VA 3RTAA 4BQQA 4K6GA 4OKSA 4RF3A 2RGNC 1FS4A 2A84A 4S3MA 3G82C 5FOTA 3WY9A 2CL0X 1ZAYA 4U5XA 1LK7A 2AWOA 5T67A 3C48A 1EFVA 2FCAA 1AKTA 2ZI4A 5H70A 4Z3DA 5IH7A 3RJZA 1X86B 4F8JA 4D3XA 2RGDA 2OR3A 4B5KA 5HM6A 1QQAA 1S3IA 2I3GA 4U7TB 1LX6A 2VEOA 3U3XA 1RAHA 3WZLA 5F4ZA 5JW6A 3BXOA 3HE3A 1TADA 1T10A 3C87A 2O4UX 3H3XA 3NKVA 4FSHA 4TV8F 5FBHA 4Q47A 4WERA 3DEKA 5BR4A 1U2GC 1QDLB 2ATEA 3O1HB 1GARA 4E2XA 2CJYA 2CXRA 1L7VC 4NOMA 1AUVA 1B6GA 3NHLA 3N74A 5HBGA 3WLOA 5BNFA 2YVAA 4Q7EA 4E30A 3AYZB 4HGPA 1D2AA 3ZDFA 3A3YA 3UXHA 2O8CB 4XQGA 4JUAA 2XKAA 3NJ8A 1P9LA 2QRZA 4RSRA 3TLGA 1CR1A 4H16A 2DTXA 1DJPA 1HDYA 2Q2OA 3TI7A 2QBYA 3M9LA 2NX2A 2B8NA 1Z28A 3G0IA 2IY8A 1N8TA 5EKUA 2Y6UA 1KBZA 4IGKA 4MP6A 3LBAA 3H9QA 5HFNA 3H42B 3ICOA 2WIGA 3ZI0A 4K1XA 4F92B 2V74B 2VAMA 3ZCXA 3WQQA 4EI2A 1OJ7A 2IUSA 4FFMA 4RAQA 4UTNA 3U44B 1YA6A 2IRWA 1DC3A 3QY9A 3UYLA 4FVTA 2V3WA 3RSGA 2DP4E 2WMYA 5M34A 1GU1A 2XMZA 1PT7A 2CZGA 2JHGA 2X0JA 3AUXA 3KEGA 3KSDO 2PL3A 1E0SA 5GTDA 2H18A 3HP4A 4WIAA 4WUTA 3BGDA 3HY4A 4JODA 2HI0A 1YD7A 4AZ3B 1R0CA 4ZV4A 5H8WA 4FQ5A 4MUGA 4HWOA 3WBBA 4GVPA 5ALIA 2P62A 5BR8B 2WRZA 3CH5A 2JATA 1EK5A 1QMPA 1VL8A 3MM4A 4OMDA 3LLCA 3NOOA 3C3XA 1XCLA 3RYHA 5DKFA 1KI6A 3AU8A 1H05A 3CYFA 3KXDA 2VXBA 3NBFA 1G3QA 2VNJA 3LS2A 5FUWA 2EX1A 1J9EA 2FZGA 2Q2NA 3D2BA 2I7VA 3HFSA 3E9MA 4E1VA 2YMMA 2ZRMA 2Q3CA 4AMGA 4UU1A 4Q15A 2ZJ5A 1EWKA 1SZDA 2COEA 1LVUA 3Q3HA 2I22A 2EWMA 2DUMA 3WYAA 4FBLA 4OQZA 3DGEC 4LI3X 4S1VA 2D2EA 2I6QA 2WJAA 5JSKA 5K8CA 3ASYA 4WOCA 1GTRA 5FLYA 2FMHA 4L3WA 5AM5A 4MKFA 4Q4HA 3UF0A 4GM4A 3MB5A 3ULKA 1WB9A 3DMFA 3DA8A 1MO4A 1WDTA 4URYR 4RKQA 4A91A 1GZ7A 1YDHA 5MGNA 3JQBC 5U9CA 3TTTA 3IKLA 3PTZA 4JBLA 4PINA 4Q19A 2W2NA 2HPVA 3FUCA 5IVHA 1N2CB 1UEIA 1TEXA 3EOAI 4ZOAA 1P1IA 1VIMA 3DDWA 4KPEC 4UJ5A 4YQYA 3HI4A 2Y76A 5KWIA 2BM1A 4A6XA 2IDMA 4B35A 3A6GA 1MH9A 4FZJA 3FIJA 4HB4A 4D99A 2XGSA 2HUNA 4G1UC 1V43A 4NICA 4XAQA 1I0LA 1VB3A 2DEUA 1JFVA 1NJSA 2V6JA 1O57A 2W2QA 2WNHA 5C37A 4N48A 1LDMA 2OM2A 3ESCA 2DHEA 3OE7A 4YP0A 1G0OA 3KZMA 1J22A 2BR4A 3W8EA 4DRXA 2CXSA 1V8OA 1E2QA 5C52B 5MFZA 3HHPA 4R05A 4HZUB 3BE8A 2C5EA 2RH4A 3EE6A 4YUWA 2BDUA 4L95C 1L8OA 1QPBA 3PQ5A 4MWSA 2QS9A 3PJFA 1FRQA 3Q7SA 3TR6A 1C7RA 1VL1A 3EZFA 3STUA 4WBSA 4Q4LA 3WL3A 3B52X 1HNNA 2P9BA 3LXXA 5FWXA 4HB0A 2IBSA 5HIJA 2I76A 2HX1A 3RO7A 1MQ8B 2B5OA 2IZ6A 3PUHA 1RJEA 3K6KA 3I6YA 4N18A 4WE3A 2E6KA 2Y1LA 1U9IC 3TMYA 2YIDA 2XGMA 3GVXA 3RUCA 1CX9B 5KYKA 3V1LA 4KQ2A 3T1YB 4P35A 3OFND 3RSCA 2C2GA 4Q4CA 1M74A 3HUEA 2E7ZA 4DY4A 2J9YB 2GZHA 4ALMA 1W30A 1JG3A 2E2WA 3HO8A 1Z4QA 3PXCX 4CKEA 2F00A 3LU1A 5CW1A 1W88A 1SUSA 4ZPXA 3FHLA 1PZNA 4RXUA 1ZCJA 3RJTA 1T1SA 4R7TA 5BSVA 1JEJA 2HIMA 1X0XA 4H9GA 1BDIA 4AULA 4QU8A 3W6UA 1E7QA 3GELA 4URXR 1TKBA 3N9IA 4KMSA 3U80A 5FOUA 1CUIA 3LF1A 3KOZA 4B4VA 1Y1QA 4ZTUB 2HMUA 3VYRB 3VZQA 2GN9A 2HEGA 1L7EA 1TM3E 3D6MA 2WFZA 3IVAA 3O74A 4M9UA 1TKCA 4GKKB 4ME6A 3CG0A 1NJFA 1F3LA 4LZPA 3AUSA 3ZE6A 3LDAA 3W5DA 2XTAA 5AK3A 1SXJC 3IOMA 2NPOA 1OX6A 3VVMA 1JEYA 2HRZA 2IF2A 4OI0A 1EFUA 2G80A 3QF7A 3TJRA 3G2KA 1ISRA 1N7IA 3RSHA 2WAOA 1G2PA 4JBXA 4TV9B 4R9UC 2GX6A 2JHCA 4EHNA 4QTYA 4OQ4A 3NVDA 4B31A 4YRQA 2F8MA 3I3SR 1G4HA 2FPPB 4GL4A 2C9BA 3QU7A 4TS1A 3TQHA 4J75A 2TMYA 4FYMA 1VSVA 3SD7A 4ZK6A 5CDFE 5ALZA 3AERB 4Y0VA 2BGJA 2PS9A 4NVRA 5TR9A 4REOA 1YU9A 8ADHA 1A4IA 2XEXA 3L4SO 3MINB 1YSCA 3L5OA 3FUVA 2ZB7A 4HMPA 2RHGB 1GLNA 4ZRMA 1SHJA 2ZYRA 4WK0B 5FEMA 1GGFA 3Q3VA 3B60A 2EL9A 4J29A 4KK4A 5GJBA 2NT3A 4A2WA 3BWXA 1E63A 4G36A 3KYCB 4N6NA 4V0OA 4FSXA 1ZD2P 3VR6H 6REQB 1C5KA 4BP3A 5FV4A 2AMLA 4P81A 5MF6A 5AUOB 1A8QA 3N1UA 4X9XA 4DCJA 2EZ8A 2JIDA 1KDRA 2VDQB 3N2GA 3NHWA 1NVVR 5BP7A 4LF7B 1JIXA 2GF2A 3IPCA 1K6XA 4IRXA 4UDYX 1YH3A 4TUYF 4LYGA 5FT9A 3RKRA 5JXHA 1YBVA 4TKLA 2ZCVA 4H4EA 4ZOEA 7MDHA 1J5PA 1WD5A 4QM7A 1IN8A 4BJHB 2ZIXA 4RNCA 3HJCA 1TZBA 3ZWVA 1BG6A 3UQZA 4YCJA 2I4MA 3E05A 3HCRA 1HYQA 2ACKA 3HBFA 3OCXA 3IQWA 4OFBA 1XCBA 3EQ9A 5A9SB 2D0PB 3IUJA 3ZR4B 2H8KA 2BY4A 3F6BX 1UR5A 4UPEA 2QJOA 4A36A 2O7QA 4GOKA 4DQUA 3ZWQA 2BJWA 2YICA 3JAWA 4LWOA 4E33A 5I7VA 3OJOA 5MHTA 1DFIA 2WYUA 1XRNA 4M83A 1G7TA 1PFQA 2VBGA 2BSXA 1UJCA 3KX2A 4P33A 1N7JA 4C4TA 3U1VA 4Z1OA 1QG0A 4IPTA 2V4UA 4QYTA 4UBMA 4CODB 2KW5A 4IX9A 2A1UB 1JXQA 2REXB 3N0TA 4GXNA 4IHJA 1WMAA 2QR3A 4QXRA 1Z3CA 2Z5GA 3LVFO 1C0KA 1W0KA 3I0ZA 4OF4A 2YZGA 4CM7A 4OHFA 1VCIA 2GN6A 2PBLA 3AV0B 1ZSNA 4D97A 2JFHA 3D4OA 4DNQA 4ZJZA 5HYVA 4KCGA 2J0VA 4ZCMA 3FYDA 4W8HA 2XZLA 1RXSA 2FSIA 1KJJA 1WMEA 1YQTA 3CX6A 3I4CA 4BEWA 1BX1A 1F4PA 1TIKA 2TECE 1W9HA 3D0QA 3UMJA 2FR8C 1GZHB 4RIEA 1ZK3A 4YMVA 1THZA 1PNRA 3VO9A 2YWJA 3MJTA 3B1FA 3DO8A 1E1DA 1FVOA 3DBLA 1X80A 3BEOA 1ZM4A 3K0KA 3QENA 3DL7A 4MQ6A 3SLRA 4E2FA 2W2VA 5B1IA 4KXMA 2O8DB 4EPVA 3T5DA 4BFTA 1RPNA 4I66A 4RORA 5JXWA 1M73E 1NJGA 2BBWA 1K5HA 1DTWB 1Q0UA 3C4JA 1XO1A 3IPYA 3LCCA 3PDJA 3D4BA 4MVXA 5G02A 1HLFA 1PW7A 3F3MA 1MXHA 5ECWA 3OA2A 2W6JD 4LMBA 3O8NA 2WIBA 4EKEA 3JWJA 3KD2A 3CISA 1HFJA 2VT7A 4Q1DA 4W4TA 3C16C 2OOSA 2HEIA 4N03A 1YR6A 2YFYA 3GW8A 4TXNA 4L8FA 1OT5A 2X22A 4QJIA 1YI0A 5AJTA 4RHYA 4HX2A 2GFHA 1Y4ZA 3JALA 1GHTA 4AUNA 4BCBA 3HA2A 2PAAA 4U6QA 2A0FA 2I80A 1KAOA 1JBEA 4JYPA 4CMGA 4EI9A 5ESDA 2BFMA 4D0SA 3GLGE 2I6SA 4Y9UA 3N7TA 4DV2B 5ALKA 1UBSB 4H1UA 4L4YA 2CNWD 1XDGA 2H59A 3ECSA 1DRJA 1R0YA 2AUNA 3WK9A 1C4XA 1AKEA 4CMEA 3NV9A 4HH3C 3D5EA 3N2ZB 3QOWA 6AT1A 3Q3IA 5CB8A 3F7NA 1II8B 1NYLA 1XEWX 3U7QB 1GPNA 1C2TA 1OV6A 3V7FA 2YS6A 4D8VA 4DJAA 1V7ZA 2P2YA 4XD7D 5KVSA 3F46A 1RWNA 2Y8EA 3IOYA 3P2MA 4NYIR 4NYMR 2FTKE 3NORA 1RHMA 4G07A 5DFAA 5DM0A 4ON9A 4IQ0A 1K9SA 1Z38A 3ANMA 5HIMA 2WVAA 2FZCA 3CJQA 3S7ZA 1V4NA 2HT6A 3FB4A 4AKGA 4DG8A 1E59A 3PHBE 1OSNA 3HNPA 4FNAA 4PN7A 3SYNA 3ZE7A 1M2OB 1RM4A 3KLNA 3Q5EA 1N5IA 1ND6A 1WA5A 2CYCA 4JLDA 4Z4GA 1VI6A 2CDNA 2DBZA 2IEIA 2MYPA 2CXTA 1IG0A 2OHOA 4URWR 5K0LA 4HRVA 3E5RA 1LNSA 2IE0A 4JENA 5HILA 4CFSA 1P8JA 4KZPA 4O5OA 3WQSB 3HCBA 5I7WA 5JFGA 4HDCA 2P1ZA 1FSZA 5IAJA 2J31A 4TXJA 2OO7A 3BC1A 2OSBA 1A2BA 2CNDA 2Q27A 3DQQA 1RLMA 3FCEA 3OX1A 4HDOB 1TCUA 5D6NA 2VDOB 4FB4A 3SVTA 3DJFA 1ODFA 3GFTA 3OLVA 5JS2A 1JEQB 1Q92A 4L22A 4R8RA 2RAFA 2Z1DA 5CLJA