1WFXA

Crystal structure of ape0204 from aeropyrum pernix
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
180
structure length
180
Chain Sequence
VRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable RNA 2'-phosphotransferase
publication title Crystal Structure of the RNA 2'-Phosphotransferase from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
total genus 46
structure length 180
sequence length 180
ec nomenclature ec 2.7.-.-:
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wfxA01
3.20.170.30 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 1wfxA02
1WFXA
chains in the Genus database with same CATH superfamily
2F5DA 2LBFB 1IG7A 5M5XJ 1BJZA 2BXYA 3LMMA 3FXRA 2OTLI 3RTRA 2IRFG 4XKCA 1Z7UA 5CVVA 5B3SH 1U5TB 5E3LA 3JCUC 1BBYA 5KVRA 3WG9A 2IS4A 1ZKGA 2K27A 1U3EM 4EJOA 3ZQCA 3E6DA 5F6FA 4MGRA 3JRBA 5E20A 4Y17A 1IRFA 4A69C 5JHUA 3F8BA 2R7VA 3B6CA 3BCAA 1MH3A 2VQCA 1B72B 2DQRA 3JTGA 3MKLA 3A0BC 3RI4A 4XN0A 2P7VB 4BDYA 3J7AY 5L3DA 4A3EJ 1YQAA 2P5LC 3FXLA 2Y9ZA 1W0TA 3OIOA 1OKRA 2OF7A 4OIOF 4CCOA 4LG0A 3H5NA 2EFOA 4G6QA 1AKHB 4LGWA 5F0HA 1FJLA 3HJEA 1PP8F 1OMIA 5E17F 3PUBA 1SAXA 3NEUA 3OR1C 2O6GE 1R1VA 2KQRA 2Y48A 4OINF 2ISZA 2KJBA 1HCRA 4Y4RA 5L3EA 3WTUC 2ME0A 3O8GA 4Z2YA 2XPVA 1F5TA 1D0YA 2E60A 3R0AA 3MFKA 3C2HA 3QU3A 1LVAA 1XGSA 3D5SC 2P6TA 3EPZA 2L01A 2M87A 3HUGA 4HZFA 1JHFA 1FOWA 4XSZF 1J2XA 4B3XA 2KZGA 3BPXA 3ERED 3JRHA 1BL0A 3SDGA 1XD7A 2CQKA 5M5WJ 1BC8C 3AL0B 3H3UA 4CICA 3E3VA 3HOZJ 3UNGC 3RJPA 3BJ6A 4IRIA 2A69F 2K4JA 2HU9A 2K9MA 3IH2A 4C3HJ 1GHCA 3B02A 1YW7A 2DA2A 1KYWA 2KFDA 1F1ZA 2O03A 5B1AH 2E7WA 3CZ6A 4UB6C 3VYRB 4RB2C 1MJAA 3TKYA 2BHYA 1Y39A 1P9QC 3OYMA 2DFHA 2XDVA 3TEDA 1DGRM 2F2EA 4WX9A 2OZ6A 3TDUC 3RYPA 2AHQA 3QYEA 2M4KA 3K9TA 3MEXA 4LOCA 4PUSA 2ZCWA 1XMKA 2CV0A 2XV4S 2JJ7A 3IP4B 3CJRB 3AG4H 3CUQB 4OWRB 5K5QA 5HNHA 2E2JJ 2KIQA 1HKQA 5FD5A 4XSXF 1ZN2A 3G3ZA 1CF7A 1BIBA 2QQBA 2KIUA 2AQFA 3F8FA 1K6YA 3W2VA 3K70C 2QZ8A 1QA6A 1XSXA 2BXZA 3GVAA 3LA2A 2Y75A 4WXHA 4M6YA 2QSGX 5LGNA 1OCZH 2HGCA 3U21A 1HSTA 4ESJA 2Z1DA 2J5PA 1K7AA 1IDYA 1P7JA 4GO1A 1FBUA 2DA1A 4G6TB 2WAQN 2EH3A 3GTKJ 3AG1H 2X48A 3L1PA 2VBXA 5E18F 1YS6A 2BY0A 3DKYA 2HYGD 4P1WA 1JT0A 4UNOA 4IHXA 2KDZA 2OV7A 3I55I 2CQXA 2IGOA 1LNWA 2V9KA 4ZDOA 3ISPA 2AO9A 3SJMA 4A93J 2DTRA 3S8PA 2JVHA 2R92J 4EM2A 3RKQA 2VXZA 1Z1DA 2L7KA 5D4RA 4CYCA 1D5VA 2B0LA 2QQAA 3L2UA 2CW0F 3FX3A 3TP3A 2KT0A 1JGSA 1YLFA 2O7OA 3OL3A 1ZAOA 3WODF 3GTMJ 1ZR4A 4BKXA 2P5VA 2DDAA 4UB8C 4BE1A 2HFHA 3L2CA 2LK2A 3CD6I 2XB0X 2M2EA 4AYBA 1RUOA 3EETA 1WWXA 2X6OA 4G7HF 4RS8A 4LJZF 1SD5A 1WVRA 2LF7A 2XB5A 3CO6C 2DI3A 5E1ZB 3COAC 1LKXA 1R36A 4IHTA 2MA3A 5L3FA 1MBGA 2H8WA 3X2QH 2JQ7A 1EV7A 3LWFA 1V5GA 2K3PA 2DA5A 1WJBA 4RGSA 1OYWA 1RETA 4A12A 1TZLA 3S2DJ 4J00A 1U5TC 1PYVA 2NVUB 1LFBA 2HS5A 3I53A 3K1NA 1HDDC 2GWRA 2X1CA 4GYIA 4LMYA 2ZJQF 3KP6A 2FBIA 2KRCA 3ZCOA 5DM6F 3DLLF 1R5HA 3F6VA 3KZZA 2CFOA 1U8BA 4A2UA 4YELA 2KJCA 3CESA 2DT5A 2DJIA 2P4WA 4FX0A 3TO7A 1BI1A 4UY8I 4ZYDA 1IN7A 1AWCA 3KP3A 4M72A 2A07F 4JYKA 3MKWB 4Q4ZF 4YFKF 2OJED 1LEAA 1OYYA 4M9SA 2ZJ2A 3MVPA 3F8MA 2L5QA 2DXIA 5H6QA 2HTSA 5F1RA 4PJLA 2KL4A 2VT2A 4V2FA 3IL2A 4PGGA 1IV8A 4NC6A 1HBXG 2EFPA 2ADUA 5GAHJ 2LDUA 2R7QA 2ZB9A 1T38A 1KU7A 4ETSA 2LKXA 1WH7A 2AXLA 3GEZA 1W7PB 3GO5A 3GZNB 4PJJA 4FTHA 4S0HB 4WCGA 4DYCA 3GW2A 3GX4X 5F27A 4CO8A 2W7NA 1ZGAA 2IS2A 1Z3XA 3G1MA 4RDUA 2L02A 4Y13A 1HSJA 2HYJA 2L4MA 2PX9A 3HG9A 3OWTA 4FT8A 2CUFA 3ABMH 4H4KC 1REPC 4AIDA 2BY3A 3OYIA 1J5YA 2ID3A 2O5RA 3GFLA 1YJNI 2XROA 2X6WA 2M4GA 4OAYA 3RYRA 3OYLA 1KU3A 1FOKA 2I10A 2ZXJA 4L9VA 5HS9A 5LD2C 3HHHA 5AIQA 4ESFA 2FUG2 4EMSA 5K7FA 3AL0C 1U6GA 2L9SA 3A0HC 4YRVA 4UVCA 2M1BA 1VQKI 2VBZA 4NNJA 4X0GA 5FFZA 2M0CA 3CJTB 3BOQA 3HOXJ 4BQNA 1IAWA 2F5CA 2HQNA 4L9TA 2XUBA 4YIRX 2XSDC 1WJAA 3WTXC 4CZZA 2PEXA 4ESBA 2K4BA 1A04A 4GRIA 4AVZA 5EG0B 1O7FA 2OC6A 2Q0OA 2Z3YA 5DEQA 5IP9J 4E70A 3EQLF 2E36A 2LBFA 3OYGA 2YU9J 1EH6A 3CP8A 2UXNA 2JA6J 3BG9A 3ZQFA 1I39A 4ZYGA 1U5TA 3K6GA 1B8IB 2R4GA 4XQFA 1MMDA 1XG1A 3W6VA 1OJLA 3CUQC 4RB0A 3E7LA 4I6ZA 4LIVA 1EA3A 3DPLC 5FLMJ 2P8TA 4XLEA 2DOEA 2HI3A 2HOSA 1XDUA 3OYBA 1BI2A 1BJAA 3TW6A 2NVTJ 3T8TA 1YX5A 3F21A 1B72A 4MHGA 1YYVA 4DZJA 1ORKA 2LRDA 2NNNA 3RCOA 4A3IJ 1R1UA 3V8KA 5E8GA 3FBNB 1ZK8A 3G1LA 1Y56A 4M3FA 2KIMA 4XLAA 2V1XA 4XMYA 4R79A 2L2OA 1B4AA 1Z21A 3GTJJ 3H0DA 2JA8J 1AKHA 3GZ6A 3ESWB 1WKMA 2R7TA 4ZZDA 5EZGA 2HVSA 2Z2SB 2ZNZA 1X1AA 5J40A 1HA8A 2VQLA 1VI0A 3CCQI 1ENHA 3BROA 4O3MA 4BE2A 5DTDA 3HHGA 1A31A 4I7HA 3GZ5A 2Q8KA 2MH9A 1KQ9A 4BXFA 3FXUA 3GCMA 3KX2A 3GFIA 5JVTA 4C2TA 1QZEA 2XF7A 3ZMDA 2VBWA 2MLKA 4A3MJ 1WJCA 4HF1A 2DPUA 5BQTA 3FK6A 1KGSA 2GA2A 2CH0A 2LMDA 2V4JC 4G12A 4CUGA 1D1AA 3TBIA 3U9GA 4XKWA 5FKLA 4AC0A 2P6SA 1MKMA 2BYVE 4KITB 2GAUA 2V9PA 3BR0A 1IXCA 4XOTA 1GV2A 1CQTA 1H89C 3CO7C 3E1SA 4BY1J 2QGUA 3ZQHA 5BPIA 3KYDB 1ZARA 1QO0D 3DKWA 3ZOBA 3CCYA 2JSCA 1QPMA 4CH7A 2GXAA 3IWZA 4BDZA 1R5GA 1BR1A 4XRSA 2FBKA 3OV8A 4IKFA 2H1KA 1ZTRA 2K5CA 4AIJA 3K1PA 5IOYA 1XSDA 4FE4A 5E3MA 1ON2A 2V1NA 4U7DA 2MSYA 5FLVA 3ABUA 3C3WA 2DYSH 4N4NB 3OIQA 4CHUA 3V8LA 3I71A 2IJLA 3DBRB 3FF5A 2L9NA 4JX5A 3HSRA 2P0WA 3OYCA 4HNUA 2A6EF 4A3LJ 3CUQA 2GQQA 3ASOH 3P9KA 5FFXA 3B73A 2MH2A 4UUTA 2K9NA 3BR5A 4HOBA 4NB5A 5HLTA 5IP7J 3ASNH 3H5AA 3GBGA 1SANA 1FWZA 3FHNA 5CQEA 1G3YA 3KLOA 2HDDA 3CC2I 3RIRA 2VJ5A 1D1CA 2MC4A 3RZDJ 2RQPA 2MD0A 3HM5A 1ETXA 3OYJA 3KE2A 5K1YA 2D1VA 1LB2A 3MAJA 1UHMA 2YPRA 3OYHA 2HOAA 3EUHA 4II3A 3EUAA 4XLPF 3PL8A 1RUNA 4EM0B 1ZRCA 4HLYA 2HR3A 2G7HA 4MEXF 3LSMA 3OR2C 3V8JA 5E8IA 3AG3H 1ETYA 2O0PA 3TDZC 1M1EB 2G7UA 3DWLE 2GZWA 2EFQA 3QYBA 3HIFA 1S7OA 1J7KA 2VONA 4Y52J 3VDXA 1IRZA 4JBAA 4FETA 3BLYA 1U9OA 1USSA 1MMNA 1UB9A 4QWQA 4FX4A 3ZP5A 1I27A 2A3SA 1W5SA 3CMEI 4G9YA 4XR6A 4E7ZA 4IHVA 4IHYA 1U2WA 2LLKA 2QM3A 3Q0UA 1Y0UA 2COBA 4PK4A 2EINH 1JT6A 2CRGA 2EB7A 4ZTJA 4IHWA 3S16J 4E7IA 2AUAA 1MJBA 2UV1A 3C1DA 2BY2A 4OIQF 2JTVA 3VB2A 3CCJI 2W4SA 1YIOA 2RDPA 4ZH4F 4AD9A 2NNYA 1UZCA 4X6AJ 2BW3B 4A3KJ 1A5JA 1G8XA 4E7SA 5A2QZ 3WTYC 5E3OA 3LQRA 3HPGA 2H6CA 3L2QA 1FY7A 3IHUA 3BZ6A 1MBJA 1RZ4A 1RKWA 1G6NA 5DD4A 4TV7A 4UXNA 4A0YA 2DT6A 5ERIA 3J81K 1EH8A 3E6CC 2R7UA 3RPUA 2ICWG 3JW4A 2FMYA 3ZXSA 1ONVA 1EKEA 1IN5A 2XPUA 3V42A 2Q1ZB 2EFNA 2EPFA 2W00A 4BE0A 2ELKA 4UHTA 1J09A 4BQAA 2VKVA 1KQ8A 1T33A 3PFYA 1S9HA 3BY6A 3BR6A 2WB1A 2JUCA 2DO7A 2QLZA 3TMOA 4D5FA 2PLYA 4ENJA 4EJUA 1IV6A 2QQ9A 5JLXA 2HQRA 3LSGA 2CUEA 4RAGA 1SFEA 4A3FJ 4C2MJ 2DFEA 4XLCA 2H1LA 4ZZLA 4IPAA 1SAUA 4PFPA 3LA7A 4HQEA 2WA0A 4RGUA 1OISA 1FLIA 1FNNA 3AFHA 1W5TA 4UUVA 2EJRA 3HL2A 2D1HA 1Q1VA 3M8EA 3QPHA 4PJ0C 5LHIA 1J9IA 2PJPA 4E7KA 5DV5A 2P81A 3DLAA 1ON1A 2W25A 2NVXJ 3JAMK 4GDFA 4WXCA 1Z0XA 2LD5A 2ZSHB 4KT6A 3GTPJ 1S5LC 3LSRA 4NDLA 2P7CB 2OBPA 3KYCB 2H09A 2VT3A 4C2UA 3Q9VA 5GAGJ 1ODDA 3QOPA 4MQ9F 2DJNA 1YX3A 2HPIA 3BCBA 3TQNA 1LE8B 4II2A 3N4MA 2CGPA 1X3ZB 2EIJH 2GA1A 3HB9A 3SZTA 5BPDA 1PDNC 1SMYF 3QRFF 2QKLB 1UJ8A 3ML6A 1X3WB 3M07A 1YOVB 3VYTB 1B1BA 3U2RA 4F52A 5FKNA 2K86A 3EUKL 2FNAA 4DBRA 1TW3A 4L9NA 3W6KB 4MIMA 5EG0A 3K70D 4KIFA 4A5NA 1FSEA 1GXQA 2CMPA 4P9FA 3FK7A 2A5YB 1XPXA 1E3HA 3CUOA 2JRMA 3KPHA 4HAMA 2CUJA 5IPAA 3RZOJ 2FMLA 5HDGA 4D7MA 1B8IA 3FXJA 1I5ZA 1Z05A 3HZJA 5CQGA 2ZO4A 3CMYA 1R22A 3HPHA 5J3LA 4FHTA 1X1CA 1HC8A 1B9MA 3A4CA 4ZYEA 3LFKA 3D5LA 1BW6A 4G8XA 1VFCA 2E1NA 4I99C 1SD6A 4PCQA 2KZVA 2EIMH 3O2PE 3I59B 2RGVA 2EFWA 1BC7C 2UUZA 1XTAA 3HSFA 4MFEA 5TISC 3ZR8X 1V55H 2Y0SN 1FOXA 3PUFA 3FMQA 4CDGA 1XSVA 3QPTA 2Y30A 2XIGA 3A02A 5ICCA 3E97A 3JRDA 3BT9A 5LEKA 3JRFA 2HQAA 4HEA2 2GM4A 3Q0VA 4F92B 2Y9YA 2WWYA 3K69A 1S8NA 2EQRA 3H3VK 1HQCA 3I3LA 2E19A 4BU2A 2NRAC 3R0JA 2CG4A 1R6RA 1D0XA 5CVRA 4UVBA 4ENMA 1ZRFA 2HWVA 2A05A 2EA2A 3FM5A 3GMEA 3K1MA 1MBKA 1X1DA 3DFGA 4XIDA 2JQNA 2OZUA 4ZC3A 1JJ6C 4N0BA 5IT3A 2DT7B 1OYIA 1QGPA 4N9IA 3H9QA 3S3MA 2FEZA 3KZIC 2MBFA 4LLGF 3JRCA 1ZG5A 4ANJA 3JSPA 3VWBA 4FCYA 3FKJA 4A6EA 2NVYJ 4BBSJ 4ABZA 5HVQC 3AKZA 3OS0A 1K4TA 4HF0A 4V2GA 2M8GX 2XC7A 2R7OA 1W1WE 1WHUA 3CCMI 1FIPA 4XICA 2QF7A 5FLXK 2DCEA 1N78A 3S1QJ 1FX7A 2VJIA 3KEYA 1SMTA 3K7AJ 3NARA 3PFIA 2A6TA 3VFZA 3S14J 2JZYA 5FJ8J 5BMZA 4K2EA 2A61A 2X1DA 2ZJRF 2LYCA 2MG4A 3PM1A 2ELJA 4MTDA 2E7XA 2QCOA 4IRHA 3PNVA 1JKQC 2CU7A 4A6DA 5EF6A 2K85A 1WCMJ 2DA6A 2JWTA 4F91B 1K79A 3I54A 1BN5A 4I0BA 3ZN1A 2MC3A 3WGIA 3OS1A 2K9QA 3BTLA 4HF2A 4ZDLA 5IT9K 4ENNA 5K7HA 1L0OC 2WBMA 4RLFA 3E5UA 4F55A 2VI6A 3RQIA 5M3FJ 1U9NA 4IXAA 1O3TA 3TL4X 4HV5A 2UZKA 2VOOA 3BZCA 2MW8A 3W6JB 2VKDA 4HV6A 1XC5A 2LKPA 1WSUA 3IUOA 3CCEI 3N05A 1SEUA 3MZ8A 3DXJF 3IC7A 1K6OA 2WTEA 2CFXA 3C2GA 3O8HA 5HDNA 2I5UA 5CYVA 1LEBA 1Z91A 2DFFA 1IN8A 2RNGA 1W5CC 3ONQA 3BP8A 2BEOA 1WRJA 1ZG3A 2EZIA 1S3JA 3QQAA 3I56I 3HOTA 5HLIA 1IRXA 1H8AC 1OFCX 1NTCA 3S1RJ 1OQYA 2W24A 5HODA 3RPQA 4HDVA 1I3AA 1J59A 1IXSB 1SFKA 4KFCA 3KEOA 2F6CA 1TNTA 5A2QK 1T98A 2XPWA 1D0ZA 5CLSA 3WTZA 1DDNA 3Q3SA 1JUMA 2DFIA 4FE7A 3F23A 1YI2I 3KP4A 1JTYA 3RKYA 2VN2A 1GXPA 5TRDA 2FU4A 1AA7A 3LSIA 2STTA 4D1QA 3SXYA 1JJ8C 4M6XA 4P5OA 3FZVA 3ELKA 2H94A 4Y7NJ 2XAUA 4OIRF 1JUPA 4BL0B 3R4KA 4OOIA 2ZJPF 1K61A 1APLC 5E1WA 5F0FA 1UCRA 4A3CJ 2H27A 4BUPA 1FZPB 2AS5F 2ZMEB 2GOMA 1X19A 5EZHA 3TO6A 2L0KA 1VQ4I 2BW3A 1ZREA 3K10A 2X6XA 4V19K 2V1UA 1RESA 4KDPA 2ECCA 3HOSA 3S3NA 2EBIA 2PN6A 1QVUA 4LIUA 4CCNA 5GPCA 4PGHA 3IRRA 1I6XA 1DGWY 2OAZA 2PG4A 2YX4A 3CDIA 5J1UA 4N9HA 2JMWA 3DEUA 3SZPA 2EWNA 1TWFJ 2E34A 4AIKA 3G1OA 3P9CA 1K83J 1X2MA 2DW4A 5JI6A 4A0ZA 1QU3A 2RV8A 4IEJA 5IYCJ 2J5OA 5FGMA 4FASD 4W1UA 2DA7A 1TQIA 4IVNA 3LAPA 2RNJA 1FMWA 3FXOA 3CJNA 5DS9A 2E5ZA 4JX6A 3W3CA 3IAS2 1FBQA 1MSEC 1I50J 1OCOH 2XGXA 2M0MA 3S2WA 4EATA 1F9NA 3LAJA 3J81Z 3CCUI 4Q48A 3CP2A 3BPVA 3ZQLA 1SFUA 3GTQJ 1V4RA 3CCLI 2Y2ZA 2EV6A 1TP4A 4BYYA 5D5XB 1I1GA 1USTA 2XF5A 1AU7A 1VQ5I 2R5ZA 3VSKA 2FJ1A 2C6YA 1EF4A 3MN2A 1IXRC 1P2FA 3H5RA 3S1NJ 2M8EA 3WTVC 2RVCA 3H0GJ 3I5UA 2LY9A 3ABKH 3CMMA 2W1OA 3D5RC 4GXOA 2GXBA 2AQEA 4NUBA 2L9RA 3QU6A 2BVLA 2R7SA 4CCJA 5HS8A 2E1CA 1NG7A 4CA0A 3HRSA 4BBRJ 3OYEA 5LEJA 2DOAA 1JKRC 2X9DA 4JX4A 4UUSB 2PMUA 2G0EA 1OPCA 4D5CA 4AU7A 3JSOA 4AUXA 1VNDA 4U0VA 3DQVC 3CC7I 2FQ3A 4GFBA 3M1CA 4BXXJ 1V3FA 3FIWA 4Y33A 1LE8A 3S2HJ 1QPIA 1G3WA 3VOEA 5LHGA 1I6HJ 1KU2A 5H6RA 1X1BA 1SVLA 2DN0A 3W2AA 3JAMZ 2BE5F 2XRLA 4B09A 5JFRA 3S3OA 1O4XA 1MW7A 5DM7F 4NQWB 5CKTA 4DNCA 1SD7A 2RREA 3DU5A 4BY7J 5EGOB 3LFUA 2IPQX 3E6MA 2R7FA 3TW7A 3FDYA 3M9AA 1IZ1A 2DMNA 5CPRB 1S7EA 2BV6A 5E3NA 5D8LB 2PMZA 2CUZA 1G4DA 4QLCU 2F5EA 2VE8A 2LSOA 2XAGA 4EGYA 4XOPA 1ETWA 2OQGA 2HOEA 4D0PA 3K4LA 1ZGJA 3PIOF 1JI8A 1U78A 2VLAA 4L18B 4G7OF 2VPRA 4ENKA 4XM3A 2XAHA 3FXMA 3CMAI 4KT5C 3SEQA 3KIOA 2KISA 2M7AA 2Z16A 2IS6A 2IP2A 1V5EA 1LPQA 2IA2A 3ZMVA 3DV8A 1R58A 3VODA 2XAFA 1IGNA 3C7JA 2KIFA 2YSRA 4GGGA 4OU0A 4B4CA 1Z77A 1W7PD 2HDCA 3RQ4A 1F43A 1SFXA 3I59A 1IN6A 1KQ0A 1RKTA 5EEHA 4IHSA 5GP9A 2EK5A 2LH9A 3EUHC 3PQJA 1VZ0A 5DDGA 4AM3A 1XB4A 2F4MB 3KLNA 4XRMA 3IH3A 4RM3A 1YITI 1OCTC 2ESHA 4CCMA 4LK1F 2WV1A 1AHDP 3I9V2 2OUMA 2DOFA 2IGKA 1P92A 4U88A 1ACIA 3ECHA 2OCCH 4N4OB 5FKKA 5J4YA 3BTIA 5FO5A 5CVUA 3EYYA 3OOPA 2K7LA 1JTXA 4B44A 3DPTA 2V6EA 1GVDA 1Y8RB 3ZMSA 4ITVA 1QZYA 4GYGA 2OD5A 3G6EI 2RN7A 6PAXA 4M74A 3IAM2 4BHPA 2ZNYA 1W4MA 2DBBA 4RGRA 4RAZA 4D9JA 2ECBA 3KZYA 9ANTA 3AG2H 2ZMEC 1YJ9I 1A36A 2R7DA 2HKOA 5D6FA 1GT0C 3S1MJ 1IJWC 2ZXHA 3CJQB 1BOAA 4BHBA 4ZTFA 2XGEA 2BOLA 3DTIA 2W84A 1XS9A 1JUSA 1MGTA 4OMZA 4LFUA 1F36A 2DQLA 2RC4A 5FRMA 2WC2A 2ZKZA 3V7SA 3F72A 1TC3C 1HLVA 1QNTA 2LR8A 4HBLA 1PVEA 1MDMB 2JRTA 1K4SA 1YRNB 3OSGA 2PI0A 3K4CA 2QKMB 5EDNA 4R1HA 3U1KA 5IYDJ 1KZHA 3CC4I 1B59A 1BOBA 3ZGKA 3CCRI 1DUXC 2ETHA 2ACJA 2OPTA 5FLXZ 2R7XA 3WGGA 3DTEA 5H20A 1UMQA 2R7RA 3G73A 2R0QC 1IRGA 1LQ1A 5LLQA 4EVIA 1ETQA 1R00A 1RC9A 4IOAF 2COMA 1R9TJ 1MZBA 4M9XA 2XF6A 2DAOA 5EEGA 1G59A 4HSTA 1TWHJ 3GUDA 1ETKA 2M45A 4AYBN 1A6QA 2VL8A 2JT1A 2CQNA 1UHWA 4CCKA 2XVCA 5IP6A 2KP6A 3ZMUA 1DPUA 3FM3A 1G3SA 4KJZA 3T0YA 1DU0A 5IT9Z 2XSJC 1X3UA 1ZRDA 4B48A 5J1RA 1YE9A 4IX7A 4BJTA 1WGXA 1XDSA 1ZH5A 5JR3A 4PJMA 2ZBKA 3RKXA 3H9GA 3VEPA 4IQJA 2NS7A 3IV5A 2WAEA 4U7BA 4KN4X 4M3EA 2YX7A 5BS6A 2F5VA 1T8IA 3A01B 1XGNA 4IO9F 2VIXA 2IGMA 1UG0A 2IAIA 1LFPA 4S05A 4ZJZA 1LDDA 2IBDA 2HQ5A 4WF2A 2ME6A 2WAFA 3Q5FA 3BJAA 2TRTA 4E7JA 3HKZA 2VKEA 1GVJA 1MH4A 3DF8A 2V9VA 3GFJA 1QVTA 4KISA 1X4OA 3CLQA 3J7YJ 2XGDA 4KN7X 4C3IJ 3BC8A 1J0RA 4BQOA 4HDUA 2ZMEA 4NC7A 4RLQA 3HOYJ 3GXOA 3GFMA 4Q47A 2VBYA 2DPDA 1OR7C 4XORA 2DDBA 5GAEJ 1NHAA 4NC8A 3ZPLA 5HOOA 4JP0A 2GLOA 3ULQB 3V7RA 1ETOA 3GF2A 1XCVA 2DK5A 2ESNA 2WAQA 4U0WA 2KDOA 5GADJ 4OIPF 1O57A 4HX8A 3JREA 2M30A 4HX4A 2B7EA 2IA1A 1JXSA 3DPUA 1PUFB 3PO2J 5IY5H 3TOBA 1TQPA 3IKTA 4E4HA 3W2WA 5DUIA 5F04A 5J8CA 1FTZA 4QIWN 2V79A 2Q2EB 2PFBA 2BGCA 3DBLB 2MLGA 2GXGA 2NS0A 3TOAA 3HTUA 4D7NA 4MNUA 3QYFA 2ZSIB 4WXDA 2LVSA 3FISA 1LDJA 1NG6A 4XLHA 5D4SA 3MCZA 4FQGA 2K40A 5FD6A 1Z6TA 1U8RA 4I09A 5DCMB 5DYMA 3BG7A 4HNTA 2OTJI 5F0CA 4PDKA 2FNPA 2KRHA 5ILVA 2NOGA 2EILH 2DA4A 3FHZA 1SD4A 2OQRA 3NRVA 5FROA 2R5ZB 3J80Z 3CCVI 2JPBA 2L9VA 3OYDA 1QRYA 3D1NI 1FSHA 2Z9OA 1TT5B 1UAAA 5BOXA 1R4NB 5EJCA 5C3EJ 1GV5A 3AAFA 1NK3P 4L0ZB 3TP0A 3EDPA 1B6AA 4B1RA 4IF4A 2XKOA 4DZPA 2VODA 1G3TA 5HDKA 4CXFA 1P4XA 2QQ8A 2RQQA 3WHBA 4O5VA 2VUMJ 1WI3A 4R8HA 2VASA 3VSLA 3JR9A 3MWMA 5M3MJ 2JA5J 1O3RA 4KYWA 4XNFA 1V5FA 1RR7A 1X2NA 4ASNA 4PSXA 1U0JA 4UUSA 3JRIA 2L7FP 2MABA 1XN7A 3CF2A 2CS3A 2FOKA 2L7MP 2QBYA 1T39A 2DA3A 1FBSA 2HVRA 4C9YA 5GTHC 1WH5A 5ICFA 1T0FC 4GCVA 4EJWA 1JKOC 3S17J 1R5ID 4XL9A 1V54H 2HYFA 2Y69H 1ZYRF 2X51A 4L5JA 2PJRB 3V7CA 4HRIA 1OR7A 4J01A 1D3YA 4LB6B 3WTSC 4NQWA 5EGOA 2WY7Q 2RKHA 1VQ7I 2CW7A 2EZHA 3GLXA 3GTGJ 2BY1A 4LLLA 1Z6RA 2LTPA 3H9JA 2VE9A 1BA5A 5HNFA 2B9SA 4I0AA 2LFBA 1XGMA 5D5WB 3L00A 1FYMA 1QHGA 1TWCJ 2W57A 3F6OA 4CYDA 3OL4A 4B47A 2WV0A 4RGXA 2YUSA 2L3DA 3Q0WA 2XAQA 2L4AA 3HEFA 3L09A 4BXUA 2HXOA 1X4PA 1TL8A 4MFDA 1R71A 1LFUP 3HDDA 3EYIA 4DJAA 1FPQA 3TGNA 2HZTA 2DYRH 4PZJA 3MZYA 1I3QJ 5FKMA 5TGTA 2EIKH 3WTTC 1SFOJ 1Y0NA 2A68F 1D5YA 3BR1A 3GLLA 3MMYB 2ELHA 3ZQGA 5HS7A 2R5YB 1BIAA 5B66C 1ITYA 3C18A 4NBQA 2NS8A 4RMNA 3T1BA 1KA8A 3NWTA 2NAZA 2IXSA 1PJRA 4M3GA 2FSWA 4AWXB 3FKIJ 4XK4A 3BQYA 4Z6YA 2HEOA 3I4MJ 2HZDA 1JGGA 3FXKA 5GTIC 5K7ZA 2VJ4A 2N8GA 3A2KA 1TWAJ 5HLHA 3LL7A 1L3LA 2F5FA 1T95A 1ZQ3P 4J19A 3F22A 3ERMA 2QYOA 2GIZA 4RAYA 5K5OA 1J75A 3K4NA 3CLOA 3HGGA 1R49A 1FOYA 2WY8Q 4AVPA 5LRSA 1MIJA 1XMAA 5FB2A 4JQFA 3HOUJ 3S93A 1T0FA 4XONA 1G2HA 5IOZA 2PBIA 2XRNA 1IUFA 1AOYA 3QODA 4BS9A 2JA2A 2UWMA 3SFZA 2DMUA 1IDZA 1Y1VJ 1MBFA 4LD5A 1W36C 2QWWA 4UVAA 5BNGA 3BTJA 4KMUX 4L5IA 2E2IJ 4HPQA 1LDKB 3K4JA 1SC7A 4X1EA 2K9SA 3BR2A 4M71A 1FTTA 3DU6A 1Y8QB 3QPLA 1FEXA 5EYRA 3GTOJ 1BR2A 5D5UB 1MDMA 1YRNA 3PO3J 3LSJA 4FISA 4PSWA 4YIFA 4E7HA 4KUMA 4U87A 4ZYHA 1ZG1A 4I98B 1WJDA 4ZDPA 3ZQQA 2CV2A 5AIPA 1RNLA 2IA0A 2Z99A 3KP5A 1W0UA 5C4XJ 3F9KA 1RRJA 2FRHA 1PP7U 3F8NA 3BJOA 5LGUA 3ROUA 2Y0MA 3O6BB 1Z67A 3GTLJ 2FBHA 2OU2A 4BEHB 5HLGA 4HX7A 4P9UA 3QPSA 4UV9A 4JK1X 1TW2A 3HKZN 3LQQA 4LITA 3OYKA 3WE2A 3FXQA 3I0TA 3TO9A 2BBYA 4QTRA 5EEAA 5TJJA 4MQVA 2XKPA 1IF1A 3C2BA 3E6BA 5C4JJ 4BNCA 5KK1A 4Y3OA 4XKBA 2ZFUA 1P6RA 2K02A 2W82A 3ZMZA 4C3JJ 2FX0A 1Z7LA 2BVMA 2R93J 4F93B 1E2XA 3FMRA 1X58A 4HG2A 2G9WA 3JRGA 2V26A 1YG2A 2E2HJ 4L0YB 3KYLA 1HDPA 4A0XA 2HNHA 1ERDA 2A6HF 3HC7A 1Z9CA 1T08B 2JK3A 3PQKA 3A01A 5DUKA 3P9IA 4LLNA 1OCPA 2BZTA 1MSFC 2FE3A 1R1TA 2CQ7A 5B5EC 1LJ9A 2JSPA 3H1CA 4KIBA 1KYZA 1RR8C 2BHZA 1GUUA 2ID6A 2WB1N 2LOOA 1E3OC 1WJFA 2IW5A 2GBYA 3J7ZI 4MO7A 3HGYA 1JE8A 1K78A 2FQ4A 2X0LA 1HW2A 3M4OJ 1ZR2A 3K4MA 1WJ5A 3IH4A 2FF4A 4CCLA 2TCTA 2CYYA 2ZFWA 2L54A 3QP5A 2CSOA 2VKHA 3BZKA 5F1JA 1R7JA 2OCEA 2TDXA 4B8XA 1TWGJ 3HBLA 3R61A 4LK0F 1H9TA 1HKTA 1VQ6I 1PUFA 2F4OB 4PFOA 1TQMA 2CJJA 4M3BA 3R60A 1FP2A 3M8JA 1LUJB 3J80K 4LB5A 2Q2EA 3KP7A 1D8KA 2EZLA 3T5XA 1YIJI 3MKZA 3L2VA 3F8CA 1HXDA 2STWA 2GOXB 1POGA 3ZQIA 4P96A 3GWZA 5L3GA 1O3QA 2KHMA 3HTSB 4EJTA 4G94A 2MYSA 2O0YA 1H0MA 2E1MB 3DTKA 1WI9A 4RM2A 4A5MA 3G71I 3PJRA 5DCMA 1QHHD 1XCBA 4DYQA 1HW1A 3HOVJ 2ZXIA 1VF9A 4MLOA 3I4NJ 2YR2A 1TTYA 2LC2A 2DMQA 1YS7A 2M3AA 1MMAA 5ICEA 2PMHA 3RKWA 4HA8A 4G6DA 2A5WA 4BH9A 1OLTA 2XHKA 2VC1A 5GPAA 3KETA 2ISYA 3PSFA 1YTYA 5DCFA 3SZGA 2HPMA 3LSTA 2V7FA 3Q9SA 4Y15A 2VXDA 2VC0A 2EV5A 1B9NA 1EH7A 2HVQA 5J4VA 2UXXA 2X6YA 2JUGA 3H3ZA 5B1BH 4YFXF 5D5VB 3NQOA 4DBQA 1QQIA 3K4BA 5E79C 3OS2A 2I8DA 3CQZJ 2LF8A 2LKSA 2DMTA 2QBYB 2IVMA 3BWGA 1WJEA 2AXTC 1Z3YA 3CDLA 1XX5A 2QEXI 1YFHA 5ED4A 3RPUD 4KNYA 3WU0A 1VQ8I 1F4KA 5FKOA 4BJ6C 5CJ9A 3CDHA 2DU9A 2Y31A 2YS9A 1I1SA 3BDDA 4RBOA 1FMVA 3LOCA 4A3BJ 3HRUA 5FRNA 2JVGA 1HW5A 4E6KG 4A3JJ 3MD2A 4RA2A 3JRAA 3ZMTA 2PJRA 3FBIB 3ABTA 5E1XA 3M3YJ 3HOWJ 1TBXA 3I4PA 1PUEE 2XASA 3VYUB 1UFMA 2K9LA 3QAHA 2M7BA 3K0LA 3P7NA 3VYSB 3T8RA 1VQMI 5LBQA 3HSEA 3HRTA 1T6SA 3VPRA 4HLXA 4F7ZA 5L3CA 2GIVA 4A3GJ 4DQ2A 1E3PA 1KU9A 3QWLA 4KMFA 1TNSA 1ETVA 3KFWX 2VOPA 1JKPC 2K3FA 4QSHA 5ICGA 1YJWI 2F48A 1MD0A 1UHSA 1O3SA 4OMYA 1S7AA 1VQNI 2WADA 1QBJA 1BI0A 4L5EA 1RPWA 5CVIA 3IRQA 5D6EA 1CGPA 2DTZA 3LSHA 5IYBJ 3CCSI 2KKOA 2D5VA 2E1OA 2R7ZJ 1OCCH 1DPRA 4LG0B 2R5YA 1E0EA 4U0YA 3G2BA 1STZA 2YU3A 3NAUA 4A3DJ 3V4GA 3WU1B 1VQLI 2W48A 4L9JA 1EJ9A 2VPLA 2CWEA 2FA5A 1SVOA 4W97A 5CVJA 2QSHX 3ABLH 4KA4A 4H0EA 1TLHB 4HW0A 5F08A 2XGCA 1Q1HA 2VJJA 3F3XA 1XMXA 2HOTA 4AIHA 2L7ZA 3L9FA 2MGQA 1BI3A 3SYTA 3HUGB 2O61A 1H9GA 4IQ4A 3F0CA 4HSRA 3SHFA 1P7IA 2V6CA 4EV0A 4EJVA 4IJAA 5LHHA 3MQ0A 1MMGA 1DQUA 4XLFA 3ZQ7A 1DU6A 4E7LA 1ZHFA 2B63J 4IOCF 2Y0SA 5JHFA 3CF5F 1T2KA 1O7LA 1IO2A 3FWEA 4LG3A 4F3QA 3S15J 5JLWA 3ECOA 4EYYQ 1WZ2A 1IN4A 1TT0A 2IEKA 2QSFX 2M5WA 2DLLA 1N77A 4HNVA 2NXNB 2FXAA 5KAIC 5C44J 3MZHA 1OCRH 1NK2P 4I2OA 2IS1A 3OSFA 3P5JA 5J8FA 2KMUA 3K2AA 4ZYAA 1ZELA 3OOUA 3MKYB 1FP1D 4HYEA 1YW8A 2H6BA 4IRGA 1BM9A 2O0QA 4PJNA 2HXIA 3BG6A 1MNDA 3OMYA 2QVOA 1GDTA 1A6IA 2VB6A 3QP6A 1D1BA 1S29A 4DGWB 4C30A 3WE3A 2E1MC 4DIQA 4S04A 4BEHA 3L7WA 1CF7B 3R6SA 5LRRA 4YFNF 3ZN0A 3IKVA 2DK8A 1JHHA 1UG2A 5D8KB 4B3AA 2DMPA 3LSKA 4MEYF 1SVMA 4YG2F 2M34A 3FMSA 5AONA 4KICA 2XAJA 2KPMA 4M73A 4WK8F 2QA4I 3A03A 1Y1WJ 4UV8A 1ZLJA 3M8FA 4HQMA 3BTCA 4OAZA 4XBFA 1NH3A 2W85A 3E5XA 2R7WA 2MD5A 2EZKA 4BJ5C 3JTHA 2E71A 2HW2A 3WG7H 2D2WA 2Z5UA 2IT0A 1P4AA 1T56A 3K4KA 1S6LA 2HKXA 3SQNA 2KLOA 2H8RA 4RB3C 3L2RA 2LY2A 4M6VA 3BR3A 5ILUA 5J1YA 3G4SI 2CW8A 2M9HA 3D0SA 3S32A 1GLNA 4BGDA 3K2ZA 3KP2A 4CYCB 2LNBA 3CTAA 1N25A 3A1YA 2EA4A 3WU2C 4Q5SF 2HDWA 4KIGA 5J47A 3SEZA 1K78B 3OY9A 2VQHA 2O9LA 1IUYA 3PNTA 3GYHX 4BAYA 3J7AO 1YW9A 2PQ8A 4RB1A 4IZZA 3LSPA 2NOJB 1DP7P 4ON0A 5JVGF 4BACA 2NVQJ 2CV1A 3REOA 3H36A 1VQPI 4JOMA 3DBHB 1BR4A 4EEFG 2EV0A 1ZLKA 4I02A 3M7GA 1WPKA 4QPQA 4EM1A 1MBHA 1QZZA 2O3FA 3BG3A 4XRSG 4XKVA 2FOWA 2LP0A 3IWFA 3UR3C 5H2FC 4YIIA 1ZGWA 1S72I 1IW7F 2O8KA 5DD8A 4BHCA 3LA3A 1IC8A 2MFZA 2IGNA 4CSWA 3B6AA 3DCFA 5LFAA 4RAFA 1C0WA 3E5QA 1H88C 1R4MB 2KRFA 2NYXA 1N75A 4MTEA 1VTNC 4XRFA 2V1DA 1VQ9I 3E0JB 3OIPA 3PNYA 5KHDA 2LG4A 3OYFA 4EGZA 1D8JA 5KCMA 3DEEA 1VQOI 4M3DA 1ULYA 1YHQI 2RAEA 2X1EA 2CO5A 2ZXWH 1FT9A 1FIAA 2CQQA 1FYLA 3DP7A 3WHCA 3HYIA 2DODA 3KEQA 5M5YJ 2P5KA 5KNLA 3BG5A 3H35A 2HTJA 3HXLA 2JPCA 4I01A 4M9ZA 4IL6C 4B43A 2X85A 1MNEA 1P4WA 2E35A 2X4HA 4XLNF 3NWSA 5KAFC 1HKSA 3UKGA 2JN6A 3PIPF 4QPOA 2PMZN 3I64A 1X1PA 2ZC2A 3QOEA 1BW5A 1MNMC 4DYRA 4EQQA 5ILSA 1KONA 3DEWA 3M1EA 1MMSA 1FC3A 3OYAA 5F64A 2QUFA 3SDBA 2QENA 1YO5C 2E5NA 1FYKA 3WGHA 3BQZA 3I58A 3U1DA 5J6XA 1W36D 1W7PA 2OA4A 4G7ZF 1DP3A 2D45A 3L2WA 1MBEA 1RIOH 4DW6A 1WQ2A 3PSIA 3DKXA 1WFXA 3HRMA 1LVKA 1R23A 2F4IA 1E17A 3KCCA 2R3SA 1RI7A 3OYNA 1HF0A 1MJ9A 3N97A 3ZRGA 5K5RA 3LNQA 2LY1A 1A35A 4YEJA 1UELB 5LGTA 1HOMA 4P55A 4WWCA 4O6JA 3O3KA 1XGOA 2O8XA 4CGZA 4I76A 2Z33A 4NHJA 3RSNA 3H92A 2JA7J 4CZCA 4XN3A 4DOZA 2FD5A 5L3BA 1Y6IA 2LREA 4BQQA 3WTWC 3SFIA 2VQGA 3RDIA
chains in the Genus database with same CATH topology
3K4LA 1JI8A 2LBFB 2V26A 3DWLE 2VLAA 3QYBA 3KYLA 3LMMA 2HNHA 4XM3A 3HC7A 1ERDA 3RTRA 3VDXA 4XKCA 4FETA 3BLYA 3SEQA 1MMNA 2IS4A 2M7AA 2Z16A 2IS6A 4XR6A 1V5EA 4E7ZA 2JSPA 4PK4A 2R7VA 2LOOA 3BCAA 1WJFA 3RQ4A 4ZTJA 4E7IA 2VQCA 2UV1A 4XN0A 3J7AY 2W4SA 4BDYA 2LH9A 3EUHC 3K4MA 1WJ5A 1VZ0A 2BW3B 1G8XA 4CCOA 4CCLA 4E7SA 3H5NA 4RM3A 4CCMA 2VKHA 3HPGA 3I9V2 2OUMA 3L2QA 2IGKA 3PUBA 3OR1C 4PFOA 2KQRA 4N4OB 4Y4RA 2DT6A 3M8JA 2R7UA 3MKZA 1D0YA 3L2VA 2E60A 2GOXB 3C2HA 3ZXSA 4B44A 3D5SC 3DPTA 2V6EA 3V42A 3EPZA 2Q1ZB 2KHMA 4ITVA 2W00A 2MYSA 4BE0A 2E1MB 1J09A 3DTKA 4RM2A 3IAM2 4B3XA 3PFYA 1S9HA 3PJRA 2WB1A 1QHHD 3TMOA 4D9JA 3AL0B 2ZXIA 4MLOA 3LSGA 2LC2A 3UNGC 2ZXHA 2M3AA 1MMAA 4XLCA 3CJQB 2HU9A 1SAUA 4ZTFA 2A5WA 2K9MA 4PFPA 1OLTA 2BOLA 2WA0A 3DTIA 3PSFA 3AFHA 3CZ6A 3VYRB 3SZGA 5FRMA 2HPMA 2V7FA 3HL2A 2VXDA 1P9QC 2HVQA 3OYMA 4E7KA 2XDVA 2X6YA 2JUGA 1DGRM 3DLAA 3K4CA 2QKMB 4DBQA 3K4BA 3OS2A 3ZGKA 1BOBA 3QYEA 2I8DA 2M4KA 4PUSA 2CV0A 2ZSHB 4KT6A 3IP4B 3CJRB 4OWRB 2R7XA 1WJEA 5HNHA 1Z3YA 3DTEA 2R7RA 4C2UA 3RPUD 2AQFA 1YX3A 2HPIA 1K6YA 3BCBA 4BJ6C 3W2VA 3K70C 2XF6A 4II2A 1G59A 1FMVA 5FRNA 2JVGA 4HSTA 4E6KG 3MD2A 2QKLB 2VL8A 2PJRA 4CCKA 3FBIB 3U21A 2KP6A 3VYTB 2Z1DA 4F52A 4KJZA 2XSJC 3EUKL 4DBRA 3VYUB 4B48A 4G6TB 1YE9A 2K9LA 4IX7A 3K70D 2M7BA 4BJTA 3VYSB 4PJMA 3H9GA 2CMPA 3DKYA 4P1WA 4IQJA 2OV7A 2IGOA 2WAEA 4U7BA 2CUJA 2V9KA 4ZDOA 2F5VA 3S8PA 2JVHA 2VIXA 2IGMA 1UG0A 1LFPA 2VXZA 2L7KA 2WADA 5CQGA 4ZJZA 2WAFA 3HPHA 3L2UA 1X1CA 3A4CA 4E7JA 3HKZA 3OL3A 3D5LA 3LSHA 4KISA 1X4OA 2KZVA 3BC8A 4BE1A 4BQOA 2UUZA 3ZR8X 4NC7A 4RLQA 4AYBA 1OR7C 4XORA 4NC8A 5HOOA 1E0EA 3G2BA 2HQAA 4HEA2 2WAQA 2KDOA 1LKXA 4F92B 2VPLA 3DPUA 4E4HA 3I3LA 3W2WA 1V5GA 2K3PA 4BU2A 1WJBA 2Q2EB 1R6RA 1D0XA 1TZLA 4J00A 2VJJA 1X1DA 1PYVA 3QYFA 2ZSIB 2JQNA 4ZC3A 2X1CA 2DT7B 1NG6A 4XLHA 2KRCA 3ZCOA 3SYTA 3HUGB 3H9QA 3S3MA 2CFOA 4IQ4A 4HSRA 4YELA 4ANJA 3CESA 3VWBA 3BG7A 3FKJA 2DJIA 4HNTA 1MMGA 2KRHA 1DQUA 5HVQC 4XLFA 3OS0A 3AKZA 4E7LA 2XC7A 2R7OA 2Y0SA 5JHFA 3MKWB 4F3QA 4LG3A 5FROA 4EYYQ 2L5QA 2DXIA 1TT0A 2DCEA 1N78A 2VJIA 3OYDA 3KEYA 1UAAA 1N77A 4PJLA 2KL4A 2A6TA 2IS1A 2X1DA 2R7QA 2LYCA 2ELJA 2KMUA 4ZYAA 1ZELA 3PNVA 3OOUA 3MKYB 2RQQA 4F91B 4PJJA 2W7NA 2O0QA 4PJNA 3BG6A 3OS1A 1MNDA 3OMYA 2IS2A 2VASA 3VSLA 1Z3XA 2VB6A 4ZDLA 1D1BA 3OWTA 1V5FA 2WBMA 3HG9A 4RLFA 4XNFA 4PSXA 1U0JA 4DGWB 4C30A 4H4KC 4F55A 3OYIA 2E1MC 2MABA 4DIQA 4BEHA 3CF2A 2CS3A 2O5RA 2X6WA 2M4GA 4OAYA 3TL4X 3OYLA 2HVRA 4C9YA 5LD2C 2VKDA 1T0FC 2FUG2 4XL9A 3AL0C 2L9SA 3IUOA 3LSKA 4YRVA 3N05A 2X51A 4NNJA 4X0GA 2PJRB 4HRIA 4J01A 2KPMA 3C2GA 2WY7Q 4BQNA 2RNGA 3ONQA 1WJAA 4OAZA 2CW7A 3HOTA 1IRXA 2R7WA 4GRIA 4BJ5C 4AVZA 2OC6A 2HW2A 3H9JA 1SFKA 5HNFA 3K4KA 2F6CA 2LBFA 3OYGA 2KLOA 1D0ZA 3L2RA 2LY2A 3CP8A 1QHGA 3OL4A 4B47A 2CW8A 3S32A 1GLNA 3K6GA 2R4GA 4XQFA 1MMDA 4BGDA 1AA7A 3LSIA 4D1QA 4LIVA 4P5OA 3A1YA 1EA3A 1X4PA 3DPLC 2HDWA 4XLEA 3SEZA 4DJAA 3OYBA 3OY9A 2VQHA 2XAUA 1YX5A 4BL0B 3PNTA 2LRDA 3RCOA 5TGTA 4BUPA 2GOMA 3FBNB 1X19A 4IZZA 2BW3A 1Y56A 2NOJB 3K10A 4XLAA 4XMYA 4R79A 4BACA 2CV1A 2X6XA 2L2OA 1Z21A 3MMYB 3H0DA 4JOMA 1BR4A 3HOSA 4RMNA 3S3NA 4CCNA 4LIUA 4QPQA 2R7TA 3NWTA 2HVSA 1DGWY 2IXSA 2Z2SB 1PJRA 1X1AA 4XKVA 1HA8A 2VQLA 3UR3C 2HZDA 4BE2A 2MFZA 2VJ4A 2IGNA 4BXFA 4CSWA 5LFAA 3A2KA 3KX2A 3LL7A 1T95A 4C2TA 1QU3A 1N75A 2XF7A 4FASD 1WJCA 3E0JB 3K4NA 3OIPA 2LG4A 3PNYA 5KHDA 3OYFA 5KCMA 2CH0A 3DEEA 2V4JC 4CUGA 1D1AA 2X1EA 2WY8Q 3TBIA 1FMWA 4XKWA 2E5ZA 3W3CA 3IAS2 4KITB 4JQFA 3S93A 4XONA 2M0MA 4EATA 3CP2A 5KNLA 3QODA 4BS9A 2JA2A 4XOTA 2UWMA 3H35A 3E1SA 3HXLA 4B43A 2X85A 1W36C 4CH7A 1MNEA 4BDZA 1BR1A 3NWSA 2XF5A 4IKFA 2K5CA 3VSKA 4QPOA 4HPQA 1LDKB 3K4JA 3QOEA 3H5RA 3DU6A 2V1NA 1KONA 4N4NB 1BR2A 3OIQA 3CMMA 2W1OA 3D5RC 2AQEA 4NUBA 4PSWA 3OYAA 4E7HA 4U87A 3SDBA 2BVLA 1WJDA 4ZDPA 2E5NA 4CCJA 3ZQQA 2CV2A 2R7SA 1NG7A 4CA0A 1W36D 2L9NA 3OYEA 2P0WA 3F9KA 3OYCA 2DOAA 1DP3A 4HNUA 3L2WA 5HLTA 3PSIA 4AU7A 3H5AA 3GBGA 3DKXA 1WFXA 3DQVC 4BEHB 1LVKA 3M1CA 3FHNA 5CQEA 2F4IA 4Y33A 3OYNA 3ZRGA 2VJ5A 4LITA 1D1CA 2MC4A 3OYKA 2LY1A 1X1BA 4YEJA 1UELB 2MD0A 3W2AA 3OYJA 3S3OA 1MW7A 4NQWB 5CKTA 2RREA 3DU5A 3OYHA 3LFUA 4II3A 3EUAA 4XKBA 2ZFUA 3PL8A 4Y3OA 3RSNA 3FDYA 4CZCA 3LSMA 2W82A 5CPRB 3OR2C 4XN3A 4DOZA 2PMZA 2CUZA 1Z7LA 2BVMA 4F93B 1Y6IA 2LREA 4XOPA 4BQQA 2O0PA 4HG2A 2VQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFX A; 
#chains in the Genus database with same CATH topology
 2F5D A;  2LBF B;  1IG7 A;  5M5X J;  1BJZ A;  2BXY A;  3LMM A;  3FXR A;  2OTL I;  3RTR A;  2IRF G;  4XKC A;  1Z7U A;  5CVV A;  5B3S H;  1U5T B;  5E3L A;  3JCU C;  1BBY A;  5KVR A;  3WG9 A;  2IS4 A;  1ZKG A;  2K27 A;  1U3E M;  4EJO A;  3ZQC A;  3E6D A;  5F6F A;  4MGR A;  3JRB A;  5E20 A;  4Y17 A;  1IRF A;  4A69 C;  5JHU A;  3F8B A;  2R7V A;  3B6C A;  3BCA A;  1MH3 A;  2VQC A;  1B72 B;  2DQR A;  3JTG A;  3MKL A;  3A0B C;  3RI4 A;  4XN0 A;  2P7V B;  4BDY A;  3J7A Y;  5L3D A;  4A3E J;  1YQA A;  2P5L C;  3FXL A;  2Y9Z A;  1W0T A;  3OIO A;  1OKR A;  2OF7 A;  4OIO F;  4CCO A;  4LG0 A;  3H5N A;  2EFO A;  4G6Q A;  1AKH B;  4LGW A;  5F0H A;  1FJL A;  3HJE A;  1PP8 F;  1OMI A;  5E17 F;  3PUB A;  1SAX A;  3NEU A;  3OR1 C;  2O6G E;  1R1V A;  2KQR A;  2Y48 A;  4OIN F;  2ISZ A;  2KJB A;  1HCR A;  4Y4R A;  5L3E A;  3WTU C;  2ME0 A;  3O8G A;  4Z2Y A;  2XPV A;  1F5T A;  1D0Y A;  2E60 A;  3R0A A;  3MFK A;  3C2H A;  3QU3 A;  1LVA A;  1XGS A;  3D5S C;  2P6T A;  3EPZ A;  2L01 A;  2M87 A;  3HUG A;  4HZF A;  1JHF A;  1FOW A;  4XSZ F;  1J2X A;  4B3X A;  2KZG A;  3BPX A;  3ERE D;  3JRH A;  1BL0 A;  3SDG A;  1XD7 A;  2CQK A;  5M5W J;  1BC8 C;  3AL0 B;  3H3U A;  4CIC A;  3E3V A;  3HOZ J;  3UNG C;  3RJP A;  3BJ6 A;  4IRI A;  2A69 F;  2K4J A;  2HU9 A;  2K9M A;  3IH2 A;  4C3H J;  1GHC A;  3B02 A;  1YW7 A;  2DA2 A;  1KYW A;  2KFD A;  1F1Z A;  2O03 A;  5B1A H;  2E7W A;  3CZ6 A;  4UB6 C;  3VYR B;  4RB2 C;  1MJA A;  3TKY A;  2BHY A;  1Y39 A;  1P9Q C;  3OYM A;  2DFH A;  2XDV A;  3TED A;  1DGR M;  2F2E A;  4WX9 A;  2OZ6 A;  3TDU C;  3RYP A;  2AHQ A;  3QYE A;  2M4K A;  3K9T A;  3MEX A;  4LOC A;  4PUS A;  2ZCW A;  1XMK A;  2CV0 A;  2XV4 S;  2JJ7 A;  3IP4 B;  3CJR B;  3AG4 H;  3CUQ B;  4OWR B;  5K5Q A;  5HNH A;  2E2J J;  2KIQ A;  1HKQ A;  5FD5 A;  4XSX F;  1ZN2 A;  3G3Z A;  1CF7 A;  1BIB A;  2QQB A;  2KIU A;  2AQF A;  3F8F A;  1K6Y A;  3W2V A;  3K70 C;  2QZ8 A;  1QA6 A;  1XSX A;  2BXZ A;  3GVA A;  3LA2 A;  2Y75 A;  4WXH A;  4M6Y A;  2QSG X;  5LGN A;  1OCZ H;  2HGC A;  3U21 A;  1HST A;  4ESJ A;  2Z1D A;  2J5P A;  1K7A A;  1IDY A;  1P7J A;  4GO1 A;  1FBU A;  2DA1 A;  4G6T B;  2WAQ N;  2EH3 A;  3GTK J;  3AG1 H;  2X48 A;  3L1P A;  2VBX A;  5E18 F;  1YS6 A;  2BY0 A;  3DKY A;  2HYG D;  4P1W A;  1JT0 A;  4UNO A;  4IHX A;  2KDZ A;  2OV7 A;  3I55 I;  2CQX A;  2IGO A;  1LNW A;  2V9K A;  4ZDO A;  3ISP A;  2AO9 A;  3SJM A;  4A93 J;  2DTR A;  3S8P A;  2JVH A;  2R92 J;  4EM2 A;  3RKQ A;  2VXZ A;  1Z1D A;  2L7K A;  5D4R A;  4CYC A;  1D5V A;  2B0L A;  2QQA A;  3L2U A;  2CW0 F;  3FX3 A;  3TP3 A;  2KT0 A;  1JGS A;  1YLF A;  2O7O A;  3OL3 A;  1ZAO A;  3WOD F;  3GTM J;  1ZR4 A;  4BKX A;  2P5V A;  2DDA A;  4UB8 C;  4BE1 A;  2HFH A;  3L2C A;  2LK2 A;  3CD6 I;  2XB0 X;  2M2E A;  4AYB A;  1RUO A;  3EET A;  1WWX A;  2X6O A;  4G7H F;  4RS8 A;  4LJZ F;  1SD5 A;  1WVR A;  2LF7 A;  2XB5 A;  3CO6 C;  2DI3 A;  5E1Z B;  3COA C;  1LKX A;  1R36 A;  4IHT A;  2MA3 A;  5L3F A;  1MBG A;  2H8W A;  3X2Q H;  2JQ7 A;  1EV7 A;  3LWF A;  1V5G A;  2K3P A;  2DA5 A;  1WJB A;  4RGS A;  1OYW A;  1RET A;  4A12 A;  1TZL A;  3S2D J;  4J00 A;  1U5T C;  1PYV A;  2NVU B;  1LFB A;  2HS5 A;  3I53 A;  3K1N A;  1HDD C;  2GWR A;  2X1C A;  4GYI A;  4LMY A;  2ZJQ F;  3KP6 A;  2FBI A;  2KRC A;  3ZCO A;  5DM6 F;  3DLL F;  1R5H A;  3F6V A;  3KZZ A;  2CFO A;  1U8B A;  4A2U A;  4YEL A;  2KJC A;  3CES A;  2DT5 A;  2DJI A;  2P4W A;  4FX0 A;  3TO7 A;  1BI1 A;  4UY8 I;  4ZYD A;  1IN7 A;  1AWC A;  3KP3 A;  4M72 A;  2A07 F;  4JYK A;  3MKW B;  4Q4Z F;  4YFK F;  2OJE D;  1LEA A;  1OYY A;  4M9S A;  2ZJ2 A;  3MVP A;  3F8M A;  2L5Q A;  2DXI A;  5H6Q A;  2HTS A;  5F1R A;  4PJL A;  2KL4 A;  2VT2 A;  4V2F A;  3IL2 A;  4PGG A;  1IV8 A;  4NC6 A;  1HBX G;  2EFP A;  2ADU A;  5GAH J;  2LDU A;  2R7Q A;  2ZB9 A;  1T38 A;  1KU7 A;  4ETS A;  2LKX A;  1WH7 A;  2AXL A;  3GEZ A;  1W7P B;  3GO5 A;  3GZN B;  4PJJ A;  4FTH A;  4S0H B;  4WCG A;  4DYC A;  3GW2 A;  3GX4 X;  5F27 A;  4CO8 A;  2W7N A;  1ZGA A;  2IS2 A;  1Z3X A;  3G1M A;  4RDU A;  2L02 A;  4Y13 A;  1HSJ A;  2HYJ A;  2L4M A;  2PX9 A;  3HG9 A;  3OWT A;  4FT8 A;  2CUF A;  3ABM H;  4H4K C;  1REP C;  4AID A;  2BY3 A;  3OYI A;  1J5Y A;  2ID3 A;  2O5R A;  3GFL A;  1YJN I;  2XRO A;  2X6W A;  2M4G A;  4OAY A;  3RYR A;  3OYL A;  1KU3 A;  1FOK A;  2I10 A;  2ZXJ A;  4L9V A;  5HS9 A;  5LD2 C;  3HHH A;  5AIQ A;  4ESF A;  2FUG 2;  4EMS A;  5K7F A;  3AL0 C;  1U6G A;  2L9S A;  3A0H C;  4YRV A;  4UVC A;  2M1B A;  1VQK I;  2VBZ A;  4NNJ A;  4X0G A;  5FFZ A;  2M0C A;  3CJT B;  3BOQ A;  3HOX J;  4BQN A;  1IAW A;  2F5C A;  2HQN A;  4L9T A;  2XUB A;  4YIR X;  2XSD C;  1WJA A;  3WTX C;  4CZZ A;  2PEX A;  4ESB A;  2K4B A;  1A04 A;  4GRI A;  4AVZ A;  5EG0 B;  1O7F A;  2OC6 A;  2Q0O A;  2Z3Y A;  5DEQ A;  5IP9 J;  4E70 A;  3EQL F;  2E36 A;  2LBF A;  3OYG A;  2YU9 J;  1EH6 A;  3CP8 A;  2UXN A;  2JA6 J;  3BG9 A;  3ZQF A;  1I39 A;  4ZYG A;  1U5T A;  3K6G A;  1B8I B;  2R4G A;  4XQF A;  1MMD A;  1XG1 A;  3W6V A;  1OJL A;  3CUQ C;  4RB0 A;  3E7L A;  4I6Z A;  4LIV A;  1EA3 A;  3DPL C;  5FLM J;  2P8T A;  4XLE A;  2DOE A;  2HI3 A;  2HOS A;  1XDU A;  3OYB A;  1BI2 A;  1BJA A;  3TW6 A;  2NVT J;  3T8T A;  1YX5 A;  3F21 A;  1B72 A;  4MHG A;  1YYV A;  4DZJ A;  1ORK A;  2LRD A;  2NNN A;  3RCO A;  4A3I J;  1R1U A;  3V8K A;  5E8G A;  3FBN B;  1ZK8 A;  3G1L A;  1Y56 A;  4M3F A;  2KIM A;  4XLA A;  2V1X A;  4XMY A;  4R79 A;  2L2O A;  1B4A A;  1Z21 A;  3GTJ J;  3H0D A;  2JA8 J;  1AKH A;  3GZ6 A;  3ESW B;  1WKM A;  2R7T A;  4ZZD A;  5EZG A;  2HVS A;  2Z2S B;  2ZNZ A;  1X1A A;  5J40 A;  1HA8 A;  2VQL A;  1VI0 A;  3CCQ I;  1ENH A;  3BRO A;  4O3M A;  4BE2 A;  5DTD A;  3HHG A;  1A31 A;  4I7H A;  3GZ5 A;  2Q8K A;  2MH9 A;  1KQ9 A;  4BXF A;  3FXU A;  3GCM A;  3KX2 A;  3GFI A;  5JVT A;  4C2T A;  1QZE A;  2XF7 A;  3ZMD A;  2VBW A;  2MLK A;  4A3M J;  1WJC A;  4HF1 A;  2DPU A;  5BQT A;  3FK6 A;  1KGS A;  2GA2 A;  2CH0 A;  2LMD A;  2V4J C;  4G12 A;  4CUG A;  1D1A A;  3TBI A;  3U9G A;  4XKW A;  5FKL A;  4AC0 A;  2P6S A;  1MKM A;  2BYV E;  4KIT B;  2GAU A;  2V9P A;  3BR0 A;  1IXC A;  4XOT A;  1GV2 A;  1CQT A;  1H89 C;  3CO7 C;  3E1S A;  4BY1 J;  2QGU A;  3ZQH A;  5BPI A;  3KYD B;  1ZAR A;  1QO0 D;  3DKW A;  3ZOB A;  3CCY A;  2JSC A;  1QPM A;  4CH7 A;  2GXA A;  3IWZ A;  4BDZ A;  1R5G A;  1BR1 A;  4XRS A;  2FBK A;  3OV8 A;  4IKF A;  2H1K A;  1ZTR A;  2K5C A;  4AIJ A;  3K1P A;  5IOY A;  1XSD A;  4FE4 A;  5E3M A;  1ON2 A;  2V1N A;  4U7D A;  2MSY A;  5FLV A;  3ABU A;  3C3W A;  2DYS H;  4N4N B;  3OIQ A;  4CHU A;  3V8L A;  3I71 A;  2IJL A;  3DBR B;  3FF5 A;  2L9N A;  4JX5 A;  3HSR A;  2P0W A;  3OYC A;  4HNU A;  2A6E F;  4A3L J;  3CUQ A;  2GQQ A;  3ASO H;  3P9K A;  5FFX A;  3B73 A;  2MH2 A;  4UUT A;  2K9N A;  3BR5 A;  4HOB A;  4NB5 A;  5HLT A;  5IP7 J;  3ASN H;  3H5A A;  3GBG A;  1SAN A;  1FWZ A;  3FHN A;  5CQE A;  1G3Y A;  3KLO A;  2HDD A;  3CC2 I;  3RIR A;  2VJ5 A;  1D1C A;  2MC4 A;  3RZD J;  2RQP A;  2MD0 A;  3HM5 A;  1ETX A;  3OYJ A;  3KE2 A;  5K1Y A;  2D1V A;  1LB2 A;  3MAJ A;  1UHM A;  2YPR A;  3OYH A;  2HOA A;  3EUH A;  4II3 A;  3EUA A;  4XLP F;  3PL8 A;  1RUN A;  4EM0 B;  1ZRC A;  4HLY A;  2HR3 A;  2G7H A;  4MEX F;  3LSM A;  3OR2 C;  3V8J A;  5E8I A;  3AG3 H;  1ETY A;  2O0P A;  3TDZ C;  1M1E B;  2G7U A;  3DWL E;  2GZW A;  2EFQ A;  3QYB A;  3HIF A;  1S7O A;  1J7K A;  2VON A;  4Y52 J;  3VDX A;  1IRZ A;  4JBA A;  4FET A;  3BLY A;  1U9O A;  1USS A;  1MMN A;  1UB9 A;  4QWQ A;  4FX4 A;  3ZP5 A;  1I27 A;  2A3S A;  1W5S A;  3CME I;  4G9Y A;  4XR6 A;  4E7Z A;  4IHV A;  4IHY A;  1U2W A;  2LLK A;  2QM3 A;  3Q0U A;  1Y0U A;  2COB A;  4PK4 A;  2EIN H;  1JT6 A;  2CRG A;  2EB7 A;  4ZTJ A;  4IHW A;  3S16 J;  4E7I A;  2AUA A;  1MJB A;  2UV1 A;  3C1D A;  2BY2 A;  4OIQ F;  2JTV A;  3VB2 A;  3CCJ I;  2W4S A;  1YIO A;  2RDP A;  4ZH4 F;  4AD9 A;  2NNY A;  1UZC A;  4X6A J;  2BW3 B;  4A3K J;  1A5J A;  1G8X A;  4E7S A;  5A2Q Z;  3WTY C;  5E3O A;  3LQR A;  3HPG A;  2H6C A;  3L2Q A;  1FY7 A;  3IHU A;  3BZ6 A;  1MBJ A;  1RZ4 A;  1RKW A;  1G6N A;  5DD4 A;  4TV7 A;  4UXN A;  4A0Y A;  2DT6 A;  5ERI A;  3J81 K;  1EH8 A;  3E6C C;  2R7U A;  3RPU A;  2ICW G;  3JW4 A;  2FMY A;  3ZXS A;  1ONV A;  1EKE A;  1IN5 A;  2XPU A;  3V42 A;  2Q1Z B;  2EFN A;  2EPF A;  2W00 A;  4BE0 A;  2ELK A;  4UHT A;  1J09 A;  4BQA A;  2VKV A;  1KQ8 A;  1T33 A;  3PFY A;  1S9H A;  3BY6 A;  3BR6 A;  2WB1 A;  2JUC A;  2DO7 A;  2QLZ A;  3TMO A;  4D5F A;  2PLY A;  4ENJ A;  4EJU A;  1IV6 A;  2QQ9 A;  5JLX A;  2HQR A;  3LSG A;  2CUE A;  4RAG A;  1SFE A;  4A3F J;  4C2M J;  2DFE A;  4XLC A;  2H1L A;  4ZZL A;  4IPA A;  1SAU A;  4PFP A;  3LA7 A;  4HQE A;  2WA0 A;  4RGU A;  1OIS A;  1FLI A;  1FNN A;  3AFH A;  1W5T A;  4UUV A;  2EJR A;  3HL2 A;  2D1H A;  1Q1V A;  3M8E A;  3QPH A;  4PJ0 C;  5LHI A;  1J9I A;  2PJP A;  4E7K A;  5DV5 A;  2P81 A;  3DLA A;  1ON1 A;  2W25 A;  2NVX J;  3JAM K;  4GDF A;  4WXC A;  1Z0X A;  2LD5 A;  2ZSH B;  4KT6 A;  3GTP J;  1S5L C;  3LSR A;  4NDL A;  2P7C B;  2OBP A;  3KYC B;  2H09 A;  2VT3 A;  4C2U A;  3Q9V A;  5GAG J;  1ODD A;  3QOP A;  4MQ9 F;  2DJN A;  1YX3 A;  2HPI A;  3BCB A;  3TQN A;  1LE8 B;  4II2 A;  3N4M A;  2CGP A;  1X3Z B;  2EIJ H;  2GA1 A;  3HB9 A;  3SZT A;  5BPD A;  1PDN C;  1SMY F;  3QRF F;  2QKL B;  1UJ8 A;  3ML6 A;  1X3W B;  3M07 A;  1YOV B;  3VYT B;  1B1B A;  3U2R A;  4F52 A;  5FKN A;  2K86 A;  3EUK L;  2FNA A;  4DBR A;  1TW3 A;  4L9N A;  3W6K B;  4MIM A;  5EG0 A;  3K70 D;  4KIF A;  4A5N A;  1FSE A;  1GXQ A;  2CMP A;  4P9F A;  3FK7 A;  2A5Y B;  1XPX A;  1E3H A;  3CUO A;  2JRM A;  3KPH A;  4HAM A;  2CUJ A;  5IPA A;  3RZO J;  2FML A;  5HDG A;  4D7M A;  1B8I A;  3FXJ A;  1I5Z A;  1Z05 A;  3HZJ A;  5CQG A;  2ZO4 A;  3CMY A;  1R22 A;  3HPH A;  5J3L A;  4FHT A;  1X1C A;  1HC8 A;  1B9M A;  3A4C A;  4ZYE A;  3LFK A;  3D5L A;  1BW6 A;  4G8X A;  1VFC A;  2E1N A;  4I99 C;  1SD6 A;  4PCQ A;  2KZV A;  2EIM H;  3O2P E;  3I59 B;  2RGV A;  2EFW A;  1BC7 C;  2UUZ A;  1XTA A;  3HSF A;  4MFE A;  5TIS C;  3ZR8 X;  1V55 H;  2Y0S N;  1FOX A;  3PUF A;  3FMQ A;  4CDG A;  1XSV A;  3QPT A;  2Y30 A;  2XIG A;  3A02 A;  5ICC A;  3E97 A;  3JRD A;  3BT9 A;  5LEK A;  3JRF A;  2HQA A;  4HEA 2;  2GM4 A;  3Q0V A;  4F92 B;  2Y9Y A;  2WWY A;  3K69 A;  1S8N A;  2EQR A;  3H3V K;  1HQC A;  3I3L A;  2E19 A;  4BU2 A;  2NRA C;  3R0J A;  2CG4 A;  1R6R A;  1D0X A;  5CVR A;  4UVB A;  4ENM A;  1ZRF A;  2HWV A;  2A05 A;  2EA2 A;  3FM5 A;  3GME A;  3K1M A;  1MBK A;  1X1D A;  3DFG A;  4XID A;  2JQN A;  2OZU A;  4ZC3 A;  1JJ6 C;  4N0B A;  5IT3 A;  2DT7 B;  1OYI A;  1QGP A;  4N9I A;  3H9Q A;  3S3M A;  2FEZ A;  3KZI C;  2MBF A;  4LLG F;  3JRC A;  1ZG5 A;  4ANJ A;  3JSP A;  3VWB A;  4FCY A;  3FKJ A;  4A6E A;  2NVY J;  4BBS J;  4ABZ A;  5HVQ C;  3AKZ A;  3OS0 A;  1K4T A;  4HF0 A;  4V2G A;  2M8G X;  2XC7 A;  2R7O A;  1W1W E;  1WHU A;  3CCM I;  1FIP A;  4XIC A;  2QF7 A;  5FLX K;  2DCE A;  1N78 A;  3S1Q J;  1FX7 A;  2VJI A;  3KEY A;  1SMT A;  3K7A J;  3NAR A;  3PFI A;  2A6T A;  3VFZ A;  3S14 J;  2JZY A;  5FJ8 J;  5BMZ A;  4K2E A;  2A61 A;  2X1D A;  2ZJR F;  2LYC A;  2MG4 A;  3PM1 A;  2ELJ A;  4MTD A;  2E7X A;  2QCO A;  4IRH A;  3PNV A;  1JKQ C;  2CU7 A;  4A6D A;  5EF6 A;  2K85 A;  1WCM J;  2DA6 A;  2JWT A;  4F91 B;  1K79 A;  3I54 A;  1BN5 A;  4I0B A;  3ZN1 A;  2MC3 A;  3WGI A;  3OS1 A;  2K9Q A;  3BTL A;  4HF2 A;  4ZDL A;  5IT9 K;  4ENN A;  5K7H A;  1L0O C;  2WBM A;  4RLF A;  3E5U A;  4F55 A;  2VI6 A;  3RQI A;  5M3F J;  1U9N A;  4IXA A;  1O3T A;  3TL4 X;  4HV5 A;  2UZK A;  2VOO A;  3BZC A;  2MW8 A;  3W6J B;  2VKD A;  4HV6 A;  1XC5 A;  2LKP A;  1WSU A;  3IUO A;  3CCE I;  3N05 A;  1SEU A;  3MZ8 A;  3DXJ F;  3IC7 A;  1K6O A;  2WTE A;  2CFX A;  3C2G A;  3O8H A;  5HDN A;  2I5U A;  5CYV A;  1LEB A;  1Z91 A;  2DFF A;  1IN8 A;  2RNG A;  1W5C C;  3ONQ A;  3BP8 A;  2BEO A;  1WRJ A;  1ZG3 A;  2EZI A;  1S3J A;  3QQA A;  3I56 I;  3HOT A;  5HLI A;  1IRX A;  1H8A C;  1OFC X;  1NTC A;  3S1R J;  1OQY A;  2W24 A;  5HOD A;  3RPQ A;  4HDV A;  1I3A A;  1J59 A;  1IXS B;  1SFK A;  4KFC A;  3KEO A;  2F6C A;  1TNT A;  5A2Q K;  1T98 A;  2XPW A;  1D0Z A;  5CLS A;  3WTZ A;  1DDN A;  3Q3S A;  1JUM A;  2DFI A;  4FE7 A;  3F23 A;  1YI2 I;  3KP4 A;  1JTY A;  3RKY A;  2VN2 A;  1GXP A;  5TRD A;  2FU4 A;  1AA7 A;  3LSI A;  2STT A;  4D1Q A;  3SXY A;  1JJ8 C;  4M6X A;  4P5O A;  3FZV A;  3ELK A;  2H94 A;  4Y7N J;  2XAU A;  4OIR F;  1JUP A;  4BL0 B;  3R4K A;  4OOI A;  2ZJP F;  1K61 A;  1APL C;  5E1W A;  5F0F A;  1UCR A;  4A3C J;  2H27 A;  4BUP A;  1FZP B;  2AS5 F;  2ZME B;  2GOM A;  1X19 A;  5EZH A;  3TO6 A;  2L0K A;  1VQ4 I;  2BW3 A;  1ZRE A;  3K10 A;  2X6X A;  4V19 K;  2V1U A;  1RES A;  4KDP A;  2ECC A;  3HOS A;  3S3N A;  2EBI A;  2PN6 A;  1QVU A;  4LIU A;  4CCN A;  5GPC A;  4PGH A;  3IRR A;  1I6X A;  1DGW Y;  2OAZ A;  2PG4 A;  2YX4 A;  3CDI A;  5J1U A;  4N9H A;  2JMW A;  3DEU A;  3SZP A;  2EWN A;  1TWF J;  2E34 A;  4AIK A;  3G1O A;  3P9C A;  1K83 J;  1X2M A;  2DW4 A;  5JI6 A;  4A0Z A;  1QU3 A;  2RV8 A;  4IEJ A;  5IYC J;  2J5O A;  5FGM A;  4FAS D;  4W1U A;  2DA7 A;  1TQI A;  4IVN A;  3LAP A;  2RNJ A;  1FMW A;  3FXO A;  3CJN A;  5DS9 A;  2E5Z A;  4JX6 A;  3W3C A;  3IAS 2;  1FBQ A;  1MSE C;  1I50 J;  1OCO H;  2XGX A;  2M0M A;  3S2W A;  4EAT A;  1F9N A;  3LAJ A;  3J81 Z;  3CCU I;  4Q48 A;  3CP2 A;  3BPV A;  3ZQL A;  1SFU A;  3GTQ J;  1V4R A;  3CCL I;  2Y2Z A;  2EV6 A;  1TP4 A;  4BYY A;  5D5X B;  1I1G A;  1UST A;  2XF5 A;  1AU7 A;  1VQ5 I;  2R5Z A;  3VSK A;  2FJ1 A;  2C6Y A;  1EF4 A;  3MN2 A;  1IXR C;  1P2F A;  3H5R A;  3S1N J;  2M8E A;  3WTV C;  2RVC A;  3H0G J;  3I5U A;  2LY9 A;  3ABK H;  3CMM A;  2W1O A;  3D5R C;  4GXO A;  2GXB A;  2AQE A;  4NUB A;  2L9R A;  3QU6 A;  2BVL A;  2R7S A;  4CCJ A;  5HS8 A;  2E1C A;  1NG7 A;  4CA0 A;  3HRS A;  4BBR J;  3OYE A;  5LEJ A;  2DOA A;  1JKR C;  2X9D A;  4JX4 A;  4UUS B;  2PMU A;  2G0E A;  1OPC A;  4D5C A;  4AU7 A;  3JSO A;  4AUX A;  1VND A;  4U0V A;  3DQV C;  3CC7 I;  2FQ3 A;  4GFB A;  3M1C A;  4BXX J;  1V3F A;  3FIW A;  4Y33 A;  1LE8 A;  3S2H J;  1QPI A;  1G3W A;  3VOE A;  5LHG A;  1I6H J;  1KU2 A;  5H6R A;  1X1B A;  1SVL A;  2DN0 A;  3W2A A;  3JAM Z;  2BE5 F;  2XRL A;  4B09 A;  5JFR A;  3S3O A;  1O4X A;  1MW7 A;  5DM7 F;  4NQW B;  5CKT A;  4DNC A;  1SD7 A;  2RRE A;  3DU5 A;  4BY7 J;  5EGO B;  3LFU A;  2IPQ X;  3E6M A;  2R7F A;  3TW7 A;  3FDY A;  3M9A A;  1IZ1 A;  2DMN A;  5CPR B;  1S7E A;  2BV6 A;  5E3N A;  5D8L B;  2PMZ A;  2CUZ A;  1G4D A;  4QLC U;  2F5E A;  2VE8 A;  2LSO A;  2XAG A;  4EGY A;  4XOP A;  1ETW A;  2OQG A;  2HOE A;  4D0P A;  3K4L A;  1ZGJ A;  3PIO F;  1JI8 A;  1U78 A;  2VLA A;  4L18 B;  4G7O F;  2VPR A;  4ENK A;  4XM3 A;  2XAH A;  3FXM A;  3CMA I;  4KT5 C;  3SEQ A;  3KIO A;  2KIS A;  2M7A A;  2Z16 A;  2IS6 A;  2IP2 A;  1V5E A;  1LPQ A;  2IA2 A;  3ZMV A;  3DV8 A;  1R58 A;  3VOD A;  2XAF A;  1IGN A;  3C7J A;  2KIF A;  2YSR A;  4GGG A;  4OU0 A;  4B4C A;  1Z77 A;  1W7P D;  2HDC A;  3RQ4 A;  1F43 A;  1SFX A;  3I59 A;  1IN6 A;  1KQ0 A;  1RKT A;  5EEH A;  4IHS A;  5GP9 A;  2EK5 A;  2LH9 A;  3EUH C;  3PQJ A;  1VZ0 A;  5DDG A;  4AM3 A;  1XB4 A;  2F4M B;  3KLN A;  4XRM A;  3IH3 A;  4RM3 A;  1YIT I;  1OCT C;  2ESH A;  4CCM A;  4LK1 F;  2WV1 A;  1AHD P;  3I9V 2;  2OUM A;  2DOF A;  2IGK A;  1P92 A;  4U88 A;  1ACI A;  3ECH A;  2OCC H;  4N4O B;  5FKK A;  5J4Y A;  3BTI A;  5FO5 A;  5CVU A;  3EYY A;  3OOP A;  2K7L A;  1JTX A;  4B44 A;  3DPT A;  2V6E A;  1GVD A;  1Y8R B;  3ZMS A;  4ITV A;  1QZY A;  4GYG A;  2OD5 A;  3G6E I;  2RN7 A;  6PAX A;  4M74 A;  3IAM 2;  4BHP A;  2ZNY A;  1W4M A;  2DBB A;  4RGR A;  4RAZ A;  4D9J A;  2ECB A;  3KZY A;  9ANT A;  3AG2 H;  2ZME C;  1YJ9 I;  1A36 A;  2R7D A;  2HKO A;  5D6F A;  1GT0 C;  3S1M J;  1IJW C;  2ZXH A;  3CJQ B;  1BOA A;  4BHB A;  4ZTF A;  2XGE A;  2BOL A;  3DTI A;  2W84 A;  1XS9 A;  1JUS A;  1MGT A;  4OMZ A;  4LFU A;  1F36 A;  2DQL A;  2RC4 A;  5FRM A;  2WC2 A;  2ZKZ A;  3V7S A;  3F72 A;  1TC3 C;  1HLV A;  1QNT A;  2LR8 A;  4HBL A;  1PVE A;  1MDM B;  2JRT A;  1K4S A;  1YRN B;  3OSG A;  2PI0 A;  3K4C A;  2QKM B;  5EDN A;  4R1H A;  3U1K A;  5IYD J;  1KZH A;  3CC4 I;  1B59 A;  1BOB A;  3ZGK A;  3CCR I;  1DUX C;  2ETH A;  2ACJ A;  2OPT A;  5FLX Z;  2R7X A;  3WGG A;  3DTE A;  5H20 A;  1UMQ A;  2R7R A;  3G73 A;  2R0Q C;  1IRG A;  1LQ1 A;  5LLQ A;  4EVI A;  1ETQ A;  1R00 A;  1RC9 A;  4IOA F;  2COM A;  1R9T J;  1MZB A;  4M9X A;  2XF6 A;  2DAO A;  5EEG A;  1G59 A;  4HST A;  1TWH J;  3GUD A;  1ETK A;  2M45 A;  4AYB N;  1A6Q A;  2VL8 A;  2JT1 A;  2CQN A;  1UHW A;  4CCK A;  2XVC A;  5IP6 A;  2KP6 A;  3ZMU A;  1DPU A;  3FM3 A;  1G3S A;  4KJZ A;  3T0Y A;  1DU0 A;  5IT9 Z;  2XSJ C;  1X3U A;  1ZRD A;  4B48 A;  5J1R A;  1YE9 A;  4IX7 A;  4BJT A;  1WGX A;  1XDS A;  1ZH5 A;  5JR3 A;  4PJM A;  2ZBK A;  3RKX A;  3H9G A;  3VEP A;  4IQJ A;  2NS7 A;  3IV5 A;  2WAE A;  4U7B A;  4KN4 X;  4M3E A;  2YX7 A;  5BS6 A;  2F5V A;  1T8I A;  3A01 B;  1XGN A;  4IO9 F;  2VIX A;  2IGM A;  1UG0 A;  2IAI A;  1LFP A;  4S05 A;  4ZJZ A;  1LDD A;  2IBD A;  2HQ5 A;  4WF2 A;  2ME6 A;  2WAF A;  3Q5F A;  3BJA A;  2TRT A;  4E7J A;  3HKZ A;  2VKE A;  1GVJ A;  1MH4 A;  3DF8 A;  2V9V A;  3GFJ A;  1QVT A;  4KIS A;  1X4O A;  3CLQ A;  3J7Y J;  2XGD A;  4KN7 X;  4C3I J;  3BC8 A;  1J0R A;  4BQO A;  4HDU A;  2ZME A;  4NC7 A;  4RLQ A;  3HOY J;  3GXO A;  3GFM A;  4Q47 A;  2VBY A;  2DPD A;  1OR7 C;  4XOR A;  2DDB A;  5GAE J;  1NHA A;  4NC8 A;  3ZPL A;  5HOO A;  4JP0 A;  2GLO A;  3ULQ B;  3V7R A;  1ETO A;  3GF2 A;  1XCV A;  2DK5 A;  2ESN A;  2WAQ A;  4U0W A;  2KDO A;  5GAD J;  4OIP F;  1O57 A;  4HX8 A;  3JRE A;  2M30 A;  4HX4 A;  2B7E A;  2IA1 A;  1JXS A;  3DPU A;  1PUF B;  3PO2 J;  5IY5 H;  3TOB A;  1TQP A;  3IKT A;  4E4H A;  3W2W A;  5DUI A;  5F04 A;  5J8C A;  1FTZ A;  4QIW N;  2V79 A;  2Q2E B;  2PFB A;  2BGC A;  3DBL B;  2MLG A;  2GXG A;  2NS0 A;  3TOA A;  3HTU A;  4D7N A;  4MNU A;  3QYF A;  2ZSI B;  4WXD A;  2LVS A;  3FIS A;  1LDJ A;  1NG6 A;  4XLH A;  5D4S A;  3MCZ A;  4FQG A;  2K40 A;  5FD6 A;  1Z6T A;  1U8R A;  4I09 A;  5DCM B;  5DYM A;  3BG7 A;  4HNT A;  2OTJ I;  5F0C A;  4PDK A;  2FNP A;  2KRH A;  5ILV A;  2NOG A;  2EIL H;  2DA4 A;  3FHZ A;  1SD4 A;  2OQR A;  3NRV A;  5FRO A;  2R5Z B;  3J80 Z;  3CCV I;  2JPB A;  2L9V A;  3OYD A;  1QRY A;  3D1N I;  1FSH A;  2Z9O A;  1TT5 B;  1UAA A;  5BOX A;  1R4N B;  5EJC A;  5C3E J;  1GV5 A;  3AAF A;  1NK3 P;  4L0Z B;  3TP0 A;  3EDP A;  1B6A A;  4B1R A;  4IF4 A;  2XKO A;  4DZP A;  2VOD A;  1G3T A;  5HDK A;  4CXF A;  1P4X A;  2QQ8 A;  2RQQ A;  3WHB A;  4O5V A;  2VUM J;  1WI3 A;  4R8H A;  2VAS A;  3VSL A;  3JR9 A;  3MWM A;  5M3M J;  2JA5 J;  1O3R A;  4KYW A;  4XNF A;  1V5F A;  1RR7 A;  1X2N A;  4ASN A;  4PSX A;  1U0J A;  4UUS A;  3JRI A;  2L7F P;  2MAB A;  1XN7 A;  3CF2 A;  2CS3 A;  2FOK A;  2L7M P;  2QBY A;  1T39 A;  2DA3 A;  1FBS A;  2HVR A;  4C9Y A;  5GTH C;  1WH5 A;  5ICF A;  1T0F C;  4GCV A;  4EJW A;  1JKO C;  3S17 J;  1R5I D;  4XL9 A;  1V54 H;  2HYF A;  2Y69 H;  1ZYR F;  2X51 A;  4L5J A;  2PJR B;  3V7C A;  4HRI A;  1OR7 A;  4J01 A;  1D3Y A;  4LB6 B;  3WTS C;  4NQW A;  5EGO A;  2WY7 Q;  2RKH A;  1VQ7 I;  2CW7 A;  2EZH A;  3GLX A;  3GTG J;  2BY1 A;  4LLL A;  1Z6R A;  2LTP A;  3H9J A;  2VE9 A;  1BA5 A;  5HNF A;  2B9S A;  4I0A A;  2LFB A;  1XGM A;  5D5W B;  3L00 A;  1FYM A;  1QHG A;  1TWC J;  2W57 A;  3F6O A;  4CYD A;  3OL4 A;  4B47 A;  2WV0 A;  4RGX A;  2YUS A;  2L3D A;  3Q0W A;  2XAQ A;  2L4A A;  3HEF A;  3L09 A;  4BXU A;  2HXO A;  1X4P A;  1TL8 A;  4MFD A;  1R71 A;  1LFU P;  3HDD A;  3EYI A;  4DJA A;  1FPQ A;  3TGN A;  2HZT A;  2DYR H;  4PZJ A;  3MZY A;  1I3Q J;  5FKM A;  5TGT A;  2EIK H;  3WTT C;  1SFO J;  1Y0N A;  2A68 F;  1D5Y A;  3BR1 A;  3GLL A;  3MMY B;  2ELH A;  3ZQG A;  5HS7 A;  2R5Y B;  1BIA A;  5B66 C;  1ITY A;  3C18 A;  4NBQ A;  2NS8 A;  4RMN A;  3T1B A;  1KA8 A;  3NWT A;  2NAZ A;  2IXS A;  1PJR A;  4M3G A;  2FSW A;  4AWX B;  3FKI J;  4XK4 A;  3BQY A;  4Z6Y A;  2HEO A;  3I4M J;  2HZD A;  1JGG A;  3FXK A;  5GTI C;  5K7Z A;  2VJ4 A;  2N8G A;  3A2K A;  1TWA J;  5HLH A;  3LL7 A;  1L3L A;  2F5F A;  1T95 A;  1ZQ3 P;  4J19 A;  3F22 A;  3ERM A;  2QYO A;  2GIZ A;  4RAY A;  5K5O A;  1J75 A;  3K4N A;  3CLO A;  3HGG A;  1R49 A;  1FOY A;  2WY8 Q;  4AVP A;  5LRS A;  1MIJ A;  1XMA A;  5FB2 A;  4JQF A;  3HOU J;  3S93 A;  1T0F A;  4XON A;  1G2H A;  5IOZ A;  2PBI A;  2XRN A;  1IUF A;  1AOY A;  3QOD A;  4BS9 A;  2JA2 A;  2UWM A;  3SFZ A;  2DMU A;  1IDZ A;  1Y1V J;  1MBF A;  4LD5 A;  1W36 C;  2QWW A;  4UVA A;  5BNG A;  3BTJ A;  4KMU X;  4L5I A;  2E2I J;  4HPQ A;  1LDK B;  3K4J A;  1SC7 A;  4X1E A;  2K9S A;  3BR2 A;  4M71 A;  1FTT A;  3DU6 A;  1Y8Q B;  3QPL A;  1FEX A;  5EYR A;  3GTO J;  1BR2 A;  5D5U B;  1MDM A;  1YRN A;  3PO3 J;  3LSJ A;  4FIS A;  4PSW A;  4YIF A;  4E7H A;  4KUM A;  4U87 A;  4ZYH A;  1ZG1 A;  4I98 B;  1WJD A;  4ZDP A;  3ZQQ A;  2CV2 A;  5AIP A;  1RNL A;  2IA0 A;  2Z99 A;  3KP5 A;  1W0U A;  5C4X J;  3F9K A;  1RRJ A;  2FRH A;  1PP7 U;  3F8N A;  3BJO A;  5LGU A;  3ROU A;  2Y0M A;  3O6B B;  1Z67 A;  3GTL J;  2FBH A;  2OU2 A;  4BEH B;  5HLG A;  4HX7 A;  4P9U A;  3QPS A;  4UV9 A;  4JK1 X;  1TW2 A;  3HKZ N;  3LQQ A;  4LIT A;  3OYK A;  3WE2 A;  3FXQ A;  3I0T A;  3TO9 A;  2BBY A;  4QTR A;  5EEA A;  5TJJ A;  4MQV A;  2XKP A;  1IF1 A;  3C2B A;  3E6B A;  5C4J J;  4BNC A;  5KK1 A;  4Y3O A;  4XKB A;  2ZFU A;  1P6R A;  2K02 A;  2W82 A;  3ZMZ A;  4C3J J;  2FX0 A;  1Z7L A;  2BVM A;  2R93 J;  4F93 B;  1E2X A;  3FMR A;  1X58 A;  4HG2 A;  2G9W A;  3JRG A;  2V26 A;  1YG2 A;  2E2H J;  4L0Y B;  3KYL A;  1HDP A;  4A0X A;  2HNH A;  1ERD A;  2A6H F;  3HC7 A;  1Z9C A;  1T08 B;  2JK3 A;  3PQK A;  3A01 A;  5DUK A;  3P9I A;  4LLN A;  1OCP A;  2BZT A;  1MSF C;  2FE3 A;  1R1T A;  2CQ7 A;  5B5E C;  1LJ9 A;  2JSP A;  3H1C A;  4KIB A;  1KYZ A;  1RR8 C;  2BHZ A;  1GUU A;  2ID6 A;  2WB1 N;  2LOO A;  1E3O C;  1WJF A;  2IW5 A;  2GBY A;  3J7Z I;  4MO7 A;  3HGY A;  1JE8 A;  1K78 A;  2FQ4 A;  2X0L A;  1HW2 A;  3M4O J;  1ZR2 A;  3K4M A;  1WJ5 A;  3IH4 A;  2FF4 A;  4CCL A;  2TCT A;  2CYY A;  2ZFW A;  2L54 A;  3QP5 A;  2CSO A;  2VKH A;  3BZK A;  5F1J A;  1R7J A;  2OCE A;  2TDX A;  4B8X A;  1TWG J;  3HBL A;  3R61 A;  4LK0 F;  1H9T A;  1HKT A;  1VQ6 I;  1PUF A;  2F4O B;  4PFO A;  1TQM A;  2CJJ A;  4M3B A;  3R60 A;  1FP2 A;  3M8J A;  1LUJ B;  3J80 K;  4LB5 A;  2Q2E A;  3KP7 A;  1D8K A;  2EZL A;  3T5X A;  1YIJ I;  3MKZ A;  3L2V A;  3F8C A;  1HXD A;  2STW A;  2GOX B;  1POG A;  3ZQI A;  4P96 A;  3GWZ A;  5L3G A;  1O3Q A;  2KHM A;  3HTS B;  4EJT A;  4G94 A;  2MYS A;  2O0Y A;  1H0M A;  2E1M B;  3DTK A;  1WI9 A;  4RM2 A;  4A5M A;  3G71 I;  3PJR A;  5DCM A;  1QHH D;  1XCB A;  4DYQ A;  1HW1 A;  3HOV J;  2ZXI A;  1VF9 A;  4MLO A;  3I4N J;  2YR2 A;  1TTY A;  2LC2 A;  2DMQ A;  1YS7 A;  2M3A A;  1MMA A;  5ICE A;  2PMH A;  3RKW A;  4HA8 A;  4G6D A;  2A5W A;  4BH9 A;  1OLT A;  2XHK A;  2VC1 A;  5GPA A;  3KET A;  2ISY A;  3PSF A;  1YTY A;  5DCF A;  3SZG A;  2HPM A;  3LST A;  2V7F A;  3Q9S A;  4Y15 A;  2VXD A;  2VC0 A;  2EV5 A;  1B9N A;  1EH7 A;  2HVQ A;  5J4V A;  2UXX A;  2X6Y A;  2JUG A;  3H3Z A;  5B1B H;  4YFX F;  5D5V B;  3NQO A;  4DBQ A;  1QQI A;  3K4B A;  5E79 C;  3OS2 A;  2I8D A;  3CQZ J;  2LF8 A;  2LKS A;  2DMT A;  2QBY B;  2IVM A;  3BWG A;  1WJE A;  2AXT C;  1Z3Y A;  3CDL A;  1XX5 A;  2QEX I;  1YFH A;  5ED4 A;  3RPU D;  4KNY A;  3WU0 A;  1VQ8 I;  1F4K A;  5FKO A;  4BJ6 C;  5CJ9 A;  3CDH A;  2DU9 A;  2Y31 A;  2YS9 A;  1I1S A;  3BDD A;  4RBO A;  1FMV A;  3LOC A;  4A3B J;  3HRU A;  5FRN A;  2JVG A;  1HW5 A;  4E6K G;  4A3J J;  3MD2 A;  4RA2 A;  3JRA A;  3ZMT A;  2PJR A;  3FBI B;  3ABT A;  5E1X A;  3M3Y J;  3HOW J;  1TBX A;  3I4P A;  1PUE E;  2XAS A;  3VYU B;  1UFM A;  2K9L A;  3QAH A;  2M7B A;  3K0L A;  3P7N A;  3VYS B;  3T8R A;  1VQM I;  5LBQ A;  3HSE A;  3HRT A;  1T6S A;  3VPR A;  4HLX A;  4F7Z A;  5L3C A;  2GIV A;  4A3G J;  4DQ2 A;  1E3P A;  1KU9 A;  3QWL A;  4KMF A;  1TNS A;  1ETV A;  3KFW X;  2VOP A;  1JKP C;  2K3F A;  4QSH A;  5ICG A;  1YJW I;  2F48 A;  1MD0 A;  1UHS A;  1O3S A;  4OMY A;  1S7A A;  1VQN I;  2WAD A;  1QBJ A;  1BI0 A;  4L5E A;  1RPW A;  5CVI A;  3IRQ A;  5D6E A;  1CGP A;  2DTZ A;  3LSH A;  5IYB J;  3CCS I;  2KKO A;  2D5V A;  2E1O A;  2R7Z J;  1OCC H;  1DPR A;  4LG0 B;  2R5Y A;  1E0E A;  4U0Y A;  3G2B A;  1STZ A;  2YU3 A;  3NAU A;  4A3D J;  3V4G A;  3WU1 B;  1VQL I;  2W48 A;  4L9J A;  1EJ9 A;  2VPL A;  2CWE A;  2FA5 A;  1SVO A;  4W97 A;  5CVJ A;  2QSH X;  3ABL H;  4KA4 A;  4H0E A;  1TLH B;  4HW0 A;  5F08 A;  2XGC A;  1Q1H A;  2VJJ A;  3F3X A;  1XMX A;  2HOT A;  4AIH A;  2L7Z A;  3L9F A;  2MGQ A;  1BI3 A;  3SYT A;  3HUG B;  2O61 A;  1H9G A;  4IQ4 A;  3F0C A;  4HSR A;  3SHF A;  1P7I A;  2V6C A;  4EV0 A;  4EJV A;  4IJA A;  5LHH A;  3MQ0 A;  1MMG A;  1DQU A;  4XLF A;  3ZQ7 A;  1DU6 A;  4E7L A;  1ZHF A;  2B63 J;  4IOC F;  2Y0S A;  5JHF A;  3CF5 F;  1T2K A;  1O7L A;  1IO2 A;  3FWE A;  4LG3 A;  4F3Q A;  3S15 J;  5JLW A;  3ECO A;  4EYY Q;  1WZ2 A;  1IN4 A;  1TT0 A;  2IEK A;  2QSF X;  2M5W A;  2DLL A;  1N77 A;  4HNV A;  2NXN B;  2FXA A;  5KAI C;  5C44 J;  3MZH A;  1OCR H;  1NK2 P;  4I2O A;  2IS1 A;  3OSF A;  3P5J A;  5J8F A;  2KMU A;  3K2A A;  4ZYA A;  1ZEL A;  3OOU A;  3MKY B;  1FP1 D;  4HYE A;  1YW8 A;  2H6B A;  4IRG A;  1BM9 A;  2O0Q A;  4PJN A;  2HXI A;  3BG6 A;  1MND A;  3OMY A;  2QVO A;  1GDT A;  1A6I A;  2VB6 A;  3QP6 A;  1D1B A;  1S29 A;  4DGW B;  4C30 A;  3WE3 A;  2E1M C;  4DIQ A;  4S04 A;  4BEH A;  3L7W A;  1CF7 B;  3R6S A;  5LRR A;  4YFN F;  3ZN0 A;  3IKV A;  2DK8 A;  1JHH A;  1UG2 A;  5D8K B;  4B3A A;  2DMP A;  3LSK A;  4MEY F;  1SVM A;  4YG2 F;  2M34 A;  3FMS A;  5AON A;  4KIC A;  2XAJ A;  2KPM A;  4M73 A;  4WK8 F;  2QA4 I;  3A03 A;  1Y1W J;  4UV8 A;  1ZLJ A;  3M8F A;  4HQM A;  3BTC A;  4OAZ A;  4XBF A;  1NH3 A;  2W85 A;  3E5X A;  2R7W A;  2MD5 A;  2EZK A;  4BJ5 C;  3JTH A;  2E71 A;  2HW2 A;  3WG7 H;  2D2W A;  2Z5U A;  2IT0 A;  1P4A A;  1T56 A;  3K4K A;  1S6L A;  2HKX A;  3SQN A;  2KLO A;  2H8R A;  4RB3 C;  3L2R A;  2LY2 A;  4M6V A;  3BR3 A;  5ILU A;  5J1Y A;  3G4S I;  2CW8 A;  2M9H A;  3D0S A;  3S32 A;  1GLN A;  4BGD A;  3K2Z A;  3KP2 A;  4CYC B;  2LNB A;  3CTA A;  1N25 A;  3A1Y A;  2EA4 A;  3WU2 C;  4Q5S F;  2HDW A;  4KIG A;  5J47 A;  3SEZ A;  1K78 B;  3OY9 A;  2VQH A;  2O9L A;  1IUY A;  3PNT A;  3GYH X;  4BAY A;  3J7A O;  1YW9 A;  2PQ8 A;  4RB1 A;  4IZZ A;  3LSP A;  2NOJ B;  1DP7 P;  4ON0 A;  5JVG F;  4BAC A;  2NVQ J;  2CV1 A;  3REO A;  3H36 A;  1VQP I;  4JOM A;  3DBH B;  1BR4 A;  4EEF G;  2EV0 A;  1ZLK A;  4I02 A;  3M7G A;  1WPK A;  4QPQ A;  4EM1 A;  1MBH A;  1QZZ A;  2O3F A;  3BG3 A;  4XRS G;  4XKV A;  2FOW A;  2LP0 A;  3IWF A;  3UR3 C;  5H2F C;  4YII A;  1ZGW A;  1S72 I;  1IW7 F;  2O8K A;  5DD8 A;  4BHC A;  3LA3 A;  1IC8 A;  2MFZ A;  2IGN A;  4CSW A;  3B6A A;  3DCF A;  5LFA A;  4RAF A;  1C0W A;  3E5Q A;  1H88 C;  1R4M B;  2KRF A;  2NYX A;  1N75 A;  4MTE A;  1VTN C;  4XRF A;  2V1D A;  1VQ9 I;  3E0J B;  3OIP A;  3PNY A;  5KHD A;  2LG4 A;  3OYF A;  4EGZ A;  1D8J A;  5KCM A;  3DEE A;  1VQO I;  4M3D A;  1ULY A;  1YHQ I;  2RAE A;  2X1E A;  2CO5 A;  2ZXW H;  1FT9 A;  1FIA A;  2CQQ A;  1FYL A;  3DP7 A;  3WHC A;  3HYI A;  2DOD A;  3KEQ A;  5M5Y J;  2P5K A;  5KNL A;  3BG5 A;  3H35 A;  2HTJ A;  3HXL A;  2JPC A;  4I01 A;  4M9Z A;  4IL6 C;  4B43 A;  2X85 A;  1MNE A;  1P4W A;  2E35 A;  2X4H A;  4XLN F;  3NWS A;  5KAF C;  1HKS A;  3UKG A;  2JN6 A;  3PIP F;  4QPO A;  2PMZ N;  3I64 A;  1X1P A;  2ZC2 A;  3QOE A;  1BW5 A;  1MNM C;  4DYR A;  4EQQ A;  5ILS A;  1KON A;  3DEW A;  3M1E A;  1MMS A;  1FC3 A;  3OYA A;  5F64 A;  2QUF A;  3SDB A;  2QEN A;  1YO5 C;  2E5N A;  1FYK A;  3WGH A;  3BQZ A;  3I58 A;  3U1D A;  5J6X A;  1W36 D;  1W7P A;  2OA4 A;  4G7Z F;  1DP3 A;  2D45 A;  3L2W A;  1MBE A;  1RIO H;  4DW6 A;  1WQ2 A;  3PSI A;  3DKX A;  1WFX A;  3HRM A;  1LVK A;  1R23 A;  2F4I A;  1E17 A;  3KCC A;  2R3S A;  1RI7 A;  3OYN A;  1HF0 A;  1MJ9 A;  3N97 A;  3ZRG A;  5K5R A;  3LNQ A;  2LY1 A;  1A35 A;  4YEJ A;  1UEL B;  5LGT A;  1HOM A;  4P55 A;  4WWC A;  4O6J A;  3O3K A;  1XGO A;  2O8X A;  4CGZ A;  4I76 A;  2Z33 A;  4NHJ A;  3RSN A;  3H92 A;  2JA7 J;  4CZC A;  4XN3 A;  4DOZ A;  2FD5 A;  5L3B A;  1Y6I A;  2LRE A;  4BQQ A;  3WTW C;  3SFI A;  2VQG A;  3RDI A; 
#chains in the Genus database with same CATH homology
 3K4L A;  1JI8 A;  2LBF B;  2V26 A;  3DWL E;  2VLA A;  3QYB A;  3KYL A;  3LMM A;  2HNH A;  4XM3 A;  3HC7 A;  1ERD A;  3RTR A;  3VDX A;  4XKC A;  4FET A;  3BLY A;  3SEQ A;  1MMN A;  2IS4 A;  2M7A A;  2Z16 A;  2IS6 A;  4XR6 A;  1V5E A;  4E7Z A;  2JSP A;  4PK4 A;  2R7V A;  2LOO A;  3BCA A;  1WJF A;  3RQ4 A;  4ZTJ A;  4E7I A;  2VQC A;  2UV1 A;  4XN0 A;  3J7A Y;  2W4S A;  4BDY A;  2LH9 A;  3EUH C;  3K4M A;  1WJ5 A;  1VZ0 A;  2BW3 B;  1G8X A;  4CCO A;  4CCL A;  4E7S A;  3H5N A;  4RM3 A;  4CCM A;  2VKH A;  3HPG A;  3I9V 2;  2OUM A;  3L2Q A;  2IGK A;  3PUB A;  3OR1 C;  4PFO A;  2KQR A;  4N4O B;  4Y4R A;  2DT6 A;  3M8J A;  2R7U A;  3MKZ A;  1D0Y A;  3L2V A;  2E60 A;  2GOX B;  3C2H A;  3ZXS A;  4B44 A;  3D5S C;  3DPT A;  2V6E A;  3V42 A;  3EPZ A;  2Q1Z B;  2KHM A;  4ITV A;  2W00 A;  2MYS A;  4BE0 A;  2E1M B;  1J09 A;  3DTK A;  4RM2 A;  3IAM 2;  4B3X A;  3PFY A;  1S9H A;  3PJR A;  2WB1 A;  1QHH D;  3TMO A;  4D9J A;  3AL0 B;  2ZXI A;  4MLO A;  3LSG A;  2LC2 A;  3UNG C;  2ZXH A;  2M3A A;  1MMA A;  4XLC A;  3CJQ B;  2HU9 A;  1SAU A;  4ZTF A;  2A5W A;  2K9M A;  4PFP A;  1OLT A;  2BOL A;  2WA0 A;  3DTI A;  3PSF A;  3AFH A;  3CZ6 A;  3VYR B;  3SZG A;  5FRM A;  2HPM A;  2V7F A;  3HL2 A;  2VXD A;  1P9Q C;  2HVQ A;  3OYM A;  4E7K A;  2XDV A;  2X6Y A;  2JUG A;  1DGR M;  3DLA A;  3K4C A;  2QKM B;  4DBQ A;  3K4B A;  3OS2 A;  3ZGK A;  1BOB A;  3QYE A;  2I8D A;  2M4K A;  4PUS A;  2CV0 A;  2ZSH B;  4KT6 A;  3IP4 B;  3CJR B;  4OWR B;  2R7X A;  1WJE A;  5HNH A;  1Z3Y A;  3DTE A;  2R7R A;  4C2U A;  3RPU D;  2AQF A;  1YX3 A;  2HPI A;  1K6Y A;  3BCB A;  4BJ6 C;  3W2V A;  3K70 C;  2XF6 A;  4II2 A;  1G59 A;  1FMV A;  5FRN A;  2JVG A;  4HST A;  4E6K G;  3MD2 A;  2QKL B;  2VL8 A;  2PJR A;  4CCK A;  3FBI B;  3U21 A;  2KP6 A;  3VYT B;  2Z1D A;  4F52 A;  4KJZ A;  2XSJ C;  3EUK L;  4DBR A;  3VYU B;  4B48 A;  4G6T B;  1YE9 A;  2K9L A;  4IX7 A;  3K70 D;  2M7B A;  4BJT A;  3VYS B;  4PJM A;  3H9G A;  2CMP A;  3DKY A;  4P1W A;  4IQJ A;  2OV7 A;  2IGO A;  2WAE A;  4U7B A;  2CUJ A;  2V9K A;  4ZDO A;  2F5V A;  3S8P A;  2JVH A;  2VIX A;  2IGM A;  1UG0 A;  1LFP A;  2VXZ A;  2L7K A;  2WAD A;  5CQG A;  4ZJZ A;  2WAF A;  3HPH A;  3L2U A;  1X1C A;  3A4C A;  4E7J A;  3HKZ A;  3OL3 A;  3D5L A;  3LSH A;  4KIS A;  1X4O A;  2KZV A;  3BC8 A;  4BE1 A;  4BQO A;  2UUZ A;  3ZR8 X;  4NC7 A;  4RLQ A;  4AYB A;  1OR7 C;  4XOR A;  4NC8 A;  5HOO A;  1E0E A;  3G2B A;  2HQA A;  4HEA 2;  2WAQ A;  2KDO A;  1LKX A;  4F92 B;  2VPL A;  3DPU A;  4E4H A;  3I3L A;  3W2W A;  1V5G A;  2K3P A;  4BU2 A;  1WJB A;  2Q2E B;  1R6R A;  1D0X A;  1TZL A;  4J00 A;  2VJJ A;  1X1D A;  1PYV A;  3QYF A;  2ZSI B;  2JQN A;  4ZC3 A;  2X1C A;  2DT7 B;  1NG6 A;  4XLH A;  2KRC A;  3ZCO A;  3SYT A;  3HUG B;  3H9Q A;  3S3M A;  2CFO A;  4IQ4 A;  4HSR A;  4YEL A;  4ANJ A;  3CES A;  3VWB A;  3BG7 A;  3FKJ A;  2DJI A;  4HNT A;  1MMG A;  2KRH A;  1DQU A;  5HVQ C;  4XLF A;  3OS0 A;  3AKZ A;  4E7L A;  2XC7 A;  2R7O A;  2Y0S A;  5JHF A;  3MKW B;  4F3Q A;  4LG3 A;  5FRO A;  4EYY Q;  2L5Q A;  2DXI A;  1TT0 A;  2DCE A;  1N78 A;  2VJI A;  3OYD A;  3KEY A;  1UAA A;  1N77 A;  4PJL A;  2KL4 A;  2A6T A;  2IS1 A;  2X1D A;  2R7Q A;  2LYC A;  2ELJ A;  2KMU A;  4ZYA A;  1ZEL A;  3PNV A;  3OOU A;  3MKY B;  2RQQ A;  4F91 B;  4PJJ A;  2W7N A;  2O0Q A;  4PJN A;  3BG6 A;  3OS1 A;  1MND A;  3OMY A;  2IS2 A;  2VAS A;  3VSL A;  1Z3X A;  2VB6 A;  4ZDL A;  1D1B A;  3OWT A;  1V5F A;  2WBM A;  3HG9 A;  4RLF A;  4XNF A;  4PSX A;  1U0J A;  4DGW B;  4C30 A;  4H4K C;  4F55 A;  3OYI A;  2E1M C;  2MAB A;  4DIQ A;  4BEH A;  3CF2 A;  2CS3 A;  2O5R A;  2X6W A;  2M4G A;  4OAY A;  3TL4 X;  3OYL A;  2HVR A;  4C9Y A;  5LD2 C;  2VKD A;  1T0F C;  2FUG 2;  4XL9 A;  3AL0 C;  2L9S A;  3IUO A;  3LSK A;  4YRV A;  3N05 A;  2X51 A;  4NNJ A;  4X0G A;  2PJR B;  4HRI A;  4J01 A;  2KPM A;  3C2G A;  2WY7 Q;  4BQN A;  2RNG A;  3ONQ A;  1WJA A;  4OAZ A;  2CW7 A;  3HOT A;  1IRX A;  2R7W A;  4GRI A;  4BJ5 C;  4AVZ A;  2OC6 A;  2HW2 A;  3H9J A;  1SFK A;  5HNF A;  3K4K A;  2F6C A;  2LBF A;  3OYG A;  2KLO A;  1D0Z A;  3L2R A;  2LY2 A;  3CP8 A;  1QHG A;  3OL4 A;  4B47 A;  2CW8 A;  3S32 A;  1GLN A;  3K6G A;  2R4G A;  4XQF A;  1MMD A;  4BGD A;  1AA7 A;  3LSI A;  4D1Q A;  4LIV A;  4P5O A;  3A1Y A;  1EA3 A;  1X4P A;  3DPL C;  2HDW A;  4XLE A;  3SEZ A;  4DJA A;  3OYB A;  3OY9 A;  2VQH A;  2XAU A;  1YX5 A;  4BL0 B;  3PNT A;  2LRD A;  3RCO A;  5TGT A;  4BUP A;  2GOM A;  3FBN B;  1X19 A;  4IZZ A;  2BW3 A;  1Y56 A;  2NOJ B;  3K10 A;  4XLA A;  4XMY A;  4R79 A;  4BAC A;  2CV1 A;  2X6X A;  2L2O A;  1Z21 A;  3MMY B;  3H0D A;  4JOM A;  1BR4 A;  3HOS A;  4RMN A;  3S3N A;  4CCN A;  4LIU A;  4QPQ A;  2R7T A;  3NWT A;  2HVS A;  1DGW Y;  2IXS A;  2Z2S B;  1PJR A;  1X1A A;  4XKV A;  1HA8 A;  2VQL A;  3UR3 C;  2HZD A;  4BE2 A;  2MFZ A;  2VJ4 A;  2IGN A;  4BXF A;  4CSW A;  5LFA A;  3A2K A;  3KX2 A;  3LL7 A;  1T95 A;  4C2T A;  1QU3 A;  1N75 A;  2XF7 A;  4FAS D;  1WJC A;  3E0J B;  3K4N A;  3OIP A;  2LG4 A;  3PNY A;  5KHD A;  3OYF A;  5KCM A;  2CH0 A;  3DEE A;  2V4J C;  4CUG A;  1D1A A;  2X1E A;  2WY8 Q;  3TBI A;  1FMW A;  4XKW A;  2E5Z A;  3W3C A;  3IAS 2;  4KIT B;  4JQF A;  3S93 A;  4XON A;  2M0M A;  4EAT A;  3CP2 A;  5KNL A;  3QOD A;  4BS9 A;  2JA2 A;  4XOT A;  2UWM A;  3H35 A;  3E1S A;  3HXL A;  4B43 A;  2X85 A;  1W36 C;  4CH7 A;  1MNE A;  4BDZ A;  1BR1 A;  3NWS A;  2XF5 A;  4IKF A;  2K5C A;  3VSK A;  4QPO A;  4HPQ A;  1LDK B;  3K4J A;  3QOE A;  3H5R A;  3DU6 A;  2V1N A;  1KON A;  4N4N B;  1BR2 A;  3OIQ A;  3CMM A;  2W1O A;  3D5R C;  2AQE A;  4NUB A;  4PSW A;  3OYA A;  4E7H A;  4U87 A;  3SDB A;  2BVL A;  1WJD A;  4ZDP A;  2E5N A;  4CCJ A;  3ZQQ A;  2CV2 A;  2R7S A;  1NG7 A;  4CA0 A;  1W36 D;  2L9N A;  3OYE A;  2P0W A;  3F9K A;  3OYC A;  2DOA A;  1DP3 A;  4HNU A;  3L2W A;  5HLT A;  3PSI A;  4AU7 A;  3H5A A;  3GBG A;  3DKX A;  1WFX A;  3DQV C;  4BEH B;  1LVK A;  3M1C A;  3FHN A;  5CQE A;  2F4I A;  4Y33 A;  3OYN A;  3ZRG A;  2VJ5 A;  4LIT A;  1D1C A;  2MC4 A;  3OYK A;  2LY1 A;  1X1B A;  4YEJ A;  1UEL B;  2MD0 A;  3W2A A;  3OYJ A;  3S3O A;  1MW7 A;  4NQW B;  5CKT A;  2RRE A;  3DU5 A;  3OYH A;  3LFU A;  4II3 A;  3EUA A;  4XKB A;  2ZFU A;  3PL8 A;  4Y3O A;  3RSN A;  3FDY A;  4CZC A;  3LSM A;  2W82 A;  5CPR B;  3OR2 C;  4XN3 A;  4DOZ A;  2PMZ A;  2CUZ A;  1Z7L A;  2BVM A;  4F93 B;  1Y6I A;  2LRE A;  4XOP A;  4BQQ A;  2O0P A;  4HG2 A;  2VQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...