The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
114
|
structure length |
114
|
Chain Sequence |
TLIYKILSRAEWDAAKAQGRFEGSAMDLADGFIHLSAGEQAQETAAKWFRGQANLVLLAVEAEPMGEDLKWEASRGGARFPHLYRPLLVSEVTREADLDLDADGVPQLGDHLAL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the Hypothetical Protein from Caulobacter Crescentus.
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Caulobacter vibrioides
|
molecule keywords |
Hypothetical protein CC0527
|
total genus |
28
|
structure length |
114
|
sequence length |
114
|
ec nomenclature | |
pdb deposition date | 2006-11-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06108 | DUF952 | Protein of unknown function (DUF952) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | ADP-ribosylation fold | ADP-ribosylation fold |
#chains in the Genus database with same CATH superfamily 2O0P A; 2JQN A; 2O0Q A; #chains in the Genus database with same CATH topology 4EYY Q; 2JQN A; 1WFX A; 2O0P A; 2HW2 A; 2AUA A; 2O0Q A; #chains in the Genus database with same CATH homology 4EYY Q; 2JQN A; 1WFX A; 2O0P A; 2HW2 A; 2O0Q A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...