1WFXA

Crystal structure of ape0204 from aeropyrum pernix
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
180
structure length
180
Chain Sequence
VRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RNA 2'-Phosphotransferase from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Probable RNA 2'-phosphotransferase
total genus 46
structure length 180
sequence length 180
ec nomenclature ec 2.7.-.-:
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wfxA01
3.20.170.30 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 1wfxA02
1WFXA
chains in the Genus database with same CATH superfamily
2ZXHA 3CESA 1AU7A 4NC8A 3IP4B 1P4AA 1J7KA 4Y33A 4U0YA 4RB2C 4L5EA 4RLFA 3RTRA 3OYCA 4OINF 4B1RA 5J3LA 3F8CA 2VJ5A 2QVOA 3EUAA 3JRIA 3CCMI 1IO2A 3K2AA 4DBQA 1ONVA 4II3A 1E3OC 1S7OA 2W4SA 2HXIA 4E6KG 1WJDA 3ZOBA 4YFKF 5CQGA 1T08B 5JHFA 1TW3A 1WHUA 2VJ4A 5FFZA 3BR0A 2MH9A 2VXZA 2KJCA 1K7AA 4FETA 4AU7A 2X9DA 3BR3A 3QOPA 1HW5A 4HSTA 3E5UA 4N9HA 3H9QA 2R7DA 1IRGA 1HCRA 2VQCA 1MMSA 5DTDA 5J1UA 2XF7A 3SQNA 1YQAA 5JI6A 2YPRA 3K2ZA 4HF0A 1YX5A 4IEJA 2GLOA 5EGOA 3BG3A 1XC5A 2WAFA 4HX8A 1T6SA 3GW2A 1S7EA 2B0LA 4LMYA 3E6MA 1R71A 1OCPA 1JUSA 4M3GA 4DYQA 2Q1ZB 2L9VA 2AQFA 3KP5A 3HTUA 2DOAA 2L5QA 1K4TA 1R4MB 3KP7A 3LSIA 1XDUA 3KP4A 4C9YA 2VBWA 1BI0A 1LKXA 1RR7A 2DMPA 2FU4A 2J5PA 5TISC 1YFHA 3TGNA 1BI2A 3BG7A 4DBRA 1K6YA 3HZJA 4LLGF 3N4MA 2EIJH 3IRRA 1EH8A 3CCSI 5EDNA 1CF7A 4MEXF 2XPVA 2DMUA 1X1PA 3M1EA 2FOKA 4KDPA 2EFPA 2ZKZA 1LPQA 3HIFA 1JT6A 2BEOA 2XRLA 4JQFA 3BTJA 4IQJA 3E1SA 4U88A 4X6AJ 1WPKA 3NWSA 3I58A 4L5IA 3H35A 4U0WA 3I4PA 2LKXA 1HKTA 4EGYA 3AFHA 2HTSA 3TDZC 4LIVA 4D5CA 1JKPC 5DUKA 3TO7A 4UUSA 1QHHD 1EH7A 1E3HA 2VKDA 1BOBA 2KIFA 1OCCH 1BR2A 2LD5A 4IXAA 3JRGA 1FZPB 4A0YA 1RETA 4HAMA 3CMAI 2NNYA 5DDGA 1UMQA 5AONA 2LMDA 2K27A 1BL0A 3U2RA 1GV2A 2HQAA 2DT7B 3A4CA 3WHCA 1P92A 3FM5A 3SHFA 2YU3A 3L2QA 1FC3A 3HOUJ 4XIDA 5F1RA 1MBKA 2EH3A 3K10A 2JPCA 3HJEA 1BR4A 2K9MA 3B02A 3LL7A 4LLNA 4EQQA 3KYDB 3T1BA 2H09A 4XKWA 5IOZA 5LRSA 3NARA 2CUFA 2E7XA 1NG7A 4M6YA 3AL0B 3IH2A 4EMSA 1YO5C 1L3LA 4IHVA 1SAUA 2AS5F 3BTIA 3L9FA 3J81Z 4BY7J 1Q1HA 3K69A 5CVVA 3F6OA 3BWGA 3GTQJ 2HQ5A 2WV1A 3SFZA 3QPLA 3OSGA 5FKOA 2MW8A 1H88C 1D3YA 5ERIA 1PP8F 1W7PB 2FA5A 5J1YA 3AG4H 1VQPI 4JBAA 3LSJA 3CC7I 5B1BH 2CV0A 3MKLA 4BKXA 2M87A 1X1DA 2H94A 1WJAA 2HVQA 3DV8A 1IN5A 2BYVE 3BTLA 1WVRA 3PSIA 2M45A 1IUYA 3V8KA 3S3OA 1LE8B 5IT9Z 1S72I 3ASOH 4M6VA 1B72A 1JUPA 2LY2A 2OPTA 3FF5A 5F64A 2E1CA 1VQ4I 4IOAF 3CCQI 3HBLA 1D1AA 1Z9CA 1Y8RB 2G9WA 4A3BJ 1FT9A 1USTA 1CQTA 1GVDA 2KDOA 2Y0MA 1OPCA 2JUCA 3PUFA 3L09A 5LGTA 1DP3A 1J09A 1QZYA 2KQRA 5ILSA 4Y13A 3HTSB 2IRFG 3ZMTA 5K1YA 4B8XA 3DU5A 5E3MA 2H1KA 3UNGC 1DPRA 3U1DA 5J6XA 1WH7A 1JGGA 1JHFA 1HA8A 2F5CA 4CGZA 2ZBKA 2EFNA 3ZMSA 2PN6A 4CH7A 4DOZA 5LBQA 4RGUA 5HS8A 4A3GJ 5CYVA 4CZZA 4RBOA 5KAIC 3HL2A 2BY2A 3JREA 1J59A 2P4WA 3WTYC 4ESBA 3W2WA 1B6AA 4A69C 1ETXA 5GPAA 1JT0A 3E3VA 3LWFA 1R6RA 4XLFA 2JWTA 2O0QA 2VONA 1JHHA 4RAGA 2B9SA 2L9SA 3CO7C 1MW7A 2WB1A 3R61A 4L9TA 2FX0A 2WADA 1REPC 1XGMA 4W1UA 2QCOA 3CCVI 3TDUC 1YTYA 4I98B 2ECBA 2LG4A 2H27A 1LE8A 3PIPF 1LVAA 3VSLA 2Q8KA 1WCMJ 3J7AY 1B72B 3LSMA 2DYRH 3CF2A 2FRHA 4N9IA 3D0SA 1YJNI 4XSZF 4EJVA 5AIQA 2K4BA 3MQ0A 4AWXB 4OIOF 1E0EA 2L3DA 4G7OF 3ZQCA 1TL8A 5FD5A 4LGWA 2JUGA 4UB6C 2Y48A 3IL2A 4MIMA 2QA4I 2ADUA 3OYEA 1PUEE 4HX4A 1T98A 1RUNA 2O6GE 3G1LA 3LAPA 2E60A 1EV7A 1BJAA 3L2UA 1XDSA 5ILUA 2CV2A 2F5EA 2GQQA 2H8WA 1R5HA 1WJEA 2G0EA 2L7FP 3ZQLA 5LEKA 5KHDA 1Y0NA 4P9UA 4IO9F 3LOCA 4LG0B 3M07A 4PK4A 1P7IA 1BW6A 4GCVA 1W5TA 1Z1DA 2ZSIB 5K5QA 4U7DA 3FISA 2DAOA 2G7UA 2O0YA 2IA2A 3ABUA 5DCMA 5F6FA 4YEJA 2DO7A 3NQOA 4CCNA 2XC7A 4BH9A 3U1KA 1ODDA 3DPLC 3AL0C 3H9GA 3HG9A 3IHUA 4BHPA 2IS6A 4XORA 4HDVA 3SYTA 5HLIA 3JRAA 2W00A 3ZP5A 1MMDA 5BNGA 1ZAOA 2EJRA 3TO9A 4E7HA 1PJRA 4LFUA 3HOVJ 3OYAA 3CC4I 1MBEA 5K5RA 1MMAA 3OV8A 1LVKA 2F5FA 5E18F 3DEUA 1OLTA 3O6BB 1B9NA 1YJWI 1FOYA 2ACJA 2GIVA 4U7BA 1U78A 2E2HJ 4E7KA 3TQNA 1XPXA 3LSTA 3VOEA 3FMSA 1UAAA 1YOVB 2K9LA 4B44A 4L0ZB 4CCKA 3OSFA 4DJAA 4A3KJ 2DPUA 2ZJPF 3P7NA 2RVCA 1G3SA 4O5VA 5J4VA 1FBQA 3H5NA 2W82A 3GTGJ 3F21A 1K83J 2LK2A 2MD0A 3HUGB 4M6XA 5B5EC 3I53A 3H0DA 2DXIA 2VOPA 2Y0SN 1BBYA 1G3WA 3MZHA 5FROA 2RREA 3JAMZ 5HS9A 3F6VA 5KNLA 1WH5A 4Z6YA 3WG9A 3DF8A 3SZTA 1AWCA 1ZARA 4A3MJ 1KQ9A 4A93J 2QEXI 1IZ1A 2O8XA 2Q2EA 2FMYA 4DYCA 3CCEI 2RN7A 3GYHX 2RNGA 3ZQQA 3S93A 3ABLH 4BEHA 2RKHA 3HYIA 1ERDA 3OYHA 2O5RA 3DBLB 2VC1A 2OD5A 4WF2A 5FKKA 5L3BA 1A35A 2GXAA 2CS3A 3GZ5A 1SD4A 2HYGD 2WTEA 2EZIA 2DFFA 1DUXC 2Y31A 1DGRM 4HLXA 5FKMA 2ETHA 1TWGJ 4Y17A 1KYWA 2IGMA 3F22A 5FLXK 2LNBA 3ULQB 4XRSA 3RPUA 2I5UA 5L3CA 2DDAA 3FM3A 1HOMA 4QSHA 5GADJ 3J7AO 1G8XA 1VQMI 4LOCA 3TOBA 2IT0A 4ZH4F 1MSFC 4MEYF 3CZ6A 3J7ZI 4MFDA 3BZCA 2E35A 5LGNA 1O7LA 1NK2P 1K79A 2VJJA 4PJJA 2E71A 2M4KA 2WV0A 4ON0A 2WY7Q 2O61A 2DK8A 2FQ3A 2HXOA 2VT3A 5E20A 2V1NA 3KZYA 3QYFA 5D5WB 3JRBA 2HQRA 4XN3A 4I01A 1XCVA 2XAUA 4BBSJ 1YRNB 4IHXA 4CCOA 3OYBA 1T39A 1F4KA 1I50J 3J80Z 2CW8A 1IGNA 2XHKA 3KX2A 3QP5A 4S0HB 4EM2A 4E7JA 4PJNA 4U0VA 1FJLA 1MGTA 4HX7A 3BQYA 1VFCA 5ILVA 5GAEJ 1TT0A 3B73A 3SJMA 3ZN0A 1ZG5A 5KCMA 1QZZA 3IAM2 4BQNA 1TWHJ 1QU3A 1G2HA 1X4OA 2HW2A 2OQGA 1MH3A 3M9AA 1XG1A 1RKTA 5GAGJ 2HOAA 2QQAA 3S16J 1FTTA 2YX4A 4HOBA 3BROA 4JX6A 2GOMA 4ENNA 2TCTA 1LEAA 3GLXA 3E5XA 5J8CA 4D9JA 5GAHJ 4HBLA 4AUXA 3CCJI 2R0QC 4BQAA 3VYUB 1ULYA 2FF4A 4HNVA 2X1CA 1A6QA 2W84A 1X1CA 3RI4A 5B1AH 3MD2A 3H3VK 3S14J 1SFUA 2M30A 4O6JA 2FMLA 2F2EA 1EKEA 2VQHA 3WU1B 5JLXA 2Z16A 1XSVA 5L3FA 3A0HC 3KP2A 3OYKA 4MTDA 2GM4A 2QWWA 1LJ9A 1YS7A 2VL8A 4E4HA 2KKOA 1PYVA 1U3EM 2J5OA 4KYWA 4EJTA 3FX3A 1POGA 3WE3A 3LA2A 3QPSA 4IHWA 2ISZA 1SVOA 4HDUA 2VKEA 2DPDA 2LF8A 4KNYA 2JA8J 4QTRA 2IS2A 2E1MB 2PBIA 2QSFX 2QF7A 4C3HJ 2VKHA 3CUQA 2CUJA 3HOXJ 2LVSA 3LA3A 1U8RA 4J01A 3DP7A 4GYIA 3R0AA 3D5RC 4BXXJ 1SFEA 3E6DA 3DPUA 4RB3C 1MMNA 2L7KA 2CJJA 2Z3YA 1EH6A 1UB9A 2DT5A 4AYBA 4HSRA 4B48A 3S3MA 4EV0A 3L2VA 2LFBA 3KP6A 3HPGA 2JSCA 2VQLA 1WJFA 4M71A 2W48A 1JKRC 1FLIA 1D5YA 1J5YA 1QQIA 2DYSH 2XAHA 1GDTA 3HHGA 5DV5A 1YW9A 3VB2A 3KPHA 1XN7A 2BHYA 2VUMJ 1AKHB 1Z3YA 4ZC3A 3HOZJ 4A3JJ 3WGIA 2YU9J 2IA1A 3H9JA 1FIAA 4XSXF 4XBFA 3H1CA 3H5RA 3GFJA 1GHCA 2WAQN 2WY8Q 1MH4A 4ZDPA 2BY3A 2V79A 1FPQA 2OCCH 4I09A 3A03A 4KJZA 1N75A 5BPDA 1DU6A 2OQRA 2LKPA 4UVCA 4KA4A 2JPBA 2DMQA 2KT0A 3HEFA 1RC9A 2CV1A 5HLGA 3GFLA 4P9FA 1X19A 5M5XJ 1XSDA 2R7QA 5E3OA 1E2XA 1Z6RA 1ZK8A 4M73A 1HSTA 4HV6A 5E8GA 5HLTA 5EZGA 5IPAA 2LDUA 2JTVA 5ED4A 1KA8A 1TWAJ 4IHSA 5F1JA 3CUQB 2VXDA 3WTXC 4G7HF 2DOFA 3FZVA 2EA4A 3KIOA 3ASNH 3GX4X 3DWLE 3O8HA 5DS9A 1MNEA 1P9QC 2AXTC 3QYBA 1TC3C 2O8KA 4PGGA 5C4XJ 2MBFA 3IH4A 5D8KB 3PO3J 3CQZJ 1G3YA 4L0YB 3SEZA 2M8GX 3G1OA 3Q0WA 2ZFUA 4JP0A 2V6EA 4A3CJ 3K70C 4C2UA 4ASNA 3H36A 4HPQA 2XGXA 3JRFA 1RUOA 4C2TA 4IRGA 3F72A 3CMEI 1XGNA 1ETWA 3C1DA 4BY1J 2DQLA 1ZTRA 2IXSA 4LK1F 2LP0A 4PJMA 2P8TA 3G73A 3K4NA 1JKOC 1W36C 2R7TA 1G6NA 4KIFA 2DT6A 2XKPA 5M5YJ 2K4JA 3BZKA 1TW2A 2XAFA 5IYCJ 3ZPLA 4FQGA 2ZMEB 1JI8A 4DQ2A 2BXZA 1XMAA 1Z3XA 2FEZA 2CW0F 4BJ5C 3AG3H 4CDGA 1LFUP 2FD5A 1P2FA 1SMTA 3VFZA 5GP9A 4WXDA 4Y52J 3K1MA 5K5OA 2QBYB 3CJTB 5FJ8J 1BA5A 4W97A 1I3QJ 4CYCA 3JRDA 1Y1WJ 2QZ8A 1LFPA 2E5NA 2PFBA 2K3PA 3BCAA 3BG6A 2F48A 3OL3A 3QWLA 3W6JB 3HGYA 3K4JA 4XKCA 5HDGA 1S5LC 5J40A 1G3TA 2L2OA 1UCRA 3TOAA 2RC4A 3GTKJ 2N8GA 2DA7A 2CW7A 3DPTA 2M3AA 2ESNA 2ZC2A 1F5TA 2VLAA 2Q0OA 3K1PA 4F55A 2ZXIA 5BQTA 3C3WA 5CQEA 5FLXZ 2JMWA 1H0MA 3TBIA 4L9NA 2DCEA 4ZTJA 1MBGA 4OIQF 1BIAA 4LD5A 4XOTA 2OZUA 1OMIA 1XX5A 3ECHA 1I27A 2MG4A 1PP7U 3VWBA 2EZKA 3V42A 1QHGA 4ITVA 2DMTA 3FXKA 1JXSA 4CSWA 1ZN2A 2DW4A 4KUMA 4M9SA 1XTAA 2XDVA 3RYRA 3ABTA 3DLAA 2NOGA 3K4CA 4B09A 4II2A 4NQWA 3MAJA 1G59A 5DUIA 1I6HJ 1TTYA 3DU6A 1X2MA 4S04A 1H8AC 1IN4A 3ZN1A 1A36A 3JTHA 3VYSB 3FBNB 1YIJI 2X1EA 1PUFA 2QBYA 2HQNA 3AG1H 3CUQC 4ZTFA 5D8LB 3F8BA 3TP3A 2VOOA 1HXDA 4CYCB 3RSNA 1T0FC 4YFXF 3KZZA 2LBFB 4WXHA 1MBFA 4D5FA 4YG2F 2EQRA 2KLOA 4BACA 1XB4A 1YX3A 1R5GA 4QPQA 4D7NA 1HSJA 2DK5A 1LDDA 2M34A 2XIGA 5IP6A 4PCQA 4E7ZA 4NDLA 1N77A 2PMZN 2AO9A 3OR1C 1OCZH 2OA4A 2R5YA 5ICEA 1WRJA 2GAUA 2KDZA 3W2VA 1B8IA 4PGHA 2E2JJ 3V7RA 4YELA 1JJ8C 4BHCA 1SC7A 5TGTA 1HBXG 3HRSA 1FOWA 4BQQA 4NUBA 2VASA 3FXRA 2PJRA 3GFMA 2DFHA 4PSXA 1BR1A 4CA0A 4ZZLA 2K02A 3RPUD 5K7ZA 3JSPA 3DLLF 3V7SA 1IF1A 3ONQA 3MZ8A 1UG0A 2L7MP 4JK1X 1ETVA 2JN6A 3X2QH 1LDJA 5JVTA 2O7OA 2O9LA 2WWYA 1YW7A 1PUFB 4AVZA 2HR3A 2XF6A 3JRCA 3FXLA 4M3DA 2OJED 1GV5A 3VODA 4F92B 5DM7F 3CLQA 1X3WB 2GIZA 3KEYA 4LB6B 1XMKA 5L3GA 2IS1A 4G12A 4B4CA 2E2IJ 4XKVA 2FNPA 4X0GA 1ZH5A 4Q47A 3PL8A 4LITA 3SEQA 3GTJJ 1UZCA 2R5YB 1DP7P 1YW8A 2NVUB 3G2BA 3TKYA 3OYMA 4XLEA 2E7WA 3H3UA 1R23A 4M9XA 1GT0C 4I0BA 1OCTC 2W1OA 3NRVA 2KIUA 3W2AA 3FKIJ 1N25A 1EA3A 1A5JA 3Q3SA 3I4NJ 4HF2A 3CD6I 2EV0A 3HOWJ 1ITYA 3U9GA 3CF5F 4D0PA 1LEBA 2CMPA 2OAZA 2QM3A 1SVMA 4YIIA 2ISYA 4GFBA 2K40A 4ZYHA 2JA2A 4RMNA 5FGMA 2P5LC 2A07F 5DYMA 5FLMJ 2VT2A 1BC8C 5HNHA 1BC7C 4N4OB 3DKWA 5TJJA 1FY7A 3E97A 2A6EF 1ZR4A 2M0CA 4JX5A 2Z99A 1TWFJ 3F0CA 3O2PE 4Y15A 3MWMA 4XONA 1MJ9A 2EK5A 2HDWA 3VEPA 1XS9A 2A6HF 2IEKA 5A2QK 1RKWA 2X6OA 4KISA 2VODA 5IT9K 2QGUA 5CLSA 3CJQB 3I71A 1R22A 3LQRA 4LIUA 2EWNA 4A5MA 2LKSA 2GWRA 1SFOJ 3JSOA 2V9PA 2BW3B 2ELHA 1SANA 3ISPA 4ENMA 3A02A 2CQKA 4BJTA 4KFCA 1MBJA 3FHNA 1UJ8A 2FJ1A 2XAGA 2V6CA 3I56I 2R7XA 2DMNA 1Z77A 2AUAA 1YI2I 3Q9SA 1CF7B 4M72A 3MEXA 4YIRX 2VBZA 3KEOA 3OS1A 1TT5B 3BR6A 2ZJRF 3T5XA 1BIBA 2K7LA 4HNUA 2BGCA 1IRFA 1XSXA 3DKYA 1VQ9I 2K9SA 2HOEA 3DEEA 2M0MA 1F36A 1I6XA 2CH0A 3HRTA 3J80K 5F0HA 1V54H 4IVNA 4PUSA 5FB2A 1T2KA 3S1NJ 3RKXA 4ZDOA 3N05A 2IW5A 3F8MA 4NC7A 2XGCA 3ERED 3A01A 1VQNI 2L0KA 2PMHA 2FXAA 1J9IA 1P4XA 3WTWC 4GDFA 4U87A 5GTHC 3GWZA 5LHIA 5DD8A 3QPHA 3U21A 4ENKA 1F43A 1U5TB 2X6YA 3T8RA 3EYYA 4FX0A 5E1WA 2D1VA 5FFXA 2HYFA 5EEHA 1RIOH 1W0TA 4G6TB 4HQMA 5HLHA 5E3NA 3F3XA 2FBKA 4KN7X 4F7ZA 2HKOA 5HS7A 3IWFA 3SXYA 1O3QA 1J75A 1OYIA 3WTSC 2RNJA 2RAEA 4E7SA 2HWVA 2K9QA 4L9VA 1R00A 3R4KA 2NYXA 3TW7A 5HDKA 1ZGWA 1TNSA 1IRZA 1SD5A 4JX4A 1ON2A 1WFXA 1KU7A 2IS4A 2HFHA 3ECOA 1MNDA 2W25A 4M3EA 1OISA 1ZLJA 3IAS2 4IHTA 2R7VA 2ZXWH 3MKZA 5ICGA 2X51A 3C7JA 3CDLA 5J47A 4XK4A 5HDNA 4XRMA 4H0EA 1QVUA 2P5VA 1FP2A 4PFOA 4E70A 2HVRA 5B3SH 4EGZA 3ZQHA 4RB0A 1QNTA 3JTGA 1H89C 2ZO4A 2QYOA 3H92A 5CVRA 4WXCA 2E1OA 4UXNA 5FKNA 4A2UA 2HVSA 3S2WA 2XPWA 4E7IA 3CJRB 4Y4RA 3GVAA 1QVTA 4G6QA 3TO6A 4QLCU 2VPRA 4WK8F 1UFMA 1FBUA 2UV1A 2ME6A 3ZQIA 4KITB 1NK3P 4BNCA 2QQ8A 3C18A 3IKVA 3HC7A 5CVIA 2BBYA 2WAQA 5C44J 1MZBA 3I59B 2R7SA 2R7UA 2G7HA 5FRMA 3CJNA 2STWA 2A05A 2I8DA 2F4IA 3E6BA 2DODA 3IWZA 4GYGA 3RKYA 2RQPA 3GF2A 3O8GA 2YR2A 2LY1A 3OR2C 3RZDJ 3FK6A 3LSGA 4OIRF 1I1SA 2PG4A 4Z2YA 3ESWB 4CHUA 2JSPA 3FBIB 3OYNA 3CC2I 2TDXA 3KEQA 1EJ9A 5L3EA 2HPIA 3DTEA 4ZJZA 1GUUA 2OTLI 3QAHA 3EQLF 2CFXA 3KZIC 3BPVA 4HNTA 3P9IA 3FWEA 3BTCA 1Z6TA 1H9TA 2E19A 1RI7A 4IPAA 2FOWA 3ZQGA 3RZOJ 2VI6A 2ZNZA 2CO5A 4F93B 3M8JA 1Y0UA 4I7HA 1SVLA 2BY0A 1FYLA 1O3TA 1KU9A 3GTOJ 4UY8I 3GCMA 3EUHC 2VIXA 3PSFA 4QIWN 4D1QA 2GXGA 3MN2A 1MSEC 1Y8QB 2XGEA 3WHBA 1W0UA 2L4AA 1A04A 1B59A 2CUEA 3HXLA 1I39A 4ANJA 3S2HJ 2KJBA 2XKOA 2PMZA 1DGWY 2GBYA 3CDHA 1YG2A 4KMUX 3BR1A 2YSRA 4A3EJ 2V7FA 1U9OA 3BCBA 1LDKB 3PQKA 1IJWC 2F5VA 1ZELA 3ML6A 3K4BA 5D6FA 2AQEA 4G6DA 4LG0A 4AVPA 1BN5A 1F1ZA 4V2GA 4FT8A 4AIJA 2BVMA 4MHGA 1FOKA 1BOAA 5JVGF 2KRCA 3I64A 1V3FA 2ELJA 1R1VA 4FTHA 3C2HA 2JVHA 2STTA 1R7JA 3K0LA 4XNFA 1P6RA 3PFYA 1U8BA 3HKZN 4A6EA 5M5WJ 2MD5A 4C30A 4UVBA 5J8FA 5D5XB 2DA4A 2DBBA 2B7EA 3CCRI 3B6CA 3P9KA 1RPWA 2RV8A 4EJUA 3MVPA 2ZJQF 3DKXA 2NVTJ 2ZXJA 1VI0A 1OFCX 2XVCA 3AG2H 3P5JA 1ZGJA 4EM1A 1FWZA 4IF4A 2EFQA 4YRVA 2PLYA 2VE8A 3LSPA 2XRNA 1B4AA 1ETKA 4M74A 4BU2A 1H9GA 1V4RA 4CO8A 1HC8A 1RZ4A 4I0AA 1XMXA 4L5JA 1MIJA 3WGGA 5H2FC 2MC4A 2Y30A 4NB5A 3JAMK 2IPQX 3BC8A 2QUFA 4UHTA 4QWQA 2CQQA 3I0TA 2I10A 1QO0D 2JVGA 2Z2SB 2Z5UA 3EUHA 2EV5A 3IH3A 3I3LA 2FBHA 3HUGA 3E0JB 4LB5A 2Y9ZA 1KU2A 4M3FA 2BZTA 3TEDA 2WAEA 2H6CA 5HOOA 1O7FA 1IXCA 1A31A 4JYKA 4H4KC 1WJ5A 3D5LA 4XLPF 4EYYQ 3KE2A 4Q5SF 2V26A 4GO1A 3NEUA 1SD6A 2CSOA 4MGRA 5F08A 4BUPA 2WA0A 1U6GA 1O3RA 1SFKA 5H6RA 2ID3A 5KAFC 1GXPA 2L02A 2Q2EB 3I4MJ 3B6AA 4ZZDA 2XGDA 5DEQA 4A0XA 2DOEA 3H0GJ 3TL4X 4I6ZA 4G8XA 2EFWA 3S3NA 5D4SA 1B9MA 2FBIA 1U2WA 2CRGA 2HDDA 2L01A 3RQ4A 1IW7F 3BZ6A 2QQ9A 2ZB9A 3A2KA 4AC0A 2K85A 3E7LA 3OIQA 9ANTA 2K9NA 5IP9J 2VN2A 3R60A 3KLOA 1YITI 1Z21A 3CTAA 2W24A 3F23A 3M7GA 3T8TA 2L7ZA 1QGPA 4RGRA 3KETA 3WTVC 1CGPA 2KFDA 3KYLA 3G71I 4BQOA 3IRQA 1YLFA 1ZRDA 2JRMA 4PDKA 1X2NA 5B66C 3HOTA 2H6BA 2AXLA 2HDCA 4KICA 5KK1A 5JHUA 5BPIA 1VNDA 1TWCJ 5E17F 4AIDA 4WX9A 4UUSB 2Y75A 1O4XA 5EEGA 4MQ9F 1IG7A 2DFIA 2HZDA 2HZTA 2ZJ2A 1AHDP 3ZMVA 2HOTA 4KIBA 2UZKA 3E5QA 3J81K 2ELKA 1IXSB 1O57A 3HKZA 3G4SI 3I5UA 3BDDA 4ZYEA 1Z05A 3WU0A 2GA2A 1NH3A 4XLHA 1OKRA 4XMYA 2EIKH 4N4NB 1YRNA 4D7MA 3OYJA 1WJBA 2QKMB 4PSWA 3BG5A 4PFPA 2PJPA 2YS9A 2VBXA 2IJLA 4LK0F 2BVLA 5E8IA 3V4GA 1I1GA 5CKTA 5FKLA 2HPMA 3OIOA 1R49A 3LFUA 3GZNB 4IX7A 2W57A 5F27A 3I54A 3LA7A 3LFKA 2XAQA 2EV6A 5E79C 2X0LA 2AHQA 1U5TC 3R6SA 1R4NB 4BGDA 1QA6A 3KLNA 4AD9A 2JQ7A 2A69F 3HHHA 4B43A 4EM0B 1UHMA 1FEXA 4FE4A 1IV6A 2EFOA 2ZMEC 4IRHA 3FXUA 1JE8A 5IP7J 2HNHA 3MKYB 2JJ7A 2XV4S 1X58A 2DJNA 3BT9A 4BXUA 3HOSA 3MFKA 1W7PA 2DI3A 2P7VB 1VQ6I 2JA5J 2V9VA 4HYEA 1ZHFA 4EVIA 1XCBA 2MA3A 2M5WA 2P6TA 4HV5A 3DCFA 4LLLA 2MC3A 3CDIA 5JLWA 1V55H 2UXXA 1JTYA 1LNWA 3A0BC 2R7ZJ 4R8HA 1ZRFA 4E7LA 5JFRA 4LG3A 3RKWA 1ZG1A 2RQQA 1YIOA 1F9NA 5IT3A 3IV5A 1XD7A 2VKVA 3CCLI 4P5OA 2KISA 3ZXSA 2R7FA 1ORKA 3HOYJ 2LH9A 3ZMDA 1OYYA 2R93J 1RESA 3V8LA 3PFIA 1JJ6C 1GVJA 4FE7A 3L1PA 4OU0A 2DLLA 4P55A 2FSWA 1WZ2A 1FIPA 1V5FA 3HGGA 2NS7A 2QSGX 2V1UA 3OL4A 3BPXA 2LF7A 2Y9YA 4KT6A 2E1MC 3Q0UA 1S29A 2NOJB 3TW6A 2JA7J 3M8EA 1OR7A 2MYSA 5IOYA 5D5UB 2LSOA 2VB6A 4Q4ZF 3LMMA 4RLQA 3ZR8X 2XPUA 3ELKA 2OUMA 3QRFF 3D5SC 1NHAA 5TRDA 2FE3A 4YFNF 1WSUA 2CUZA 4ZYDA 2OTJI 2WC2A 3PIOF 4AIKA 2FQ4A 4ESJA 1WI9A 2DJIA 4A3DJ 1R1UA 3HPHA 2EPFA 1ON1A 1LFBA 2A61A 3S15J 1ENHA 3K4LA 1IRXA 5E1XA 1HKSA 2C6YA 3OYGA 4UNOA 4KIGA 3ABMH 3PQJA 2W85A 3DFGA 2TRTA 4HW0A 3ABKH 2XSJC 4XOPA 1Z0XA 2GA1A 4MLOA 1ZR2A 3T0YA 4IZZA 1X1BA 3WTTC 1FTZA 2HI3A 4CCMA 1RRJA 3CP2A 2NVYJ 4XLCA 4CCJA 1HW2A 3WTUC 3I9V2 4NC6A 4RM2A 5LFAA 2EINH 2IBDA 5CVJA 4RB1A 4B3XA 3DBRB 2JA6J 4BL0B 4WWCA 3GTMJ 1T95A 3D1NI 1QBJA 2R3SA 1AOYA 5J4YA 4BBRJ 1QZEA 2Y69H 2VC0A 3KFWX 4RAZA 3VSKA 3ZMUA 5F0FA 3HB9A 1IN6A 4QPOA 1R1TA 5ICCA 1V5GA 5C3EJ 2HEOA 2DU9A 1OJLA 3L00A 4HQEA 2Z9OA 4FCYA 2JRTA 3WU2C 3OYFA 4AYBN 3OMYA 2Y0SA 5DCMB 1ZRCA 3K4MA 1IN7A 2JZYA 2F6CA 1HDPA 2JT1A 5D4RA 2COMA 3S17J 4P1WA 5HVQC 1A6IA 4I76A 2M2EA 3BR5A 5AIPA 3BJ6A 4XR6A 3GMEA 1GXQA 1K61A 1R58A 2KIQA 1JKQC 2VE9A 2DA5A 2L4MA 4DZJA 3WGHA 4RM3A 2XUBA 4ZYGA 3DBHB 1SFXA 5EYRA 2XROA 2KRHA 3GZ6A 3M8FA 4PJLA 1ETYA 3HM5A 1QRYA 1MDMA 4XLAA 2E5ZA 3I55I 1HDDC 2X6WA 1WI3A 2OF7A 4XN0A 2O03A 3SFIA 3OOPA 3FIWA 4HEA2 2MLKA 2LREA 3LSKA 1DU0A 1TLHB 1Z91A 3H5AA 5D5VB 1E17A 4HG2A 1LB2A 1T38A 3CO6C 3GFIA 1S6LA 4XRSG 1MNMC 4DGWB 1VQ7I 2NVQJ 2M7BA 5GPCA 2KRFA 1W5SA 2R7OA 4UUTA 3S1MJ 2Y2ZA 3WE2A 4OMZA 1T0FA 2A3SA 5BMZA 5LLQA 3K1NA 4A0ZA 1HKQA 2W7NA 1JTXA 4BEHB 2LY9A 1ETOA 4I02A 3ERMA 1YJ9I 4OIPF 2D45A 1DQUA 4A5NA 3IKTA 3S1RJ 1RNLA 3UKGA 1PDNC 2R92J 3K4KA 2R5ZA 3ZQFA 1N78A 2LC2A 1YYVA 4BDZA 2F4MB 1KONA 2EIMH 3OS0A 2LLKA 3PJRA 1JGSA 2VQGA 3G3ZA 1T56A 2IGNA 1MDMB 1MBHA 2KP6A 2X1DA 1WGXA 3H3ZA 1ZG3A 1OQYA 1W7PD 4CXFA 4BE0A 1NTCA 5A2QZ 3F9KA 5EG0A 2IGKA 4PZJA 3FXOA 1X4PA 4RGSA 3PNVA 3LNQA 4J19A 2PMUA 3GXOA 4NQWB 3CUOA 4IKFA 2DQRA 4ETSA 1Q1VA 1VQLI 4C3IJ 2CGPA 2HS5A 4RAYA 1UHSA 2BV6A 2CWEA 2DA3A 2IGOA 2FUG2 1RR8C 1K6OA 4N0BA 2PI0A 3L2WA 1YE9A 2LTPA 1ZLKA 3NWTA 2O3FA 5CVUA 1VTNC 5LRRA 3RDIA 1R5ID 5BS6A 3M4OJ 1S8NA 3WODF 2HGCA 5BOXA 4NBQA 5DD4A 5FRNA 1USSA 4I2OA 2CG4A 1X1AA 2YX7A 4B3AA 3RQIA 3FDYA 1J2XA 1STZA 4OMYA 4C2MJ 4G94A 2KHMA 3K6GA 3K70D 4R1HA 4A6DA 1J0RA 1SAXA 2MSYA 1L0OC 3SDBA 1IDYA 1WWXA 3QODA 3QU6A 4X1EA 3CLOA 3RJPA 2NRAC 3S8PA 4GXOA 2R5ZB 4HRIA 4UUVA 3S2DJ 1D8JA 2OV7A 1LQ1A 1FMWA 1VZ0A 2GXBA 3S1QJ 5E3LA 3RPQA 1W1WE 1U0JA 1QPIA 3HSEA 3S32A 5GTIC 4XICA 4UV8A 3FKJA 2DA1A 4S05A 4DNCA 4BE1A 1K78A 2IVMA 2WBMA 2XASA 3QU3A 2ICWG 5EG0B 3BR2A 1TQPA 1FYMA 1MJBA 1OCOH 4EJWA 1MMGA 2VBYA 1IV8A 1C0WA 1KQ0A 4XQFA 4IL6C 3DTIA 2PQ8A 3ZCOA 1ZGAA 4BS9A 2DA2A 4OAYA 4DIQA 1HW1A 4FASD 4CUGA 1IC8A 2DTZA 2OCEA 2HU9A 1Y1VJ 2D1HA 2ESHA 2O0PA 3BOQA 2M4GA 2MFZA 4A3LJ 2NXNB 4EATA 2DA6A 2FNAA 1FMVA 2GOXB 5HODA 3F8FA 4F3QA 4O3MA 2JQNA 1UELB 1IAWA 2M8EA 1V5EA 3LSHA 2X4HA 3TP0A 4MQVA 4RDUA 4KN4X 3M1CA 3HSFA 2R7RA 3CMMA 3E6CC 2R7WA 4XRFA 1YHQI 1X3UA 1ZREA 4UV9A 4M3BA 3BJOA 4I99C 1DPUA 2A68F 2A5YB 1IN8A 4A3FJ 1W5CC 4F91B 2VJIA 5EJCA 1OR7C 4BYYA 3VYTB 1IDZA 3O3KA 5CJ9A 4ESFA 4XKBA 2K86A 3QP6A 4GGGA 2IA0A 2P0WA 4JOMA 3SDGA 4MTEA 4HZFA 3GEZA 3J7YJ 1BW5A 2HOSA 5DCFA 2MLGA 3FXQA 2YUSA 3FK7A 3CCUI 1K78B 3TMOA 2QKLB 2XB5A 1IXRC 3CP8A 3W6VA 1BI1A 1KYZA 2IAIA 4K2EA 2XB0X 1EF4A 3FXMA 4L18B 1MD0A 3ZMZA 2RGVA 1TP4A 4XLNF 2IP2A 4TV7A 3ZGKA 2DFEA 3DXJF 3VPRA 3FHZA 4BXFA 3PM1A 1AKHA 1VQKI 3K7AJ 5IY5H 4WCGA 4IJAA 1S3JA 5LEJA 2XAJA 1P4WA 3LAJA 1E3PA 3BLYA 4CZCA 4BDYA 2JK3A 1D5VA 4A12A 3QOEA 5M3FJ 1G4DA 5E1ZB 2F5DA 2ZSHB 2NAZA 2XF5A 1Y39A 2UXNA 1AA7A 1D8KA 2BW3A 2QENA 3EETA 5LHHA 3BP8A 4J00A 1QPMA 1UG2A 1VF9A 1ZQ3P 4RAFA 2NVXJ 3V7CA 1LUJB 3C2GA 1FYKA 3ROUA 3UR3C 3CMYA 2VPLA 4ENJA 5KVRA 2KMUA 2CU7A 3K9TA 3EDPA 3OS2A 4B47A 1XGSA 3MKWB 3OYIA 4A3IJ 4G9YA 2HKXA 2V1DA 4AIHA 1MJAA 5FD6A 3HRUA 2ME0A 2BHZA 3PUBA 1FNNA 4ZYAA 3HDDA 1W4MA 2LOOA 4MNUA 2E36A 5LHGA 5H6QA 2WB1N 4Q48A 2P7CB 1Z67A 3GUDA 2KIMA 2R4GA 1JUMA 1VQ5I 3N97A 4F52A 3ZQ7A 3WG7H 2M7AA 3RCOA 4ABZA 2D5VA 3PNTA 4M9ZA 4EEFG 5K7HA 3OIPA 4BHBA 3A01B 4DW6A 5L3DA 1FSHA 1Z7LA 3MZYA 4XL9A 4RA2A 5IYBJ 1ZYRF 1MKMA 2DN0A 2ECCA 3KP3A 3IC7A 1APLC 2HYJA 3DEWA 2GZWA 2EZHA 3ZRGA 3G1MA 1TBXA 1U5TA 2NS0A 3EUKL 5DM6F 1D1CA 1KZHA 5JR3A 4R79A 1WKMA 4Y3OA 1KGSA 3GTLJ 1BM9A 3MCZA 1DDNA 4OWRB 2EB7A 4IOCF 1X3ZB 2KZVA 4NHJA 5LD2C 2DDBA 2L54A 5FO5A 3HSRA 2UUZA 2LRDA 4IRIA 1SMYF 2H8RA 1GLNA 1SD7A 2KL4A 2ZMEA 2PEXA 2F4OB 3P9CA 5FLVA 2BXYA 4NNJA 1FBSA 2EZLA 1OYWA 2ZNYA 3NAUA 4KMFA 4Y7NJ 1OCRH 2MABA 2M9HA 3GLLA 2CQ7A 3BG9A 3OOUA 3L2RA 1FSEA 1FP1D 5EZHA 3JRHA 2CYYA 1ACIA 1D0ZA 2A5WA 1BI3A 5C4JJ 3SZPA 1Y6IA 2E1NA 4G7ZF 2A6TA 3RKQA 1FX7A 3JR9A 2LR8A 2D2WA 2BE5F 4P96A 1KQ8A 1T33A 4PJ0C 3QYEA 1IUFA 3VYRB 3FMRA 2P6SA 2K5CA 3PO2J 1I3AA 1Y56A 1TQIA 2L9RA 4BE2A 3Q5FA 1HF0A 6PAXA 2MH2A 1M1EB 2LYCA 2K3FA 2P81A 4L9JA 5ICFA 2CFOA 3W3CA 4HLYA 4CYDA 3MMYB 3A1YA 3PNYA 1YS6A 4YIFA 4DZPA 4CICA 2ID6A 3I59A 3L2CA 3DTKA 1D0XA 2V4JC 1NG6A 4LJZF 1I5ZA 1PVEA 3V8JA 3SZGA 4IHYA 1KU3A 3Q0VA 3BJAA 2H1LA 4EJOA 2X6XA 1Z7UA 4HA8A 3AKZA 4RS8A 4XM3A 3OYLA 5CPRB 2NNNA 1B1BA 1W36D 2B63J 1XGOA 5M3MJ 3VDXA 4DYRA 3COAC 2Z33A 1ZKGA 3FXJA 1UHWA 4ZDLA 4UVAA 3LQQA 2V1XA 1TZLA 3RYPA 2COBA 1T8IA 1WQ2A 2CQXA 3M3YJ 3QQAA 3OY9A 2MGQA 2HTJA 3BQZA 3CCYA 1BJZA 4FX4A 3KYCB 2LBFA 1TQMA 3IUOA 3REOA 4FHTA 3R0JA 3GO5A 3L7WA 4AM3A 2DTRA 5K7FA 3HRMA 5LGUA 3W6KB 3JW4A 3KCCA 1HQCA 3WTZA 3EPZA 1HLVA 4BJ6C 3G6EI 2QQBA 1D0YA 2UWMA 3LSRA 1FOXA 2PX9A 4BAYA 2QSHX 4KT5C 2Z1DA 3F8NA 4MO7A 3RIRA 1B8IB 3JCUC 2BOLA 5F04A 3C2BA 1O3SA 4CCLA 1VQ8I 3Q9VA 5EF6A 1S7AA 2ZCWA 4OOIA 1SEUA 2P5KA 2CQNA 4UB8C 1D1BA 1WJCA 3EYIA 2ZFWA 2OC6A 3GBGA 2QLZA 2PJRB 5EEAA 1VQOI 4RGXA 2XSDC 2OU2A 2RDPA 1S9HA 4FISA 1ETQA 1R36A 2BY1A 5IYDJ 3OWTA 4V2FA 2V9KA 4HF1A 5F0CA 3AAFA 1R9TJ 2M1BA 4IQ4A 1TNTA 5HNFA 5EGOB 2X48A 5J1RA 2E34A 3QPTA 3GTPJ 2OBPA 3BY6A 4OAZA 1K4SA 2EBIA 2X85A 1U9NA 2KZGA 4V19K 5D6EA 1P7JA 2KPMA 2NS8A 2L9NA 3OYDA 4GRIA 2OZ6A 4C3JJ 2EA2A 4MFEA 3FMQA 3DQVC 2EILH 5H20A
chains in the Genus database with same CATH topology
2ZXHA 2X1CA 3CESA 4NC8A 1X1CA 3IP4B 1WFXA 3MD2A 2IS4A 4Y33A 4RLFA 2KRHA 1MNDA 2VQHA 3RTRA 3OYCA 3IAS2 4PJLA 2Z16A 2VJ5A 2R7VA 3MKZA 3EUAA 2X51A 4XLAA 2E5ZA 4DBQA 3OYKA 4II3A 2X6WA 2W4SA 4E6KG 4XN0A 1WJDA 2VL8A 4E4HA 1PYVA 5CQGA 5JHFA 2VJ4A 4PFOA 2VXZA 2HVRA 4HEA2 2LREA 3LSKA 3H5AA 4FETA 4AU7A 4HG2A 4HSTA 2HVSA 3H9QA 4E7IA 3CJRB 4DGWB 2IS2A 2M7BA 2E1MB 4Y4RA 2VQCA 2R7OA 2VKHA 2XF7A 2CUJA 4J01A 2UV1A 4KITB 1YX5A 2W7NA 2WAFA 3D5RC 3HC7A 2WAQA 3DPUA 4BEHB 2R7SA 2R7UA 1MMNA 2L7KA 5FRMA 2Q1ZB 2AQFA 1DQUA 4AYBA 4HSRA 4B48A 2DOAA 3L2VA 2I8DA 3S3MA 2L5QA 2F4IA 3HPGA 3LSIA 3K4KA 2VQLA 1WJFA 2LY1A 3OR2C 1N78A 4C9YA 3LSGA 2LC2A 1LKXA 4BDZA 1KONA 3OS0A 3PJRA 2VQGA 1Z3YA 3BG7A 4ZC3A 4DBRA 1K6YA 2IGNA 3H9JA 2KP6A 2JSPA 2X1DA 3FBIB 4BE0A 3OYNA 3H5RA 2WY8Q 2HPIA 3F9KA 2IGKA 4ZDPA 1X4PA 3DTEA 4ZJZA 4KJZA 3PNVA 1N75A 4NQWB 4IKFA 4JQFA 4HNTA 2CV1A 1X19A 4IQJA 2R7QA 3E1SA 2IGOA 2FUG2 3NWSA 3H35A 3L2WA 1YE9A 5HLTA 4F93B 3M8JA 3NWTA 3AFHA 4LIVA 2VXDA 3EUHC 2VIXA 3PSFA 5FRNA 4D1QA 1X1AA 1QHHD 3DWLE 3FDYA 1MNEA 1P9QC 2VKDA 1BOBA 3QYBA 2KHMA 1BR2A 3K6GA 3K70D 3HXLA 4ANJA 2PMZA 1DGWY 3SDBA 3QODA 3SEZA 3S8PA 4HRIA 2V7FA 3BCBA 1LDKB 2OV7A 2F5VA 1FMWA 1VZ0A 2HQAA 2ZFUA 1ZELA 2V6EA 3K70C 2DT7B 4C2UA 1U0JA 3A4CA 3K4BA 2AQEA 3L2QA 3S32A 4HPQA 3FKJA 2BVMA 3K10A 4C2TA 1BR4A 2K9MA 4BE1A 3LL7A 2KRCA 2ELJA 2WBMA 4XKWA 2IXSA 4PJMA 3C2HA 2JVHA 1NG7A 3PFYA 4XNFA 1MMGA 3K4NA 3AL0B 4XQFA 1W36C 2R7TA 3DTIA 3ZCOA 4BS9A 4C30A 2DT6A 1SAUA 4OAYA 4DIQA 4FASD 4CUGA 2HU9A 3DKXA 1JI8A 2O0PA 2M4GA 2MFZA 4YRVA 1Z3XA 4EATA 4BJ5C 1FMVA 2GOXB 2JQNA 4F3QA 1UELB 4BU2A 1V5EA 3LSHA 2CV0A 3M1CA 2R7RA 1X1DA 3CMMA 1WJAA 2HVQA 2R7WA 2MC4A 3PSIA 3BC8A 3S3OA 2JVGA 2Z2SB 2LY2A 1LFPA 2E5NA 4F91B 2K3PA 3BCAA 1D1AA 2VJIA 1OR7C 3BG6A 3I3LA 3OL3A 3VYTB 3E0JB 4XKBA 2KDOA 2P0WA 4JOMA 3K4JA 2WAEA 4XKCA 1DP3A 5HOOA 1J09A 2KQRA 2L2OA 4H4KC 1WJ5A 3D5LA 2CW7A 3DPTA 2M3AA 4EYYQ 3DU5A 3TMOA 2QKLB 2V26A 3CP8A 2VLAA 4F55A 3UNGC 4BUPA 2ZXIA 2WA0A 1HA8A 1SFKA 5CQEA 4DOZA 2Q2EB 4CH7A 3TBIA 3ZGKA 3TL4X 2DCEA 4ZTJA 3HL2A 4BXFA 3S3NA 4XOTA 3W2WA 3BLYA 4CZCA 4BDYA 3VWBA 1R6RA 4XLFA 3V42A 1QHGA 4ITVA 3RQ4A 4CSWA 3QOEA 2O0QA 2ZSHB 2XDVA 3A2KA 2XF5A 2L9SA 1MW7A 2WB1A 3OIQA 2WADA 1AA7A 2BW3A 3DLAA 3K4CA 4J00A 4II2A 1G59A 1Z21A 3DU6A 3C2GA 3UR3C 2VPLA 3VYSB 3FBNB 2LG4A 2X1EA 2KMUA 3KYLA 3VSLA 4BQOA 3J7AY 4ZTFA 3OS2A 4B47A 3MKWB 3RSNA 3OYIA 1T0FC 3HOTA 2LBFB 3LSMA 3CF2A 2KLOA 4BACA 3PUBA 4ZYAA 1E0EA 1YX3A 2LOOA 2HZDA 4QPQA 2JUGA 4E7ZA 1N77A 3OR1C 3OYEA 3HKZA 2R4GA 2E60A 4F52A 3L2UA 2M7AA 3RCOA 4XLHA 2CV2A 3PNTA 4XMYA 3W2VA 4N4NB 3OYJA 1WJBA 1WJEA 3OIPA 4YELA 2QKMB 4PSWA 4PFPA 5KHDA 1Z7LA 4XL9A 2BVLA 5TGTA 4PK4A 5CKTA 2HPMA 4BQQA 4NUBA 2ZSIB 3LFUA 2VASA 2PJRA 4IX7A 4PSXA 1BR1A 4YEJA 3ZRGA 3EUKL 4CA0A 1D1CA 3RPUD 4CCNA 2XC7A 3DPLC 4R79A 4BGDA 3H9GA 3AL0C 3ONQA 4Y3OA 3HG9A 1UG0A 2IS6A 4XORA 4OWRB 3SYTA 2W00A 2KZVA 4B43A 1MMDA 5LD2C 4AVZA 2UUZA 2LRDA 4E7HA 1PJRA 2XF6A 1GLNA 2KL4A 2HNHA 3OYAA 3MKYB 1MMAA 1LVKA 4F92B 4NNJA 3HOSA 3KEYA 1OLTA 2IS1A 2MABA 4XKVA 4U7BA 4X0GA 3OOUA 4E7KA 3L2RA 3PL8A 4LITA 3SEQA 4E7LA 3OYMA 3G2BA 4LG3A 4XLEA 1UAAA 2RQQA 2K9LA 4B44A 1D0ZA 2A5WA 4CCKA 4P5OA 4DJAA 3ZXSA 1Y6IA 2A6TA 3H5NA 2LH9A 2W82A 2W1OA 3W2AA 2MD0A 3HUGB 1EA3A 3QYEA 3H0DA 3VYRB 2DXIA 2K5CA 5FROA 1Y56A 2RREA 4BE2A 1V5FA 2CMPA 5KNLA 3OL4A 2LYCA 2JA2A 4KT6A 2E1MC 4RMNA 2NOJB 2CFOA 3W3CA 3MMYB 3A1YA 3PNYA 5HNHA 2MYSA 4N4OB 2VB6A 2RNGA 3ZQQA 3LMMA 3S93A 4RLQA 3ZR8X 2OUMA 4BEHA 3DTKA 1ERDA 3D5SC 3OYHA 1D0XA 2O5RA 2V4JC 4XONA 1NG6A 2CUZA 2HDWA 3SZGA 2CS3A 4KISA 2DJIA 3CJQB 3HPHA 4LIUA 2X6XA 3AKZA 1W36D 4XM3A 3OYLA 5CPRB 1DGRM 2BW3B 3K4LA 3VDXA 1IRXA 4ZDLA 4BJTA 3FHNA 1TZLA 2IGMA 2R7XA 3OYGA 1G8XA 3OY9A 2LBFA 3CZ6A 2XSJC 4XOPA 3OS1A 3IUOA 4MLOA 4IZZA 1X1BA 4HNUA 2VJJA 4PJJA 2M4KA 4CCMA 3CP2A 4XLCA 4CCJA 2WY7Q 3I9V2 3DKYA 3EPZA 4RM2A 5LFAA 3DEEA 2M0MA 4B3XA 4BJ6C 2V1NA 4BL0B 2CH0A 3QYFA 1T95A 1D0YA 2UWMA 4XN3A 4PUSA 2Z1DA 2XAUA 3VSKA 4ZDOA 3N05A 2BOLA 4NC7A 4CCOA 4CCLA 3OYBA 4QPOA 1V5GA 2CW8A 1D1BA 3KX2A 4U87A 1WJCA 3OYFA 2OC6A 3OMYA 3GBGA 2Y0SA 4E7JA 4PJNA 2PJRB 3U21A 1S9HA 3K4MA 2X6YA 2F6CA 3OWTA 1TT0A 2V9KA 4P1WA 5KCMA 5HVQC 1QU3A 3IAM2 4BQNA 2HW2A 1X4OA 4IQ4A 5HNFA 4G6TB 4XR6A 2GOMA 4OAZA 2X85A 2KPMA 4E7SA 2L9NA 3OYDA 4GRIA 4D9JA 4RM3A 3VYUB 3DQVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFX A; 
#chains in the Genus database with same CATH topology
 2ZXH A;  3CES A;  1AU7 A;  4NC8 A;  3IP4 B;  1P4A A;  1J7K A;  4Y33 A;  4U0Y A;  4RB2 C;  4L5E A;  4RLF A;  3RTR A;  3OYC A;  4OIN F;  4B1R A;  5J3L A;  3F8C A;  2VJ5 A;  2QVO A;  3EUA A;  3JRI A;  3CCM I;  1IO2 A;  3K2A A;  4DBQ A;  1ONV A;  4II3 A;  1E3O C;  1S7O A;  2W4S A;  2HXI A;  4E6K G;  1WJD A;  3ZOB A;  4YFK F;  5CQG A;  1T08 B;  5JHF A;  1TW3 A;  1WHU A;  2VJ4 A;  5FFZ A;  3BR0 A;  2MH9 A;  2VXZ A;  2KJC A;  1K7A A;  4FET A;  4AU7 A;  2X9D A;  3BR3 A;  3QOP A;  1HW5 A;  4HST A;  3E5U A;  4N9H A;  3H9Q A;  2R7D A;  1IRG A;  1HCR A;  2VQC A;  1MMS A;  5DTD A;  5J1U A;  2XF7 A;  3SQN A;  1YQA A;  5JI6 A;  2YPR A;  3K2Z A;  4HF0 A;  1YX5 A;  4IEJ A;  2GLO A;  5EGO A;  3BG3 A;  1XC5 A;  2WAF A;  4HX8 A;  1T6S A;  3GW2 A;  1S7E A;  2B0L A;  4LMY A;  3E6M A;  1R71 A;  1OCP A;  1JUS A;  4M3G A;  4DYQ A;  2Q1Z B;  2L9V A;  2AQF A;  3KP5 A;  3HTU A;  2DOA A;  2L5Q A;  1K4T A;  1R4M B;  3KP7 A;  3LSI A;  1XDU A;  3KP4 A;  4C9Y A;  2VBW A;  1BI0 A;  1LKX A;  1RR7 A;  2DMP A;  2FU4 A;  2J5P A;  5TIS C;  1YFH A;  3TGN A;  1BI2 A;  3BG7 A;  4DBR A;  1K6Y A;  3HZJ A;  4LLG F;  3N4M A;  2EIJ H;  3IRR A;  1EH8 A;  3CCS I;  5EDN A;  1CF7 A;  4MEX F;  2XPV A;  2DMU A;  1X1P A;  3M1E A;  2FOK A;  4KDP A;  2EFP A;  2ZKZ A;  1LPQ A;  3HIF A;  1JT6 A;  2BEO A;  2XRL A;  4JQF A;  3BTJ A;  4IQJ A;  3E1S A;  4U88 A;  4X6A J;  1WPK A;  3NWS A;  3I58 A;  4L5I A;  3H35 A;  4U0W A;  3I4P A;  2LKX A;  1HKT A;  4EGY A;  3AFH A;  2HTS A;  3TDZ C;  4LIV A;  4D5C A;  1JKP C;  5DUK A;  3TO7 A;  4UUS A;  1QHH D;  1EH7 A;  1E3H A;  2VKD A;  1BOB A;  2KIF A;  1OCC H;  1BR2 A;  2LD5 A;  4IXA A;  3JRG A;  1FZP B;  4A0Y A;  1RET A;  4HAM A;  3CMA I;  2NNY A;  5DDG A;  1UMQ A;  5AON A;  2LMD A;  2K27 A;  1BL0 A;  3U2R A;  1GV2 A;  2HQA A;  2DT7 B;  3A4C A;  3WHC A;  1P92 A;  3FM5 A;  3SHF A;  2YU3 A;  3L2Q A;  1FC3 A;  3HOU J;  4XID A;  5F1R A;  1MBK A;  2EH3 A;  3K10 A;  2JPC A;  3HJE A;  1BR4 A;  2K9M A;  3B02 A;  3LL7 A;  4LLN A;  4EQQ A;  3KYD B;  3T1B A;  2H09 A;  4XKW A;  5IOZ A;  5LRS A;  3NAR A;  2CUF A;  2E7X A;  1NG7 A;  4M6Y A;  3AL0 B;  3IH2 A;  4EMS A;  1YO5 C;  1L3L A;  4IHV A;  1SAU A;  2AS5 F;  3BTI A;  3L9F A;  3J81 Z;  4BY7 J;  1Q1H A;  3K69 A;  5CVV A;  3F6O A;  3BWG A;  3GTQ J;  2HQ5 A;  2WV1 A;  3SFZ A;  3QPL A;  3OSG A;  5FKO A;  2MW8 A;  1H88 C;  1D3Y A;  5ERI A;  1PP8 F;  1W7P B;  2FA5 A;  5J1Y A;  3AG4 H;  1VQP I;  4JBA A;  3LSJ A;  3CC7 I;  5B1B H;  2CV0 A;  3MKL A;  4BKX A;  2M87 A;  1X1D A;  2H94 A;  1WJA A;  2HVQ A;  3DV8 A;  1IN5 A;  2BYV E;  3BTL A;  1WVR A;  3PSI A;  2M45 A;  1IUY A;  3V8K A;  3S3O A;  1LE8 B;  5IT9 Z;  1S72 I;  3ASO H;  4M6V A;  1B72 A;  1JUP A;  2LY2 A;  2OPT A;  3FF5 A;  5F64 A;  2E1C A;  1VQ4 I;  4IOA F;  3CCQ I;  3HBL A;  1D1A A;  1Z9C A;  1Y8R B;  2G9W A;  4A3B J;  1FT9 A;  1UST A;  1CQT A;  1GVD A;  2KDO A;  2Y0M A;  1OPC A;  2JUC A;  3PUF A;  3L09 A;  5LGT A;  1DP3 A;  1J09 A;  1QZY A;  2KQR A;  5ILS A;  4Y13 A;  3HTS B;  2IRF G;  3ZMT A;  5K1Y A;  4B8X A;  3DU5 A;  5E3M A;  2H1K A;  3UNG C;  1DPR A;  3U1D A;  5J6X A;  1WH7 A;  1JGG A;  1JHF A;  1HA8 A;  2F5C A;  4CGZ A;  2ZBK A;  2EFN A;  3ZMS A;  2PN6 A;  4CH7 A;  4DOZ A;  5LBQ A;  4RGU A;  5HS8 A;  4A3G J;  5CYV A;  4CZZ A;  4RBO A;  5KAI C;  3HL2 A;  2BY2 A;  3JRE A;  1J59 A;  2P4W A;  3WTY C;  4ESB A;  3W2W A;  1B6A A;  4A69 C;  1ETX A;  5GPA A;  1JT0 A;  3E3V A;  3LWF A;  1R6R A;  4XLF A;  2JWT A;  2O0Q A;  2VON A;  1JHH A;  4RAG A;  2B9S A;  2L9S A;  3CO7 C;  1MW7 A;  2WB1 A;  3R61 A;  4L9T A;  2FX0 A;  2WAD A;  1REP C;  1XGM A;  4W1U A;  2QCO A;  3CCV I;  3TDU C;  1YTY A;  4I98 B;  2ECB A;  2LG4 A;  2H27 A;  1LE8 A;  3PIP F;  1LVA A;  3VSL A;  2Q8K A;  1WCM J;  3J7A Y;  1B72 B;  3LSM A;  2DYR H;  3CF2 A;  2FRH A;  4N9I A;  3D0S A;  1YJN I;  4XSZ F;  4EJV A;  5AIQ A;  2K4B A;  3MQ0 A;  4AWX B;  4OIO F;  1E0E A;  2L3D A;  4G7O F;  3ZQC A;  1TL8 A;  5FD5 A;  4LGW A;  2JUG A;  4UB6 C;  2Y48 A;  3IL2 A;  4MIM A;  2QA4 I;  2ADU A;  3OYE A;  1PUE E;  4HX4 A;  1T98 A;  1RUN A;  2O6G E;  3G1L A;  3LAP A;  2E60 A;  1EV7 A;  1BJA A;  3L2U A;  1XDS A;  5ILU A;  2CV2 A;  2F5E A;  2GQQ A;  2H8W A;  1R5H A;  1WJE A;  2G0E A;  2L7F P;  3ZQL A;  5LEK A;  5KHD A;  1Y0N A;  4P9U A;  4IO9 F;  3LOC A;  4LG0 B;  3M07 A;  4PK4 A;  1P7I A;  1BW6 A;  4GCV A;  1W5T A;  1Z1D A;  2ZSI B;  5K5Q A;  4U7D A;  3FIS A;  2DAO A;  2G7U A;  2O0Y A;  2IA2 A;  3ABU A;  5DCM A;  5F6F A;  4YEJ A;  2DO7 A;  3NQO A;  4CCN A;  2XC7 A;  4BH9 A;  3U1K A;  1ODD A;  3DPL C;  3AL0 C;  3H9G A;  3HG9 A;  3IHU A;  4BHP A;  2IS6 A;  4XOR A;  4HDV A;  3SYT A;  5HLI A;  3JRA A;  2W00 A;  3ZP5 A;  1MMD A;  5BNG A;  1ZAO A;  2EJR A;  3TO9 A;  4E7H A;  1PJR A;  4LFU A;  3HOV J;  3OYA A;  3CC4 I;  1MBE A;  5K5R A;  1MMA A;  3OV8 A;  1LVK A;  2F5F A;  5E18 F;  3DEU A;  1OLT A;  3O6B B;  1B9N A;  1YJW I;  1FOY A;  2ACJ A;  2GIV A;  4U7B A;  1U78 A;  2E2H J;  4E7K A;  3TQN A;  1XPX A;  3LST A;  3VOE A;  3FMS A;  1UAA A;  1YOV B;  2K9L A;  4B44 A;  4L0Z B;  4CCK A;  3OSF A;  4DJA A;  4A3K J;  2DPU A;  2ZJP F;  3P7N A;  2RVC A;  1G3S A;  4O5V A;  5J4V A;  1FBQ A;  3H5N A;  2W82 A;  3GTG J;  3F21 A;  1K83 J;  2LK2 A;  2MD0 A;  3HUG B;  4M6X A;  5B5E C;  3I53 A;  3H0D A;  2DXI A;  2VOP A;  2Y0S N;  1BBY A;  1G3W A;  3MZH A;  5FRO A;  2RRE A;  3JAM Z;  5HS9 A;  3F6V A;  5KNL A;  1WH5 A;  4Z6Y A;  3WG9 A;  3DF8 A;  3SZT A;  1AWC A;  1ZAR A;  4A3M J;  1KQ9 A;  4A93 J;  2QEX I;  1IZ1 A;  2O8X A;  2Q2E A;  2FMY A;  4DYC A;  3CCE I;  2RN7 A;  3GYH X;  2RNG A;  3ZQQ A;  3S93 A;  3ABL H;  4BEH A;  2RKH A;  3HYI A;  1ERD A;  3OYH A;  2O5R A;  3DBL B;  2VC1 A;  2OD5 A;  4WF2 A;  5FKK A;  5L3B A;  1A35 A;  2GXA A;  2CS3 A;  3GZ5 A;  1SD4 A;  2HYG D;  2WTE A;  2EZI A;  2DFF A;  1DUX C;  2Y31 A;  1DGR M;  4HLX A;  5FKM A;  2ETH A;  1TWG J;  4Y17 A;  1KYW A;  2IGM A;  3F22 A;  5FLX K;  2LNB A;  3ULQ B;  4XRS A;  3RPU A;  2I5U A;  5L3C A;  2DDA A;  3FM3 A;  1HOM A;  4QSH A;  5GAD J;  3J7A O;  1G8X A;  1VQM I;  4LOC A;  3TOB A;  2IT0 A;  4ZH4 F;  1MSF C;  4MEY F;  3CZ6 A;  3J7Z I;  4MFD A;  3BZC A;  2E35 A;  5LGN A;  1O7L A;  1NK2 P;  1K79 A;  2VJJ A;  4PJJ A;  2E71 A;  2M4K A;  2WV0 A;  4ON0 A;  2WY7 Q;  2O61 A;  2DK8 A;  2FQ3 A;  2HXO A;  2VT3 A;  5E20 A;  2V1N A;  3KZY A;  3QYF A;  5D5W B;  3JRB A;  2HQR A;  4XN3 A;  4I01 A;  1XCV A;  2XAU A;  4BBS J;  1YRN B;  4IHX A;  4CCO A;  3OYB A;  1T39 A;  1F4K A;  1I50 J;  3J80 Z;  2CW8 A;  1IGN A;  2XHK A;  3KX2 A;  3QP5 A;  4S0H B;  4EM2 A;  4E7J A;  4PJN A;  4U0V A;  1FJL A;  1MGT A;  4HX7 A;  3BQY A;  1VFC A;  5ILV A;  5GAE J;  1TT0 A;  3B73 A;  3SJM A;  3ZN0 A;  1ZG5 A;  5KCM A;  1QZZ A;  3IAM 2;  4BQN A;  1TWH J;  1QU3 A;  1G2H A;  1X4O A;  2HW2 A;  2OQG A;  1MH3 A;  3M9A A;  1XG1 A;  1RKT A;  5GAG J;  2HOA A;  2QQA A;  3S16 J;  1FTT A;  2YX4 A;  4HOB A;  3BRO A;  4JX6 A;  2GOM A;  4ENN A;  2TCT A;  1LEA A;  3GLX A;  3E5X A;  5J8C A;  4D9J A;  5GAH J;  4HBL A;  4AUX A;  3CCJ I;  2R0Q C;  4BQA A;  3VYU B;  1ULY A;  2FF4 A;  4HNV A;  2X1C A;  1A6Q A;  2W84 A;  1X1C A;  3RI4 A;  5B1A H;  3MD2 A;  3H3V K;  3S14 J;  1SFU A;  2M30 A;  4O6J A;  2FML A;  2F2E A;  1EKE A;  2VQH A;  3WU1 B;  5JLX A;  2Z16 A;  1XSV A;  5L3F A;  3A0H C;  3KP2 A;  3OYK A;  4MTD A;  2GM4 A;  2QWW A;  1LJ9 A;  1YS7 A;  2VL8 A;  4E4H A;  2KKO A;  1PYV A;  1U3E M;  2J5O A;  4KYW A;  4EJT A;  3FX3 A;  1POG A;  3WE3 A;  3LA2 A;  3QPS A;  4IHW A;  2ISZ A;  1SVO A;  4HDU A;  2VKE A;  2DPD A;  2LF8 A;  4KNY A;  2JA8 J;  4QTR A;  2IS2 A;  2E1M B;  2PBI A;  2QSF X;  2QF7 A;  4C3H J;  2VKH A;  3CUQ A;  2CUJ A;  3HOX J;  2LVS A;  3LA3 A;  1U8R A;  4J01 A;  3DP7 A;  4GYI A;  3R0A A;  3D5R C;  4BXX J;  1SFE A;  3E6D A;  3DPU A;  4RB3 C;  1MMN A;  2L7K A;  2CJJ A;  2Z3Y A;  1EH6 A;  1UB9 A;  2DT5 A;  4AYB A;  4HSR A;  4B48 A;  3S3M A;  4EV0 A;  3L2V A;  2LFB A;  3KP6 A;  3HPG A;  2JSC A;  2VQL A;  1WJF A;  4M71 A;  2W48 A;  1JKR C;  1FLI A;  1D5Y A;  1J5Y A;  1QQI A;  2DYS H;  2XAH A;  1GDT A;  3HHG A;  5DV5 A;  1YW9 A;  3VB2 A;  3KPH A;  1XN7 A;  2BHY A;  2VUM J;  1AKH B;  1Z3Y A;  4ZC3 A;  3HOZ J;  4A3J J;  3WGI A;  2YU9 J;  2IA1 A;  3H9J A;  1FIA A;  4XSX F;  4XBF A;  3H1C A;  3H5R A;  3GFJ A;  1GHC A;  2WAQ N;  2WY8 Q;  1MH4 A;  4ZDP A;  2BY3 A;  2V79 A;  1FPQ A;  2OCC H;  4I09 A;  3A03 A;  4KJZ A;  1N75 A;  5BPD A;  1DU6 A;  2OQR A;  2LKP A;  4UVC A;  4KA4 A;  2JPB A;  2DMQ A;  2KT0 A;  3HEF A;  1RC9 A;  2CV1 A;  5HLG A;  3GFL A;  4P9F A;  1X19 A;  5M5X J;  1XSD A;  2R7Q A;  5E3O A;  1E2X A;  1Z6R A;  1ZK8 A;  4M73 A;  1HST A;  4HV6 A;  5E8G A;  5HLT A;  5EZG A;  5IPA A;  2LDU A;  2JTV A;  5ED4 A;  1KA8 A;  1TWA J;  4IHS A;  5F1J A;  3CUQ B;  2VXD A;  3WTX C;  4G7H F;  2DOF A;  3FZV A;  2EA4 A;  3KIO A;  3ASN H;  3GX4 X;  3DWL E;  3O8H A;  5DS9 A;  1MNE A;  1P9Q C;  2AXT C;  3QYB A;  1TC3 C;  2O8K A;  4PGG A;  5C4X J;  2MBF A;  3IH4 A;  5D8K B;  3PO3 J;  3CQZ J;  1G3Y A;  4L0Y B;  3SEZ A;  2M8G X;  3G1O A;  3Q0W A;  2ZFU A;  4JP0 A;  2V6E A;  4A3C J;  3K70 C;  4C2U A;  4ASN A;  3H36 A;  4HPQ A;  2XGX A;  3JRF A;  1RUO A;  4C2T A;  4IRG A;  3F72 A;  3CME I;  1XGN A;  1ETW A;  3C1D A;  4BY1 J;  2DQL A;  1ZTR A;  2IXS A;  4LK1 F;  2LP0 A;  4PJM A;  2P8T A;  3G73 A;  3K4N A;  1JKO C;  1W36 C;  2R7T A;  1G6N A;  4KIF A;  2DT6 A;  2XKP A;  5M5Y J;  2K4J A;  3BZK A;  1TW2 A;  2XAF A;  5IYC J;  3ZPL A;  4FQG A;  2ZME B;  1JI8 A;  4DQ2 A;  2BXZ A;  1XMA A;  1Z3X A;  2FEZ A;  2CW0 F;  4BJ5 C;  3AG3 H;  4CDG A;  1LFU P;  2FD5 A;  1P2F A;  1SMT A;  3VFZ A;  5GP9 A;  4WXD A;  4Y52 J;  3K1M A;  5K5O A;  2QBY B;  3CJT B;  5FJ8 J;  1BA5 A;  4W97 A;  1I3Q J;  4CYC A;  3JRD A;  1Y1W J;  2QZ8 A;  1LFP A;  2E5N A;  2PFB A;  2K3P A;  3BCA A;  3BG6 A;  2F48 A;  3OL3 A;  3QWL A;  3W6J B;  3HGY A;  3K4J A;  4XKC A;  5HDG A;  1S5L C;  5J40 A;  1G3T A;  2L2O A;  1UCR A;  3TOA A;  2RC4 A;  3GTK J;  2N8G A;  2DA7 A;  2CW7 A;  3DPT A;  2M3A A;  2ESN A;  2ZC2 A;  1F5T A;  2VLA A;  2Q0O A;  3K1P A;  4F55 A;  2ZXI A;  5BQT A;  3C3W A;  5CQE A;  5FLX Z;  2JMW A;  1H0M A;  3TBI A;  4L9N A;  2DCE A;  4ZTJ A;  1MBG A;  4OIQ F;  1BIA A;  4LD5 A;  4XOT A;  2OZU A;  1OMI A;  1XX5 A;  3ECH A;  1I27 A;  2MG4 A;  1PP7 U;  3VWB A;  2EZK A;  3V42 A;  1QHG A;  4ITV A;  2DMT A;  3FXK A;  1JXS A;  4CSW A;  1ZN2 A;  2DW4 A;  4KUM A;  4M9S A;  1XTA A;  2XDV A;  3RYR A;  3ABT A;  3DLA A;  2NOG A;  3K4C A;  4B09 A;  4II2 A;  4NQW A;  3MAJ A;  1G59 A;  5DUI A;  1I6H J;  1TTY A;  3DU6 A;  1X2M A;  4S04 A;  1H8A C;  1IN4 A;  3ZN1 A;  1A36 A;  3JTH A;  3VYS B;  3FBN B;  1YIJ I;  2X1E A;  1PUF A;  2QBY A;  2HQN A;  3AG1 H;  3CUQ C;  4ZTF A;  5D8L B;  3F8B A;  3TP3 A;  2VOO A;  1HXD A;  4CYC B;  3RSN A;  1T0F C;  4YFX F;  3KZZ A;  2LBF B;  4WXH A;  1MBF A;  4D5F A;  4YG2 F;  2EQR A;  2KLO A;  4BAC A;  1XB4 A;  1YX3 A;  1R5G A;  4QPQ A;  4D7N A;  1HSJ A;  2DK5 A;  1LDD A;  2M34 A;  2XIG A;  5IP6 A;  4PCQ A;  4E7Z A;  4NDL A;  1N77 A;  2PMZ N;  2AO9 A;  3OR1 C;  1OCZ H;  2OA4 A;  2R5Y A;  5ICE A;  1WRJ A;  2GAU A;  2KDZ A;  3W2V A;  1B8I A;  4PGH A;  2E2J J;  3V7R A;  4YEL A;  1JJ8 C;  4BHC A;  1SC7 A;  5TGT A;  1HBX G;  3HRS A;  1FOW A;  4BQQ A;  4NUB A;  2VAS A;  3FXR A;  2PJR A;  3GFM A;  2DFH A;  4PSX A;  1BR1 A;  4CA0 A;  4ZZL A;  2K02 A;  3RPU D;  5K7Z A;  3JSP A;  3DLL F;  3V7S A;  1IF1 A;  3ONQ A;  3MZ8 A;  1UG0 A;  2L7M P;  4JK1 X;  1ETV A;  2JN6 A;  3X2Q H;  1LDJ A;  5JVT A;  2O7O A;  2O9L A;  2WWY A;  1YW7 A;  1PUF B;  4AVZ A;  2HR3 A;  2XF6 A;  3JRC A;  3FXL A;  4M3D A;  2OJE D;  1GV5 A;  3VOD A;  4F92 B;  5DM7 F;  3CLQ A;  1X3W B;  2GIZ A;  3KEY A;  4LB6 B;  1XMK A;  5L3G A;  2IS1 A;  4G12 A;  4B4C A;  2E2I J;  4XKV A;  2FNP A;  4X0G A;  1ZH5 A;  4Q47 A;  3PL8 A;  4LIT A;  3SEQ A;  3GTJ J;  1UZC A;  2R5Y B;  1DP7 P;  1YW8 A;  2NVU B;  3G2B A;  3TKY A;  3OYM A;  4XLE A;  2E7W A;  3H3U A;  1R23 A;  4M9X A;  1GT0 C;  4I0B A;  1OCT C;  2W1O A;  3NRV A;  2KIU A;  3W2A A;  3FKI J;  1N25 A;  1EA3 A;  1A5J A;  3Q3S A;  3I4N J;  4HF2 A;  3CD6 I;  2EV0 A;  3HOW J;  1ITY A;  3U9G A;  3CF5 F;  4D0P A;  1LEB A;  2CMP A;  2OAZ A;  2QM3 A;  1SVM A;  4YII A;  2ISY A;  4GFB A;  2K40 A;  4ZYH A;  2JA2 A;  4RMN A;  5FGM A;  2P5L C;  2A07 F;  5DYM A;  5FLM J;  2VT2 A;  1BC8 C;  5HNH A;  1BC7 C;  4N4O B;  3DKW A;  5TJJ A;  1FY7 A;  3E97 A;  2A6E F;  1ZR4 A;  2M0C A;  4JX5 A;  2Z99 A;  1TWF J;  3F0C A;  3O2P E;  4Y15 A;  3MWM A;  4XON A;  1MJ9 A;  2EK5 A;  2HDW A;  3VEP A;  1XS9 A;  2A6H F;  2IEK A;  5A2Q K;  1RKW A;  2X6O A;  4KIS A;  2VOD A;  5IT9 K;  2QGU A;  5CLS A;  3CJQ B;  3I71 A;  1R22 A;  3LQR A;  4LIU A;  2EWN A;  4A5M A;  2LKS A;  2GWR A;  1SFO J;  3JSO A;  2V9P A;  2BW3 B;  2ELH A;  1SAN A;  3ISP A;  4ENM A;  3A02 A;  2CQK A;  4BJT A;  4KFC A;  1MBJ A;  3FHN A;  1UJ8 A;  2FJ1 A;  2XAG A;  2V6C A;  3I56 I;  2R7X A;  2DMN A;  1Z77 A;  2AUA A;  1YI2 I;  3Q9S A;  1CF7 B;  4M72 A;  3MEX A;  4YIR X;  2VBZ A;  3KEO A;  3OS1 A;  1TT5 B;  3BR6 A;  2ZJR F;  3T5X A;  1BIB A;  2K7L A;  4HNU A;  2BGC A;  1IRF A;  1XSX A;  3DKY A;  1VQ9 I;  2K9S A;  2HOE A;  3DEE A;  2M0M A;  1F36 A;  1I6X A;  2CH0 A;  3HRT A;  3J80 K;  5F0H A;  1V54 H;  4IVN A;  4PUS A;  5FB2 A;  1T2K A;  3S1N J;  3RKX A;  4ZDO A;  3N05 A;  2IW5 A;  3F8M A;  4NC7 A;  2XGC A;  3ERE D;  3A01 A;  1VQN I;  2L0K A;  2PMH A;  2FXA A;  1J9I A;  1P4X A;  3WTW C;  4GDF A;  4U87 A;  5GTH C;  3GWZ A;  5LHI A;  5DD8 A;  3QPH A;  3U21 A;  4ENK A;  1F43 A;  1U5T B;  2X6Y A;  3T8R A;  3EYY A;  4FX0 A;  5E1W A;  2D1V A;  5FFX A;  2HYF A;  5EEH A;  1RIO H;  1W0T A;  4G6T B;  4HQM A;  5HLH A;  5E3N A;  3F3X A;  2FBK A;  4KN7 X;  4F7Z A;  2HKO A;  5HS7 A;  3IWF A;  3SXY A;  1O3Q A;  1J75 A;  1OYI A;  3WTS C;  2RNJ A;  2RAE A;  4E7S A;  2HWV A;  2K9Q A;  4L9V A;  1R00 A;  3R4K A;  2NYX A;  3TW7 A;  5HDK A;  1ZGW A;  1TNS A;  1IRZ A;  1SD5 A;  4JX4 A;  1ON2 A;  1WFX A;  1KU7 A;  2IS4 A;  2HFH A;  3ECO A;  1MND A;  2W25 A;  4M3E A;  1OIS A;  1ZLJ A;  3IAS 2;  4IHT A;  2R7V A;  2ZXW H;  3MKZ A;  5ICG A;  2X51 A;  3C7J A;  3CDL A;  5J47 A;  4XK4 A;  5HDN A;  4XRM A;  4H0E A;  1QVU A;  2P5V A;  1FP2 A;  4PFO A;  4E70 A;  2HVR A;  5B3S H;  4EGZ A;  3ZQH A;  4RB0 A;  1QNT A;  3JTG A;  1H89 C;  2ZO4 A;  2QYO A;  3H92 A;  5CVR A;  4WXC A;  2E1O A;  4UXN A;  5FKN A;  4A2U A;  2HVS A;  3S2W A;  2XPW A;  4E7I A;  3CJR B;  4Y4R A;  3GVA A;  1QVT A;  4G6Q A;  3TO6 A;  4QLC U;  2VPR A;  4WK8 F;  1UFM A;  1FBU A;  2UV1 A;  2ME6 A;  3ZQI A;  4KIT B;  1NK3 P;  4BNC A;  2QQ8 A;  3C18 A;  3IKV A;  3HC7 A;  5CVI A;  2BBY A;  2WAQ A;  5C44 J;  1MZB A;  3I59 B;  2R7S A;  2R7U A;  2G7H A;  5FRM A;  3CJN A;  2STW A;  2A05 A;  2I8D A;  2F4I A;  3E6B A;  2DOD A;  3IWZ A;  4GYG A;  3RKY A;  2RQP A;  3GF2 A;  3O8G A;  2YR2 A;  2LY1 A;  3OR2 C;  3RZD J;  3FK6 A;  3LSG A;  4OIR F;  1I1S A;  2PG4 A;  4Z2Y A;  3ESW B;  4CHU A;  2JSP A;  3FBI B;  3OYN A;  3CC2 I;  2TDX A;  3KEQ A;  1EJ9 A;  5L3E A;  2HPI A;  3DTE A;  4ZJZ A;  1GUU A;  2OTL I;  3QAH A;  3EQL F;  2CFX A;  3KZI C;  3BPV A;  4HNT A;  3P9I A;  3FWE A;  3BTC A;  1Z6T A;  1H9T A;  2E19 A;  1RI7 A;  4IPA A;  2FOW A;  3ZQG A;  3RZO J;  2VI6 A;  2ZNZ A;  2CO5 A;  4F93 B;  3M8J A;  1Y0U A;  4I7H A;  1SVL A;  2BY0 A;  1FYL A;  1O3T A;  1KU9 A;  3GTO J;  4UY8 I;  3GCM A;  3EUH C;  2VIX A;  3PSF A;  4QIW N;  4D1Q A;  2GXG A;  3MN2 A;  1MSE C;  1Y8Q B;  2XGE A;  3WHB A;  1W0U A;  2L4A A;  1A04 A;  1B59 A;  2CUE A;  3HXL A;  1I39 A;  4ANJ A;  3S2H J;  2KJB A;  2XKO A;  2PMZ A;  1DGW Y;  2GBY A;  3CDH A;  1YG2 A;  4KMU X;  3BR1 A;  2YSR A;  4A3E J;  2V7F A;  1U9O A;  3BCB A;  1LDK B;  3PQK A;  1IJW C;  2F5V A;  1ZEL A;  3ML6 A;  3K4B A;  5D6F A;  2AQE A;  4G6D A;  4LG0 A;  4AVP A;  1BN5 A;  1F1Z A;  4V2G A;  4FT8 A;  4AIJ A;  2BVM A;  4MHG A;  1FOK A;  1BOA A;  5JVG F;  2KRC A;  3I64 A;  1V3F A;  2ELJ A;  1R1V A;  4FTH A;  3C2H A;  2JVH A;  2STT A;  1R7J A;  3K0L A;  4XNF A;  1P6R A;  3PFY A;  1U8B A;  3HKZ N;  4A6E A;  5M5W J;  2MD5 A;  4C30 A;  4UVB A;  5J8F A;  5D5X B;  2DA4 A;  2DBB A;  2B7E A;  3CCR I;  3B6C A;  3P9K A;  1RPW A;  2RV8 A;  4EJU A;  3MVP A;  2ZJQ F;  3DKX A;  2NVT J;  2ZXJ A;  1VI0 A;  1OFC X;  2XVC A;  3AG2 H;  3P5J A;  1ZGJ A;  4EM1 A;  1FWZ A;  4IF4 A;  2EFQ A;  4YRV A;  2PLY A;  2VE8 A;  3LSP A;  2XRN A;  1B4A A;  1ETK A;  4M74 A;  4BU2 A;  1H9G A;  1V4R A;  4CO8 A;  1HC8 A;  1RZ4 A;  4I0A A;  1XMX A;  4L5J A;  1MIJ A;  3WGG A;  5H2F C;  2MC4 A;  2Y30 A;  4NB5 A;  3JAM K;  2IPQ X;  3BC8 A;  2QUF A;  4UHT A;  4QWQ A;  2CQQ A;  3I0T A;  2I10 A;  1QO0 D;  2JVG A;  2Z2S B;  2Z5U A;  3EUH A;  2EV5 A;  3IH3 A;  3I3L A;  2FBH A;  3HUG A;  3E0J B;  4LB5 A;  2Y9Z A;  1KU2 A;  4M3F A;  2BZT A;  3TED A;  2WAE A;  2H6C A;  5HOO A;  1O7F A;  1IXC A;  1A31 A;  4JYK A;  4H4K C;  1WJ5 A;  3D5L A;  4XLP F;  4EYY Q;  3KE2 A;  4Q5S F;  2V26 A;  4GO1 A;  3NEU A;  1SD6 A;  2CSO A;  4MGR A;  5F08 A;  4BUP A;  2WA0 A;  1U6G A;  1O3R A;  1SFK A;  5H6R A;  2ID3 A;  5KAF C;  1GXP A;  2L02 A;  2Q2E B;  3I4M J;  3B6A A;  4ZZD A;  2XGD A;  5DEQ A;  4A0X A;  2DOE A;  3H0G J;  3TL4 X;  4I6Z A;  4G8X A;  2EFW A;  3S3N A;  5D4S A;  1B9M A;  2FBI A;  1U2W A;  2CRG A;  2HDD A;  2L01 A;  3RQ4 A;  1IW7 F;  3BZ6 A;  2QQ9 A;  2ZB9 A;  3A2K A;  4AC0 A;  2K85 A;  3E7L A;  3OIQ A;  9ANT A;  2K9N A;  5IP9 J;  2VN2 A;  3R60 A;  3KLO A;  1YIT I;  1Z21 A;  3CTA A;  2W24 A;  3F23 A;  3M7G A;  3T8T A;  2L7Z A;  1QGP A;  4RGR A;  3KET A;  3WTV C;  1CGP A;  2KFD A;  3KYL A;  3G71 I;  4BQO A;  3IRQ A;  1YLF A;  1ZRD A;  2JRM A;  4PDK A;  1X2N A;  5B66 C;  3HOT A;  2H6B A;  2AXL A;  2HDC A;  4KIC A;  5KK1 A;  5JHU A;  5BPI A;  1VND A;  1TWC J;  5E17 F;  4AID A;  4WX9 A;  4UUS B;  2Y75 A;  1O4X A;  5EEG A;  4MQ9 F;  1IG7 A;  2DFI A;  2HZD A;  2HZT A;  2ZJ2 A;  1AHD P;  3ZMV A;  2HOT A;  4KIB A;  2UZK A;  3E5Q A;  3J81 K;  2ELK A;  1IXS B;  1O57 A;  3HKZ A;  3G4S I;  3I5U A;  3BDD A;  4ZYE A;  1Z05 A;  3WU0 A;  2GA2 A;  1NH3 A;  4XLH A;  1OKR A;  4XMY A;  2EIK H;  4N4N B;  1YRN A;  4D7M A;  3OYJ A;  1WJB A;  2QKM B;  4PSW A;  3BG5 A;  4PFP A;  2PJP A;  2YS9 A;  2VBX A;  2IJL A;  4LK0 F;  2BVL A;  5E8I A;  3V4G A;  1I1G A;  5CKT A;  5FKL A;  2HPM A;  3OIO A;  1R49 A;  3LFU A;  3GZN B;  4IX7 A;  2W57 A;  5F27 A;  3I54 A;  3LA7 A;  3LFK A;  2XAQ A;  2EV6 A;  5E79 C;  2X0L A;  2AHQ A;  1U5T C;  3R6S A;  1R4N B;  4BGD A;  1QA6 A;  3KLN A;  4AD9 A;  2JQ7 A;  2A69 F;  3HHH A;  4B43 A;  4EM0 B;  1UHM A;  1FEX A;  4FE4 A;  1IV6 A;  2EFO A;  2ZME C;  4IRH A;  3FXU A;  1JE8 A;  5IP7 J;  2HNH A;  3MKY B;  2JJ7 A;  2XV4 S;  1X58 A;  2DJN A;  3BT9 A;  4BXU A;  3HOS A;  3MFK A;  1W7P A;  2DI3 A;  2P7V B;  1VQ6 I;  2JA5 J;  2V9V A;  4HYE A;  1ZHF A;  4EVI A;  1XCB A;  2MA3 A;  2M5W A;  2P6T A;  4HV5 A;  3DCF A;  4LLL A;  2MC3 A;  3CDI A;  5JLW A;  1V55 H;  2UXX A;  1JTY A;  1LNW A;  3A0B C;  2R7Z J;  4R8H A;  1ZRF A;  4E7L A;  5JFR A;  4LG3 A;  3RKW A;  1ZG1 A;  2RQQ A;  1YIO A;  1F9N A;  5IT3 A;  3IV5 A;  1XD7 A;  2VKV A;  3CCL I;  4P5O A;  2KIS A;  3ZXS A;  2R7F A;  1ORK A;  3HOY J;  2LH9 A;  3ZMD A;  1OYY A;  2R93 J;  1RES A;  3V8L A;  3PFI A;  1JJ6 C;  1GVJ A;  4FE7 A;  3L1P A;  4OU0 A;  2DLL A;  4P55 A;  2FSW A;  1WZ2 A;  1FIP A;  1V5F A;  3HGG A;  2NS7 A;  2QSG X;  2V1U A;  3OL4 A;  3BPX A;  2LF7 A;  2Y9Y A;  4KT6 A;  2E1M C;  3Q0U A;  1S29 A;  2NOJ B;  3TW6 A;  2JA7 J;  3M8E A;  1OR7 A;  2MYS A;  5IOY A;  5D5U B;  2LSO A;  2VB6 A;  4Q4Z F;  3LMM A;  4RLQ A;  3ZR8 X;  2XPU A;  3ELK A;  2OUM A;  3QRF F;  3D5S C;  1NHA A;  5TRD A;  2FE3 A;  4YFN F;  1WSU A;  2CUZ A;  4ZYD A;  2OTJ I;  2WC2 A;  3PIO F;  4AIK A;  2FQ4 A;  4ESJ A;  1WI9 A;  2DJI A;  4A3D J;  1R1U A;  3HPH A;  2EPF A;  1ON1 A;  1LFB A;  2A61 A;  3S15 J;  1ENH A;  3K4L A;  1IRX A;  5E1X A;  1HKS A;  2C6Y A;  3OYG A;  4UNO A;  4KIG A;  3ABM H;  3PQJ A;  2W85 A;  3DFG A;  2TRT A;  4HW0 A;  3ABK H;  2XSJ C;  4XOP A;  1Z0X A;  2GA1 A;  4MLO A;  1ZR2 A;  3T0Y A;  4IZZ A;  1X1B A;  3WTT C;  1FTZ A;  2HI3 A;  4CCM A;  1RRJ A;  3CP2 A;  2NVY J;  4XLC A;  4CCJ A;  1HW2 A;  3WTU C;  3I9V 2;  4NC6 A;  4RM2 A;  5LFA A;  2EIN H;  2IBD A;  5CVJ A;  4RB1 A;  4B3X A;  3DBR B;  2JA6 J;  4BL0 B;  4WWC A;  3GTM J;  1T95 A;  3D1N I;  1QBJ A;  2R3S A;  1AOY A;  5J4Y A;  4BBR J;  1QZE A;  2Y69 H;  2VC0 A;  3KFW X;  4RAZ A;  3VSK A;  3ZMU A;  5F0F A;  3HB9 A;  1IN6 A;  4QPO A;  1R1T A;  5ICC A;  1V5G A;  5C3E J;  2HEO A;  2DU9 A;  1OJL A;  3L00 A;  4HQE A;  2Z9O A;  4FCY A;  2JRT A;  3WU2 C;  3OYF A;  4AYB N;  3OMY A;  2Y0S A;  5DCM B;  1ZRC A;  3K4M A;  1IN7 A;  2JZY A;  2F6C A;  1HDP A;  2JT1 A;  5D4R A;  2COM A;  3S17 J;  4P1W A;  5HVQ C;  1A6I A;  4I76 A;  2M2E A;  3BR5 A;  5AIP A;  3BJ6 A;  4XR6 A;  3GME A;  1GXQ A;  1K61 A;  1R58 A;  2KIQ A;  1JKQ C;  2VE9 A;  2DA5 A;  2L4M A;  4DZJ A;  3WGH A;  4RM3 A;  2XUB A;  4ZYG A;  3DBH B;  1SFX A;  5EYR A;  2XRO A;  2KRH A;  3GZ6 A;  3M8F A;  4PJL A;  1ETY A;  3HM5 A;  1QRY A;  1MDM A;  4XLA A;  2E5Z A;  3I55 I;  1HDD C;  2X6W A;  1WI3 A;  2OF7 A;  4XN0 A;  2O03 A;  3SFI A;  3OOP A;  3FIW A;  4HEA 2;  2MLK A;  2LRE A;  3LSK A;  1DU0 A;  1TLH B;  1Z91 A;  3H5A A;  5D5V B;  1E17 A;  4HG2 A;  1LB2 A;  1T38 A;  3CO6 C;  3GFI A;  1S6L A;  4XRS G;  1MNM C;  4DGW B;  1VQ7 I;  2NVQ J;  2M7B A;  5GPC A;  2KRF A;  1W5S A;  2R7O A;  4UUT A;  3S1M J;  2Y2Z A;  3WE2 A;  4OMZ A;  1T0F A;  2A3S A;  5BMZ A;  5LLQ A;  3K1N A;  4A0Z A;  1HKQ A;  2W7N A;  1JTX A;  4BEH B;  2LY9 A;  1ETO A;  4I02 A;  3ERM A;  1YJ9 I;  4OIP F;  2D45 A;  1DQU A;  4A5N A;  3IKT A;  3S1R J;  1RNL A;  3UKG A;  1PDN C;  2R92 J;  3K4K A;  2R5Z A;  3ZQF A;  1N78 A;  2LC2 A;  1YYV A;  4BDZ A;  2F4M B;  1KON A;  2EIM H;  3OS0 A;  2LLK A;  3PJR A;  1JGS A;  2VQG A;  3G3Z A;  1T56 A;  2IGN A;  1MDM B;  1MBH A;  2KP6 A;  2X1D A;  1WGX A;  3H3Z A;  1ZG3 A;  1OQY A;  1W7P D;  4CXF A;  4BE0 A;  1NTC A;  5A2Q Z;  3F9K A;  5EG0 A;  2IGK A;  4PZJ A;  3FXO A;  1X4P A;  4RGS A;  3PNV A;  3LNQ A;  4J19 A;  2PMU A;  3GXO A;  4NQW B;  3CUO A;  4IKF A;  2DQR A;  4ETS A;  1Q1V A;  1VQL I;  4C3I J;  2CGP A;  2HS5 A;  4RAY A;  1UHS A;  2BV6 A;  2CWE A;  2DA3 A;  2IGO A;  2FUG 2;  1RR8 C;  1K6O A;  4N0B A;  2PI0 A;  3L2W A;  1YE9 A;  2LTP A;  1ZLK A;  3NWT A;  2O3F A;  5CVU A;  1VTN C;  5LRR A;  3RDI A;  1R5I D;  5BS6 A;  3M4O J;  1S8N A;  3WOD F;  2HGC A;  5BOX A;  4NBQ A;  5DD4 A;  5FRN A;  1USS A;  4I2O A;  2CG4 A;  1X1A A;  2YX7 A;  4B3A A;  3RQI A;  3FDY A;  1J2X A;  1STZ A;  4OMY A;  4C2M J;  4G94 A;  2KHM A;  3K6G A;  3K70 D;  4R1H A;  4A6D A;  1J0R A;  1SAX A;  2MSY A;  1L0O C;  3SDB A;  1IDY A;  1WWX A;  3QOD A;  3QU6 A;  4X1E A;  3CLO A;  3RJP A;  2NRA C;  3S8P A;  4GXO A;  2R5Z B;  4HRI A;  4UUV A;  3S2D J;  1D8J A;  2OV7 A;  1LQ1 A;  1FMW A;  1VZ0 A;  2GXB A;  3S1Q J;  5E3L A;  3RPQ A;  1W1W E;  1U0J A;  1QPI A;  3HSE A;  3S32 A;  5GTI C;  4XIC A;  4UV8 A;  3FKJ A;  2DA1 A;  4S05 A;  4DNC A;  4BE1 A;  1K78 A;  2IVM A;  2WBM A;  2XAS A;  3QU3 A;  2ICW G;  5EG0 B;  3BR2 A;  1TQP A;  1FYM A;  1MJB A;  1OCO H;  4EJW A;  1MMG A;  2VBY A;  1IV8 A;  1C0W A;  1KQ0 A;  4XQF A;  4IL6 C;  3DTI A;  2PQ8 A;  3ZCO A;  1ZGA A;  4BS9 A;  2DA2 A;  4OAY A;  4DIQ A;  1HW1 A;  4FAS D;  4CUG A;  1IC8 A;  2DTZ A;  2OCE A;  2HU9 A;  1Y1V J;  2D1H A;  2ESH A;  2O0P A;  3BOQ A;  2M4G A;  2MFZ A;  4A3L J;  2NXN B;  4EAT A;  2DA6 A;  2FNA A;  1FMV A;  2GOX B;  5HOD A;  3F8F A;  4F3Q A;  4O3M A;  2JQN A;  1UEL B;  1IAW A;  2M8E A;  1V5E A;  3LSH A;  2X4H A;  3TP0 A;  4MQV A;  4RDU A;  4KN4 X;  3M1C A;  3HSF A;  2R7R A;  3CMM A;  3E6C C;  2R7W A;  4XRF A;  1YHQ I;  1X3U A;  1ZRE A;  4UV9 A;  4M3B A;  3BJO A;  4I99 C;  1DPU A;  2A68 F;  2A5Y B;  1IN8 A;  4A3F J;  1W5C C;  4F91 B;  2VJI A;  5EJC A;  1OR7 C;  4BYY A;  3VYT B;  1IDZ A;  3O3K A;  5CJ9 A;  4ESF A;  4XKB A;  2K86 A;  3QP6 A;  4GGG A;  2IA0 A;  2P0W A;  4JOM A;  3SDG A;  4MTE A;  4HZF A;  3GEZ A;  3J7Y J;  1BW5 A;  2HOS A;  5DCF A;  2MLG A;  3FXQ A;  2YUS A;  3FK7 A;  3CCU I;  1K78 B;  3TMO A;  2QKL B;  2XB5 A;  1IXR C;  3CP8 A;  3W6V A;  1BI1 A;  1KYZ A;  2IAI A;  4K2E A;  2XB0 X;  1EF4 A;  3FXM A;  4L18 B;  1MD0 A;  3ZMZ A;  2RGV A;  1TP4 A;  4XLN F;  2IP2 A;  4TV7 A;  3ZGK A;  2DFE A;  3DXJ F;  3VPR A;  3FHZ A;  4BXF A;  3PM1 A;  1AKH A;  1VQK I;  3K7A J;  5IY5 H;  4WCG A;  4IJA A;  1S3J A;  5LEJ A;  2XAJ A;  1P4W A;  3LAJ A;  1E3P A;  3BLY A;  4CZC A;  4BDY A;  2JK3 A;  1D5V A;  4A12 A;  3QOE A;  5M3F J;  1G4D A;  5E1Z B;  2F5D A;  2ZSH B;  2NAZ A;  2XF5 A;  1Y39 A;  2UXN A;  1AA7 A;  1D8K A;  2BW3 A;  2QEN A;  3EET A;  5LHH A;  3BP8 A;  4J00 A;  1QPM A;  1UG2 A;  1VF9 A;  1ZQ3 P;  4RAF A;  2NVX J;  3V7C A;  1LUJ B;  3C2G A;  1FYK A;  3ROU A;  3UR3 C;  3CMY A;  2VPL A;  4ENJ A;  5KVR A;  2KMU A;  2CU7 A;  3K9T A;  3EDP A;  3OS2 A;  4B47 A;  1XGS A;  3MKW B;  3OYI A;  4A3I J;  4G9Y A;  2HKX A;  2V1D A;  4AIH A;  1MJA A;  5FD6 A;  3HRU A;  2ME0 A;  2BHZ A;  3PUB A;  1FNN A;  4ZYA A;  3HDD A;  1W4M A;  2LOO A;  4MNU A;  2E36 A;  5LHG A;  5H6Q A;  2WB1 N;  4Q48 A;  2P7C B;  1Z67 A;  3GUD A;  2KIM A;  2R4G A;  1JUM A;  1VQ5 I;  3N97 A;  4F52 A;  3ZQ7 A;  3WG7 H;  2M7A A;  3RCO A;  4ABZ A;  2D5V A;  3PNT A;  4M9Z A;  4EEF G;  5K7H A;  3OIP A;  4BHB A;  3A01 B;  4DW6 A;  5L3D A;  1FSH A;  1Z7L A;  3MZY A;  4XL9 A;  4RA2 A;  5IYB J;  1ZYR F;  1MKM A;  2DN0 A;  2ECC A;  3KP3 A;  3IC7 A;  1APL C;  2HYJ A;  3DEW A;  2GZW A;  2EZH A;  3ZRG A;  3G1M A;  1TBX A;  1U5T A;  2NS0 A;  3EUK L;  5DM6 F;  1D1C A;  1KZH A;  5JR3 A;  4R79 A;  1WKM A;  4Y3O A;  1KGS A;  3GTL J;  1BM9 A;  3MCZ A;  1DDN A;  4OWR B;  2EB7 A;  4IOC F;  1X3Z B;  2KZV A;  4NHJ A;  5LD2 C;  2DDB A;  2L54 A;  5FO5 A;  3HSR A;  2UUZ A;  2LRD A;  4IRI A;  1SMY F;  2H8R A;  1GLN A;  1SD7 A;  2KL4 A;  2ZME A;  2PEX A;  2F4O B;  3P9C A;  5FLV A;  2BXY A;  4NNJ A;  1FBS A;  2EZL A;  1OYW A;  2ZNY A;  3NAU A;  4KMF A;  4Y7N J;  1OCR H;  2MAB A;  2M9H A;  3GLL A;  2CQ7 A;  3BG9 A;  3OOU A;  3L2R A;  1FSE A;  1FP1 D;  5EZH A;  3JRH A;  2CYY A;  1ACI A;  1D0Z A;  2A5W A;  1BI3 A;  5C4J J;  3SZP A;  1Y6I A;  2E1N A;  4G7Z F;  2A6T A;  3RKQ A;  1FX7 A;  3JR9 A;  2LR8 A;  2D2W A;  2BE5 F;  4P96 A;  1KQ8 A;  1T33 A;  4PJ0 C;  3QYE A;  1IUF A;  3VYR B;  3FMR A;  2P6S A;  2K5C A;  3PO2 J;  1I3A A;  1Y56 A;  1TQI A;  2L9R A;  4BE2 A;  3Q5F A;  1HF0 A;  6PAX A;  2MH2 A;  1M1E B;  2LYC A;  2K3F A;  2P81 A;  4L9J A;  5ICF A;  2CFO A;  3W3C A;  4HLY A;  4CYD A;  3MMY B;  3A1Y A;  3PNY A;  1YS6 A;  4YIF A;  4DZP A;  4CIC A;  2ID6 A;  3I59 A;  3L2C A;  3DTK A;  1D0X A;  2V4J C;  1NG6 A;  4LJZ F;  1I5Z A;  1PVE A;  3V8J A;  3SZG A;  4IHY A;  1KU3 A;  3Q0V A;  3BJA A;  2H1L A;  4EJO A;  2X6X A;  1Z7U A;  4HA8 A;  3AKZ A;  4RS8 A;  4XM3 A;  3OYL A;  5CPR B;  2NNN A;  1B1B A;  1W36 D;  2B63 J;  1XGO A;  5M3M J;  3VDX A;  4DYR A;  3COA C;  2Z33 A;  1ZKG A;  3FXJ A;  1UHW A;  4ZDL A;  4UVA A;  3LQQ A;  2V1X A;  1TZL A;  3RYP A;  2COB A;  1T8I A;  1WQ2 A;  2CQX A;  3M3Y J;  3QQA A;  3OY9 A;  2MGQ A;  2HTJ A;  3BQZ A;  3CCY A;  1BJZ A;  4FX4 A;  3KYC B;  2LBF A;  1TQM A;  3IUO A;  3REO A;  4FHT A;  3R0J A;  3GO5 A;  3L7W A;  4AM3 A;  2DTR A;  5K7F A;  3HRM A;  5LGU A;  3W6K B;  3JW4 A;  3KCC A;  1HQC A;  3WTZ A;  3EPZ A;  1HLV A;  4BJ6 C;  3G6E I;  2QQB A;  1D0Y A;  2UWM A;  3LSR A;  1FOX A;  2PX9 A;  4BAY A;  2QSH X;  4KT5 C;  2Z1D A;  3F8N A;  4MO7 A;  3RIR A;  1B8I B;  3JCU C;  2BOL A;  5F04 A;  3C2B A;  1O3S A;  4CCL A;  1VQ8 I;  3Q9V A;  5EF6 A;  1S7A A;  2ZCW A;  4OOI A;  1SEU A;  2P5K A;  2CQN A;  4UB8 C;  1D1B A;  1WJC A;  3EYI A;  2ZFW A;  2OC6 A;  3GBG A;  2QLZ A;  2PJR B;  5EEA A;  1VQO I;  4RGX A;  2XSD C;  2OU2 A;  2RDP A;  1S9H A;  4FIS A;  1ETQ A;  1R36 A;  2BY1 A;  5IYD J;  3OWT A;  4V2F A;  2V9K A;  4HF1 A;  5F0C A;  3AAF A;  1R9T J;  2M1B A;  4IQ4 A;  1TNT A;  5HNF A;  5EGO B;  2X48 A;  5J1R A;  2E34 A;  3QPT A;  3GTP J;  2OBP A;  3BY6 A;  4OAZ A;  1K4S A;  2EBI A;  2X85 A;  1U9N A;  2KZG A;  4V19 K;  5D6E A;  1P7J A;  2KPM A;  2NS8 A;  2L9N A;  3OYD A;  4GRI A;  2OZ6 A;  4C3J J;  2EA2 A;  4MFE A;  3FMQ A;  3DQV C;  2EIL H;  5H20 A; 
#chains in the Genus database with same CATH homology
 2ZXH A;  2X1C A;  3CES A;  4NC8 A;  1X1C A;  3IP4 B;  1WFX A;  3MD2 A;  2IS4 A;  4Y33 A;  4RLF A;  2KRH A;  1MND A;  2VQH A;  3RTR A;  3OYC A;  3IAS 2;  4PJL A;  2Z16 A;  2VJ5 A;  2R7V A;  3MKZ A;  3EUA A;  2X51 A;  4XLA A;  2E5Z A;  4DBQ A;  3OYK A;  4II3 A;  2X6W A;  2W4S A;  4E6K G;  4XN0 A;  1WJD A;  2VL8 A;  4E4H A;  1PYV A;  5CQG A;  5JHF A;  2VJ4 A;  4PFO A;  2VXZ A;  2HVR A;  4HEA 2;  2LRE A;  3LSK A;  3H5A A;  4FET A;  4AU7 A;  4HG2 A;  4HST A;  2HVS A;  3H9Q A;  4E7I A;  3CJR B;  4DGW B;  2IS2 A;  2M7B A;  2E1M B;  4Y4R A;  2VQC A;  2R7O A;  2VKH A;  2XF7 A;  2CUJ A;  4J01 A;  2UV1 A;  4KIT B;  1YX5 A;  2W7N A;  2WAF A;  3D5R C;  3HC7 A;  2WAQ A;  3DPU A;  4BEH B;  2R7S A;  2R7U A;  1MMN A;  2L7K A;  5FRM A;  2Q1Z B;  2AQF A;  1DQU A;  4AYB A;  4HSR A;  4B48 A;  2DOA A;  3L2V A;  2I8D A;  3S3M A;  2L5Q A;  2F4I A;  3HPG A;  3LSI A;  3K4K A;  2VQL A;  1WJF A;  2LY1 A;  3OR2 C;  1N78 A;  4C9Y A;  3LSG A;  2LC2 A;  1LKX A;  4BDZ A;  1KON A;  3OS0 A;  3PJR A;  2VQG A;  1Z3Y A;  3BG7 A;  4ZC3 A;  4DBR A;  1K6Y A;  2IGN A;  3H9J A;  2KP6 A;  2JSP A;  2X1D A;  3FBI B;  4BE0 A;  3OYN A;  3H5R A;  2WY8 Q;  2HPI A;  3F9K A;  2IGK A;  4ZDP A;  1X4P A;  3DTE A;  4ZJZ A;  4KJZ A;  3PNV A;  1N75 A;  4NQW B;  4IKF A;  4JQF A;  4HNT A;  2CV1 A;  1X19 A;  4IQJ A;  2R7Q A;  3E1S A;  2IGO A;  2FUG 2;  3NWS A;  3H35 A;  3L2W A;  1YE9 A;  5HLT A;  4F93 B;  3M8J A;  3NWT A;  3AFH A;  4LIV A;  2VXD A;  3EUH C;  2VIX A;  3PSF A;  5FRN A;  4D1Q A;  1X1A A;  1QHH D;  3DWL E;  3FDY A;  1MNE A;  1P9Q C;  2VKD A;  1BOB A;  3QYB A;  2KHM A;  1BR2 A;  3K6G A;  3K70 D;  3HXL A;  4ANJ A;  2PMZ A;  1DGW Y;  3SDB A;  3QOD A;  3SEZ A;  3S8P A;  4HRI A;  2V7F A;  3BCB A;  1LDK B;  2OV7 A;  2F5V A;  1FMW A;  1VZ0 A;  2HQA A;  2ZFU A;  1ZEL A;  2V6E A;  3K70 C;  2DT7 B;  4C2U A;  1U0J A;  3A4C A;  3K4B A;  2AQE A;  3L2Q A;  3S32 A;  4HPQ A;  3FKJ A;  2BVM A;  3K10 A;  4C2T A;  1BR4 A;  2K9M A;  4BE1 A;  3LL7 A;  2KRC A;  2ELJ A;  2WBM A;  4XKW A;  2IXS A;  4PJM A;  3C2H A;  2JVH A;  1NG7 A;  3PFY A;  4XNF A;  1MMG A;  3K4N A;  3AL0 B;  4XQF A;  1W36 C;  2R7T A;  3DTI A;  3ZCO A;  4BS9 A;  4C30 A;  2DT6 A;  1SAU A;  4OAY A;  4DIQ A;  4FAS D;  4CUG A;  2HU9 A;  3DKX A;  1JI8 A;  2O0P A;  2M4G A;  2MFZ A;  4YRV A;  1Z3X A;  4EAT A;  4BJ5 C;  1FMV A;  2GOX B;  2JQN A;  4F3Q A;  1UEL B;  4BU2 A;  1V5E A;  3LSH A;  2CV0 A;  3M1C A;  2R7R A;  1X1D A;  3CMM A;  1WJA A;  2HVQ A;  2R7W A;  2MC4 A;  3PSI A;  3BC8 A;  3S3O A;  2JVG A;  2Z2S B;  2LY2 A;  1LFP A;  2E5N A;  4F91 B;  2K3P A;  3BCA A;  1D1A A;  2VJI A;  1OR7 C;  3BG6 A;  3I3L A;  3OL3 A;  3VYT B;  3E0J B;  4XKB A;  2KDO A;  2P0W A;  4JOM A;  3K4J A;  2WAE A;  4XKC A;  1DP3 A;  5HOO A;  1J09 A;  2KQR A;  2L2O A;  4H4K C;  1WJ5 A;  3D5L A;  2CW7 A;  3DPT A;  2M3A A;  4EYY Q;  3DU5 A;  3TMO A;  2QKL B;  2V26 A;  3CP8 A;  2VLA A;  4F55 A;  3UNG C;  4BUP A;  2ZXI A;  2WA0 A;  1HA8 A;  1SFK A;  5CQE A;  4DOZ A;  2Q2E B;  4CH7 A;  3TBI A;  3ZGK A;  3TL4 X;  2DCE A;  4ZTJ A;  3HL2 A;  4BXF A;  3S3N A;  4XOT A;  3W2W A;  3BLY A;  4CZC A;  4BDY A;  3VWB A;  1R6R A;  4XLF A;  3V42 A;  1QHG A;  4ITV A;  3RQ4 A;  4CSW A;  3QOE A;  2O0Q A;  2ZSH B;  2XDV A;  3A2K A;  2XF5 A;  2L9S A;  1MW7 A;  2WB1 A;  3OIQ A;  2WAD A;  1AA7 A;  2BW3 A;  3DLA A;  3K4C A;  4J00 A;  4II2 A;  1G59 A;  1Z21 A;  3DU6 A;  3C2G A;  3UR3 C;  2VPL A;  3VYS B;  3FBN B;  2LG4 A;  2X1E A;  2KMU A;  3KYL A;  3VSL A;  4BQO A;  3J7A Y;  4ZTF A;  3OS2 A;  4B47 A;  3MKW B;  3RSN A;  3OYI A;  1T0F C;  3HOT A;  2LBF B;  3LSM A;  3CF2 A;  2KLO A;  4BAC A;  3PUB A;  4ZYA A;  1E0E A;  1YX3 A;  2LOO A;  2HZD A;  4QPQ A;  2JUG A;  4E7Z A;  1N77 A;  3OR1 C;  3OYE A;  3HKZ A;  2R4G A;  2E60 A;  4F52 A;  3L2U A;  2M7A A;  3RCO A;  4XLH A;  2CV2 A;  3PNT A;  4XMY A;  3W2V A;  4N4N B;  3OYJ A;  1WJB A;  1WJE A;  3OIP A;  4YEL A;  2QKM B;  4PSW A;  4PFP A;  5KHD A;  1Z7L A;  4XL9 A;  2BVL A;  5TGT A;  4PK4 A;  5CKT A;  2HPM A;  4BQQ A;  4NUB A;  2ZSI B;  3LFU A;  2VAS A;  2PJR A;  4IX7 A;  4PSX A;  1BR1 A;  4YEJ A;  3ZRG A;  3EUK L;  4CA0 A;  1D1C A;  3RPU D;  4CCN A;  2XC7 A;  3DPL C;  4R79 A;  4BGD A;  3H9G A;  3AL0 C;  3ONQ A;  4Y3O A;  3HG9 A;  1UG0 A;  2IS6 A;  4XOR A;  4OWR B;  3SYT A;  2W00 A;  2KZV A;  4B43 A;  1MMD A;  5LD2 C;  4AVZ A;  2UUZ A;  2LRD A;  4E7H A;  1PJR A;  2XF6 A;  1GLN A;  2KL4 A;  2HNH A;  3OYA A;  3MKY B;  1MMA A;  1LVK A;  4F92 B;  4NNJ A;  3HOS A;  3KEY A;  1OLT A;  2IS1 A;  2MAB A;  4XKV A;  4U7B A;  4X0G A;  3OOU A;  4E7K A;  3L2R A;  3PL8 A;  4LIT A;  3SEQ A;  4E7L A;  3OYM A;  3G2B A;  4LG3 A;  4XLE A;  1UAA A;  2RQQ A;  2K9L A;  4B44 A;  1D0Z A;  2A5W A;  4CCK A;  4P5O A;  4DJA A;  3ZXS A;  1Y6I A;  2A6T A;  3H5N A;  2LH9 A;  2W82 A;  2W1O A;  3W2A A;  2MD0 A;  3HUG B;  1EA3 A;  3QYE A;  3H0D A;  3VYR B;  2DXI A;  2K5C A;  5FRO A;  1Y56 A;  2RRE A;  4BE2 A;  1V5F A;  2CMP A;  5KNL A;  3OL4 A;  2LYC A;  2JA2 A;  4KT6 A;  2E1M C;  4RMN A;  2NOJ B;  2CFO A;  3W3C A;  3MMY B;  3A1Y A;  3PNY A;  5HNH A;  2MYS A;  4N4O B;  2VB6 A;  2RNG A;  3ZQQ A;  3LMM A;  3S93 A;  4RLQ A;  3ZR8 X;  2OUM A;  4BEH A;  3DTK A;  1ERD A;  3D5S C;  3OYH A;  1D0X A;  2O5R A;  2V4J C;  4XON A;  1NG6 A;  2CUZ A;  2HDW A;  3SZG A;  2CS3 A;  4KIS A;  2DJI A;  3CJQ B;  3HPH A;  4LIU A;  2X6X A;  3AKZ A;  1W36 D;  4XM3 A;  3OYL A;  5CPR B;  1DGR M;  2BW3 B;  3K4L A;  3VDX A;  1IRX A;  4ZDL A;  4BJT A;  3FHN A;  1TZL A;  2IGM A;  2R7X A;  3OYG A;  1G8X A;  3OY9 A;  2LBF A;  3CZ6 A;  2XSJ C;  4XOP A;  3OS1 A;  3IUO A;  4MLO A;  4IZZ A;  1X1B A;  4HNU A;  2VJJ A;  4PJJ A;  2M4K A;  4CCM A;  3CP2 A;  4XLC A;  4CCJ A;  2WY7 Q;  3I9V 2;  3DKY A;  3EPZ A;  4RM2 A;  5LFA A;  3DEE A;  2M0M A;  4B3X A;  4BJ6 C;  2V1N A;  4BL0 B;  2CH0 A;  3QYF A;  1T95 A;  1D0Y A;  2UWM A;  4XN3 A;  4PUS A;  2Z1D A;  2XAU A;  3VSK A;  4ZDO A;  3N05 A;  2BOL A;  4NC7 A;  4CCO A;  4CCL A;  3OYB A;  4QPO A;  1V5G A;  2CW8 A;  1D1B A;  3KX2 A;  4U87 A;  1WJC A;  3OYF A;  2OC6 A;  3OMY A;  3GBG A;  2Y0S A;  4E7J A;  4PJN A;  2PJR B;  3U21 A;  1S9H A;  3K4M A;  2X6Y A;  2F6C A;  3OWT A;  1TT0 A;  2V9K A;  4P1W A;  5KCM A;  5HVQ C;  1QU3 A;  3IAM 2;  4BQN A;  2HW2 A;  1X4O A;  4IQ4 A;  5HNF A;  4G6T B;  4XR6 A;  2GOM A;  4OAZ A;  2X85 A;  2KPM A;  4E7S A;  2L9N A;  3OYD A;  4GRI A;  4D9J A;  4RM3 A;  3VYU B;  3DQV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...