1WFXA

Crystal structure of ape0204 from aeropyrum pernix
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
180
structure length
180
Chain Sequence
VRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable RNA 2'-phosphotransferase
publication title Crystal Structure of the RNA 2'-Phosphotransferase from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
total genus 46
structure length 180
sequence length 180
ec nomenclature ec 2.7.-.-:
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wfxA01
3.20.170.30 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 1wfxA02
1WFXA
chains in the Genus database with same CATH superfamily
4F92B 2DA2A 3GTKJ 1WJEA 3CMMA 1FMWA 2M87A 2VKVA 3KZYA 4DBRA 1OR7A 1YQAA 2O5RA 3J7AY 3PUFA 4HSRA 1QO0D 3RYPA 2Z5UA 2CQ7A 3JRIA 1ZR2A 1EA3A 4G7HF 2J5PA 1T8IA 1FYMA 2R5YA 5DV5A 2G9WA 3C3WA 2FRHA 4EJVA 2FA5A 3I64A 1YO5C 4Y52J 2HYJA 2YR2A 2KFDA 1RZ4A 1LKXA 2EFWA 1S3JA 2O61A 2F5CA 3NARA 4YRVA 1E0EA 4DJAA 1SAXA 1ENHA 2IXSA 4AIDA 2OCEA 1S7OA 2XDVA 3GLLA 5FB2A 4ANJA 1FWZA 1G4DA 3K1NA 3GTMJ 3K9TA 3F6VA 4KISA 1LVAA 3GUDA 3QU6A 5LRRA 2DA1A 2PEXA 2NNNA 3DBRB 4KT5C 2VUMJ 3FM3A 2M7BA 1YW9A 1HDPA 2K7LA 3HOSA 1K83J 1FBUA 4CYCB 4Y13A 1EJ9A 3IL2A 2L3DA 2WAQA 2YSRA 1X2NA 1SVLA 2LVSA 1JKRC 1FC3A 1FEXA 2ZC2A 3CUQB 4BHPA 4C3JJ 3S93A 5EG0A 4G9YA 4ZC3A 2EFQA 2CFOA 3F3XA 3CCUI 4G8XA 3RI4A 1EH8A 1B72B 2B63J 2RVCA 2CUZA 2DA4A 4ABZA 3OYCA 2OD5A 3F8BA 4G6QA 2XSJC 5DS9A 1ON1A 2EV0A 2XSDC 2EWNA 3LSGA 2LOOA 3K69A 3QP6A 3QYBA 4PK4A 3WU0A 3JTGA 4RB3C 2ESNA 2RC4A 2WB1N 3GTPJ 2VIXA 3M9AA 2JWTA 2FUG2 2L02A 2QEXI 1PP7U 5DCMA 4A2UA 5FKOA 4BQNA 2KIMA 3JCUC 2XGXA 2EZIA 4E7LA 3K1MA 3ERED 4ZYDA 3ECHA 1JT6A 3RCOA 2Y31A 3OWTA 2H09A 3I3LA 3CCEI 2HDCA 4ZZDA 4N4NB 5HLIA 1FP2A 1DP7P 3W3CA 1H88C 3IC7A 5E1XA 1YOVB 2JSCA 5LGNA 1VQ9I 3GZNB 1R7JA 1X1DA 2DDAA 2QQAA 2HOEA 2HPMA 1GXQA 1ZKGA 4MO7A 4NB5A 4KMFA 4QPQA 2F4OB 3IWZA 4WCGA 3HRMA 2IW5A 1VFCA 4I01A 3VOEA 2KPMA 4BQOA 2YU9J 1T98A 2CSOA 4CXFA 2FMLA 4IHYA 1MNEA 2HI3A 4CZZA 1E2XA 4I2OA 1ZTRA 2R7FA 3ABTA 2QYOA 3R0AA 5HNFA 4FQGA 5EJCA 4PZJA 2QZ8A 4BEHB 3IHUA 5ED4A 4RS8A 5EEAA 3GF2A 1DQUA 3M8EA 3CCJI 4XKBA 2M5WA 2D2WA 2P81A 2LP0A 1IDZA 1USTA 4CICA 3PUBA 1XGNA 3MEXA 4MFDA 2CU7A 3H3ZA 4XN3A 2DMUA 3CESA 1FNNA 1IW7F 2W57A 4YFXF 3NRVA 1IO2A 1UB9A 2LLKA 2ZJPF 5LRSA 3GFMA 2A07F 2KDZA 1GV2A 2DFEA 2WAEA 1BI0A 2WY7Q 5FGMA 3AKZA 4WF2A 1OISA 1WFXA 4NC6A 4OWRB 4WXHA 4CCJA 3ESWB 4BACA 2TDXA 2DOAA 2P5VA 2EIKH 2HGCA 4FHTA 4A6EA 3H3VK 1POGA 3BR2A 3V4GA 4K2EA 3TO6A 4PFPA 3DPTA 4UUTA 2UXXA 4Y33A 5DUKA 4A93J 1V5FA 4UY8I 1Y6IA 2XGEA 2HDDA 2HXOA 2ECBA 4II3A 1UG2A 1FX7A 4PJLA 1QU3A 5TRDA 3A2KA 1ZK8A 2EH3A 4B4CA 3F8MA 5LEJA 4YG2F 2IS2A 4UB8C 3RPUA 3IWFA 1IN4A 3LL7A 3IKTA 1U9OA 2CUFA 4D7MA 5M5WJ 4LLLA 4JX6A 3OYFA 5DM7F 1WJBA 3ABLH 1SMTA 1RESA 5E3NA 1CQTA 1AU7A 5JI6A 4QWQA 3G1OA 1RETA 2M45A 2VJJA 3GX4X 5M3FJ 3QOEA 3WTXC 4CCOA 2K27A 3CP2A 1XGOA 1BOAA 2XKPA 3FMQA 2DAOA 3LAJA 2CYYA 4R8HA 1AKHA 1Z21A 1PVEA 4FETA 3ZQFA 4UUSB 3U1KA 3CCYA 3PSIA 1NG6A 4RDUA 1J9IA 4HPQA 1T08B 1V54H 4RGUA 5IYBJ 1O7FA 1IAWA 2QBYA 3AG4H 1X3UA 3OYEA 3PL8A 2KT0A 2NS7A 2E1OA 4Y17A 2M8EA 3UNGC 2JA5J 1I39A 1Q1VA 1LUJB 3BY6A 2GWRA 1MH4A 2EFPA 2G7UA 2MW8A 3WTZA 4FT8A 4DIQA 1WJDA 1S29A 1VQ8I 4M3BA 2VE8A 5ICGA 2OU2A 1XS9A 3FXOA 3P7NA 2M8GX 2X1DA 4PGGA 2DPDA 2X4HA 1KQ0A 4PGHA 3JSPA 4MEXF 3OYDA 3EYYA 1VQLI 2MFZA 2Z16A 3Q0WA 3SYTA 1SD6A 4F91B 3CQZJ 1Y0UA 5J1YA 2ZSIB 1FZPB 4BE2A 1R58A 3DKXA 1TT5B 1QZYA 2X1CA 3SHFA 4HNUA 2IJLA 3GFLA 3MN2A 3I4PA 2VQGA 1N78A 2WAQN 3FDYA 3QRFF 2Z1DA 3JAMK 1QGPA 3JR9A 1DP3A 1U8BA 4FE7A 1YRNA 1WJFA 3H36A 1KGSA 1ON2A 1R5HA 2F4IA 1Z6TA 4RAZA 3C2BA 1MDMA 2QUFA 1HKSA 1WSUA 2W4SA 4R1HA 3GTQJ 2QF7A 1XC5A 5IP9J 2VC1A 1V5GA 2LRDA 3LSHA 2R0QC 4YEJA 1FSEA 1QRYA 1SFEA 2A69F 2EV5A 2EZKA 5F0HA 1AA7A 3L2WA 1R5GA 1JXSA 4ENNA 1U5TB 1APLC 3ZMTA 2L0KA 4XRSG 4F55A 4QTRA 4V2GA 2BY2A 2BY3A 4L18B 3LA2A 2OTLI 4ZDLA 4A3KJ 3WE3A 1YS7A 2BVMA 3TO9A 4WX9A 1G8XA 5J1RA 3BG5A 3VYTB 4AIHA 3H0GJ 3N97A 4BU2A 2JN6A 2XAHA 1TWFJ 4KITB 4A5NA 1JE8A 1K4TA 3F0CA 1U6GA 4UV9A 3ZMZA 1FTZA 2KRFA 3WGIA 1O3QA 3BZKA 3L2QA 4F52A 1ITYA 2CGPA 2QM3A 2Z2SB 1U9NA 2JUCA 2I8DA 2VKDA 5EF6A 3KP4A 1WJCA 2DJIA 2M3AA 1RKTA 2KISA 3AL0B 3HRSA 5ILUA 2E34A 4GFBA 3RKYA 4IX7A 2ZB9A 4CYCA 3DU5A 4EV0A 3KP3A 5DYMA 4A3BJ 2MH2A 5D5UB 3CUQA 1NK2P 4L9JA 5ICFA 3OYLA 4Q48A 2R5ZB 1J75A 2OZ6A 1ZRFA 5EDNA 1P4AA 1P4XA 3G2BA 5H6RA 3PO2J 3OOPA 3S3OA 2TCTA 1B72A 3N4MA 2YS9A 2B0LA 1S7EA 4A3JJ 4OIOF 1VQ6I 3LWFA 4PJ0C 2ECCA 3BQYA 3KLNA 2V7FA 1E3OC 3JRGA 3EUHC 2FE3A 2IGKA 1WZ2A 1R5ID 3OSGA 3JAMZ 2X6XA 3H1CA 3QQAA 3NAUA 2ZCWA 4KJZA 4BBSJ 1GT0C 3GTOJ 2LY2A 2HNHA 5HLTA 4DGWB 5J40A 3O2PE 2K9LA 2L2OA 1OCTC 3DLLF 1KYWA 2DDBA 4L9NA 5D4SA 3CCSI 6PAXA 3LFUA 4OIRF 3K4KA 2VQHA 5DCMB 3V8LA 2MABA 2QKLB 2ZBKA 3BR6A 2LSOA 1SD4A 2BE5F 4A0ZA 1OPCA 2FU4A 4KICA 4D9JA 2VBZA 4EYYQ 3HSEA 1IV6A 4OMYA 1IJWC 2NOJB 2OBPA 1EH6A 2D5VA 2MC4A 4EM2A 2HOSA 4ZZLA 3QOPA 1TWGJ 4GO1A 3SZPA 4IO9F 3BTJA 2FOKA 1XCBA 3AG1H 3LQRA 1XDSA 3VDXA 1D5YA 4OMZA 2E1MB 1LJ9A 1S8NA 2QSGX 2E1NA 3UR3C 3T1BA 3EQLF 1X2MA 3GZ6A 3L2UA 2BHYA 1TQIA 2K5CA 2CW7A 4BEHA 5BMZA 1FSHA 4QSHA 1ETOA 2VN2A 4BXXJ 2DOFA 1ACIA 4RB2C 2VOOA 5LD2C 2X85A 3PNTA 3KE2A 2VBYA 2XV4S 2V9VA 3FMSA 3HKZN 2QQBA 4HRIA 4X6AJ 1FLIA 1OR7C 3OIOA 1A35A 4LD5A 1YITI 3QPLA 4HX8A 3GFJA 3MQ0A 1BW6A 2AQEA 4E7JA 3U1DA 4J01A 3CD6I 4A12A 3KETA 3T8TA 1AWCA 2HS5A 2DI3A 5HOOA 1G6NA 4XLCA 5FKNA 4W1UA 2EZHA 1T6SA 5L3FA 2HYGD 3L9FA 1ONVA 2KIFA 4HNVA 1Z3XA 4L9TA 3DPLC 2L9NA 4F93B 2VT2A 2W48A 1FYKA 3OSFA 5DUIA 1G3WA 4C2TA 4IRGA 4PSXA 4Y4RA 2E35A 2EV6A 4IPAA 1JTXA 2IAIA 5DTDA 4XK4A 1VF9A 2XRNA 4EGZA 1SFOJ 1JT0A 2XIGA 3KCCA 1G3TA 5D8KB 1F4KA 3K4JA 2VT3A 2PN6A 4BHCA 2FOWA 1U78A 3HOZJ 1JKQC 3IRRA 5E79C 5M5XJ 3DQVC 1A04A 1U2WA 2VI6A 3H3UA 1O7LA 3RIRA 3ZMVA 2AHQA 2ESHA 1TQPA 1SVOA 2HU9A 2ELJA 3HTUA 1V55H 5IPAA 4Z6YA 2WY8Q 3J7ZI 3JREA 2X51A 3LQQA 4BUPA 4NDLA 3MWMA 3DV8A 4HDUA 1Y56A 5F04A 1ODDA 3I58A 4JBAA 3ISPA 3Q0UA 4HF1A 4DW6A 2CS3A 2G0EA 5J6XA 1YW8A 3E6CC 1G2HA 5B3SH 2XROA 4CGZA 4DNCA 2H94A 4XQFA 3LSJA 4OAYA 1BOBA 5E18F 1R71A 3KYLA 2HOTA 3OYAA 1KU3A 4WK8F 2ZJQF 3HIFA 4UUSA 5C4XJ 4LOCA 3WHBA 3F23A 5K1YA 1OCPA 2Y30A 3HJEA 3J80K 2A6EF 2PBIA 3CJQB 3CMEI 3S8PA 5EYRA 3HEFA 2L4MA 4BDYA 1JJ8C 4BS9A 2DQRA 3ZN1A 3E1SA 2IS6A 5BQTA 3ZP5A 2XVCA 3HUGB 1IXCA 2CMPA 1OYWA 4KIBA 5D5XB 3K10A 3FKJA 2BY0A 3BJOA 1BC7C 2UWMA 3O8GA 1YX3A 1UFMA 2DT7B 3KPHA 3R60A 3AG2H 4UHTA 4ITVA 5D6EA 1JHFA 4G7OF 2BZTA 2HDWA 1L3LA 2JMWA 3E5UA 3CDIA 3M07A 1R36A 5LBQA 4HBLA 4U88A 2M4GA 4H0EA 1YHQI 1B6AA 2DODA 1P2FA 2KKOA 4XKWA 3K4NA 3VSKA 2W25A 3IAS2 3K1PA 1EV7A 2E1MC 1PDNC 1T56A 2XUBA 2O8XA 2I10A 2V9PA 4KUMA 3DP7A 3GLXA 3SJMA 1Z3YA 3GCMA 1OQYA 1MJ9A 1OCRH 1V3FA 3GO5A 2QGUA 2DA5A 4NBQA 2EA2A 3WE2A 1TP4A 5KAIC 3LOCA 4S0HB 3RPQA 1F1ZA 5TJJA 4X0GA 3B02A 1T39A 4E7IA 1JHHA 2K4BA 5CKTA 5HS9A 5A2QZ 2FX0A 3ASOH 1YJ9I 2XGCA 5BNGA 5FRNA 1UHMA 3F21A 4HZFA 3RKWA 2MGQA 1YIJI 3T0YA 4I98B 4XLAA 1Y8QB 1CGPA 3OIQA 2PJPA 3LA3A 1IUYA 1X1CA 1ETYA 1K79A 2MA3A 1N75A 4Y7NJ 3HHGA 4AIKA 2CH0A 2LD5A 4IVNA 3OYBA 1BC8C 2R92J 4HEA2 1U5TA 3BJ6A 4IHSA 4I76A 3DEUA 2XKOA 3OYMA 2M2EA 2L7FP 3LSIA 2ZNZA 3GTLJ 4JYKA 2FQ3A 4HW0A 2GQQA 3BC8A 1JUMA 1SANA 2ZFWA 1AOYA 3TKYA 5FFXA 4BJ6C 5JLWA 2QQ8A 2MC3A 2L01A 2JQ7A 2EIJH 4S04A 2NNYA 2BW3B 3RZDJ 2O7OA 3Q3SA 3HOVJ 3OYHA 1LDDA 3JRFA 1EH7A 2ZNYA 1STZA 4FX0A 3ZQIA 4DBQA 4RM2A 2F6CA 4U87A 4A69C 2CFXA 3AFHA 3HBLA 4Z2YA 3MZ8A 3J80Z 1MBEA 3IKVA 1GVDA 2UXNA 1P92A 3RJPA 1LE8A 3S2WA 2LY1A 2EFOA 1RNLA 3B73A 4IXAA 3TL4X 1RR8C 4LFUA 1TBXA 1SEUA 2OA4A 2ZMEA 1FOKA 4XLFA 3CO6C 3BCAA 2EBIA 3DEEA 3LSTA 4P96A 5GPAA 3BZCA 4KIGA 1CF7B 2DJNA 3CJTB 1OCCH 3TOAA 3SFZA 2R7XA 2CRGA 3HOTA 2ZJ2A 4LIUA 4DZJA 3ZQLA 2C6YA 3IAM2 1MMDA 1W36C 3MZYA 2R5ZA 1J7KA 3MKZA 3OIPA 4YIRX 3S16J 2DA3A 3ML6A 2CQKA 3H9QA 1Z9CA 1LVKA 1NTCA 4OIPF 1BR4A 3C1DA 4B47A 3ZQHA 2XAQA 2X1EA 1TLHB 2ZKZA 3H5RA 4GYIA 4UV8A 3TP3A 4EEFG 2Q8KA 2O0PA 3I56I 3C7JA 3DU6A 2BVLA 5EZGA 3TOBA 2M9HA 3F8FA 3S14J 5E3MA 2VPRA 2XF6A 3U9GA 4XIDA 4M3EA 3H5NA 4GDFA 2VQLA 3VYSB 3S1NJ 1USSA 2NAZA 4RA2A 5GTHC 1T0FA 4KN4X 3GXOA 2JRMA 3QPHA 2Q2EB 2VXZA 2K3PA 1J0RA 1W5TA 1J59A 1BM9A 4LLNA 5FD5A 1KA8A 1I1GA 4XR6A 1NHAA 2Q0OA 2FEZA 1H89C 2K9MA 1O4XA 1QHGA 2XPUA 4A3EJ 4P9FA 2RQPA 3IH2A 3VEPA 3E6BA 4LMYA 2LG4A 2Y48A 2XAGA 2JA6J 2L5QA 5FRMA 4IHTA 1UAAA 2JJ7A 3CZ6A 3VPRA 4L0ZB 3HL2A 3SFIA 2NVXJ 3MCZA 4AYBN 4XSZF 2ADUA 2XAJA 5KAFC 4NC7A 2Z99A 1OKRA 1WH5A 3P9IA 1GXPA 2H8WA 3DCFA 2GOMA 1I1SA 2NS8A 1LFPA 2VBWA 5FJ8J 2HFHA 1N25A 4HF0A 2ACJA 1MKMA 1XB4A 3OMYA 5IT9Z 5LGTA 1I5ZA 2BBYA 1XMAA 2E2JJ 2LFBA 2H27A 3CTAA 2KDOA 1I27A 1OMIA 2X6WA 5J3LA 2DU9A 4FTHA 3FBIB 1FMVA 3BQZA 3WHCA 3KYDB 2R7OA 3BP8A 1P4WA 4G94A 5DDGA 4MLOA 4DYQA 3X2QH 1MMAA 1S5LC 4B3AA 3RYRA 3E6DA 1E3PA 1MZBA 1LFUP 4A3FJ 4S05A 4IEJA 4RB1A 2LDUA 1XDUA 3E7LA 4YELA 2EPFA 2O0YA 3HPHA 3ZQCA 3KEQA 3OS2A 2IT0A 1OYIA 3E5XA 1BI2A 1L0OC 3JRAA 2FMYA 5AONA 5BPIA 3FXLA 4G12A 3L2VA 2OJED 3H0DA 1IN8A 2A05A 2ICWG 2HR3A 4UB6C 3ERMA 3L2CA 3TP0A 3FF5A 3Q5FA 2GBYA 4M73A 4M72A 1D3YA 2IA2A 3Q0VA 4BXUA 4ESBA 4E7HA 3MKWB 2PMHA 3CUQC 3P5JA 2PI0A 1XCVA 3PQJA 4ZYAA 4E6KG 4HX7A 3GTJJ 3ASNH 5F64A 2CUJA 1HC8A 1S6LA 2VB6A 4ENJA 1ZAOA 1A6IA 5HODA 1FY7A 2ELHA 5DD8A 1ETWA 4RLQA 3WG9A 2L4AA 3IP4B 4KT6A 5E20A 3HG9A 3HSFA 2R7QA 3RSNA 4ENMA 3FKIJ 4HSTA 4OU0A 4B48A 3CC2I 3LAPA 1DDNA 5JLXA 1WWXA 1FBQA 1XGSA 4BDZA 3FM5A 5IP7J 1FP1D 4F7ZA 3DEWA 3DBHB 5M3MJ 1P7IA 2LBFB 2HKXA 2D1VA 4V2FA 3FK6A 3HUGA 5J8CA 1T38A 3C2GA 3H92A 2IEKA 2VASA 4FCYA 2ZXIA 2DK5A 4W97A 1X58A 1BJZA 3IUOA 2GM4A 2FSWA 1DUXC 2VJ5A 2HQRA 1K4SA 1F9NA 2V1DA 3BTIA 3ZGKA 2W1OA 5E3LA 5CYVA 3L09A 3MAJA 3U21A 3BCBA 3FX3A 2DLLA 1TNSA 5FLVA 3TO7A 4NHJA 5JVTA 3ZPLA 4PDKA 2O6GE 1XSVA 2CV2A 4AWXB 2MD0A 3A01B 1TL8A 2G7HA 5ILSA 1X1AA 4ZH4F 3NQOA 5CVVA 5EEGA 1A31A 3L7WA 3ZMDA 1OLTA 1R1UA 1MNMC 2QVOA 5K7FA 5JVGF 1QBJA 3KZZA 2IS1A 1X3ZB 3E0JB 3PFYA 4HQMA 2HPIA 4YIIA 2IA0A 2L54A 1WRJA 3KP2A 2PMUA 3FZVA 1YYVA 4NQWB 5H6QA 1X19A 3JW4A 3PJRA 1Z7UA 2Y2ZA 1QVUA 3N05A 3U2RA 2X0LA 2VJ4A 2VE9A 1NK3P 3I4MJ 4CH7A 3P9CA 3BOQA 4AU7A 4ON0A 2CQQA 3D5SC 2AQFA 1RPWA 2BW3A 2OAZA 1X3WB 1ZREA 3E3VA 2Z9OA 1IG7A 5LFAA 5EGOB 1YTYA 1YG2A 1TZLA 3RZOJ 1PYVA 3CP8A 1IXSB 3SXYA 2D1HA 1K7AA 5BS6A 1X4PA 3TMOA 4CYDA 2JQNA 1VTNC 3CC7I 1I3AA 4A3CJ 1FIAA 2XASA 2KZVA 5AIQA 3ZMSA 4EJUA 2DA6A 1MMGA 2VLAA 1LE8B 2A6HF 3OS0A 2STWA 5CPRB 2ZJRF 4BQQA 4ETSA 4UVCA 1CF7A 3DF8A 1YJWI 3BPXA 2ZMEB 3I71A 4XONA 4I6ZA 3S17J 3BR5A 5GAEJ 2A6TA 4XRMA 1XG1A 4DYCA 5LHGA 3S3NA 3A0BC 3K7AJ 3QPSA 4GRIA 3VWBA 1QNTA 2FD5A 4MQVA 3FXQA 3VFZA 3HYIA 3VODA 1XGMA 3TW6A 4XLPF 1UCRA 4CCLA 3K70C 3T8RA 1DU6A 2EB7A 3BR1A 1ZYRF 3KEYA 2F5VA 4AIJA 3I0TA 4HX4A 4FE4A 1BA5A 5GADJ 4XICA 1PUEE 4BHBA 2E7WA 2HTJA 4AM3A 4ZDOA 4RAYA 1KONA 2HW2A 2XF5A 4IHVA 2LKPA 1G3YA 1BL0A 1ORKA 3RQ4A 1TNTA 2MSYA 3PM1A 2E1CA 2K86A 2ME0A 1GVJA 3CCLI 1QA6A 2NRAC 3C18A 2Q2EA 4LLGF 4I0BA 3CJNA 1IN6A 5HS8A 1LDJA 2QCOA 2LKSA 3BG9A 3KX2A 1IDYA 5B1BH 2EQRA 4M9SA 3JTHA 4L0YB 4PSWA 2EK5A 2BGCA 3ZRGA 4BXFA 3ABUA 3LNQA 1F5TA 2LTPA 2O3FA 1FOXA 2DT6A 3W2VA 1JUSA 2ZXWH 2KRHA 5IT3A 2ISZA 2HZTA 2KMUA 3FHNA 2QENA 4L5IA 1O3TA 4M6VA 1TW3A 1SC7A 2KJCA 2X48A 2E71A 1B9NA 3WTWC 1R49A 1JUPA 2TRTA 2MD5A 2PMZA 3ZQQA 1UHWA 2HVRA 2DYSH 5CLSA 3LSPA 2OC6A 4XORA 5F27A 1FIPA 3S3MA 4YIFA 4CA0A 2LF7A 3K4MA 1U5TC 2BOLA 4XRSA 1B9MA 3HGGA 1OJLA 1RI7A 2MG4A 3C2HA 2P6TA 3F8CA 4P9UA 2VOPA 1SFXA 4E7ZA 1J2XA 2B7EA 2DXIA 1A5JA 3LFKA 2W84A 3ULQB 1RC9A 3BTLA 3BDDA 4DOZA 3DWLE 3G3ZA 2K9NA 3MMYB 2P7VB 3HRTA 3R0JA 1VQ7I 3FWEA 1ZRCA 3G6EI 4X1EA 3COAC 3KEOA 2FNAA 4ZYGA 1KQ8A 2P5LC 2B9SA 1GLNA 3H35A 3K4CA 5DD4A 4AD9A 4Y3OA 4BE0A 3I4NJ 4E7KA 1K78B 1BJAA 4O6JA 3AL0C 3O8HA 5FLXZ 2KZGA 3HDDA 1OFCX 9ANTA 5A2QK 1Y39A 1VQ5I 3W2AA 4XSXF 4GCVA 4P1WA 1WKMA 3ZR8X 4A0YA 4KDPA 4CO8A 1MIJA 3D5RC 1D0ZA 1BI1A 2J5OA 1W1WE 1MJBA 2P0WA 1ERDA 2CG4A 4PUSA 2WB1A 1EKEA 2L9VA 3ZMUA 3OYIA 2HKOA 2Y0SA 5C3EJ 4J00A 4EATA 4UXNA 4U0VA 4PJMA 2F48A 2XHKA 2HVSA 4HG2A 3WTSC 3IH3A 3FHZA 3K4BA 1UELB 3OOUA 2V4JC 3V8KA 3TEDA 2EIMH 1MMSA 4FX4A 1R4NB 4KIFA 4XRFA 5KNLA 2CV0A 4AUXA 3OL4A 4M3FA 4Q47A 3G73A 2LREA 3K6GA 2FNPA 1T0FC 3W6JB 3CCQI 2R7TA 1X1PA 4PCQA 2CO5A 4EMSA 2LBFA 3ONQA 1SFUA 2M4KA 1Y1WJ 1KU7A 3F6OA 1T33A 2RREA 2XAUA 3A02A 2W00A 2WTEA 2EINH 4OINF 2DPUA 3LSRA 1ETKA 3ECOA 4N9IA 5EEHA 2DMPA 2DA7A 1JJ6C 4JX4A 2DFFA 4EJTA 3FK7A 4I7HA 4II2A 1KZHA 1XN7A 2DK8A 1PUFA 1HF0A 4WXCA 2GOXB 4LG3A 1I3QJ 1IV8A 2XRLA 4LB6B 3CJRB 4PJNA 3HC7A 4BL0B 2NOGA 3FISA 2FBIA 5D6FA 2XC7A 3ABKH 2ETHA 5HS7A 1HKTA 3GFIA 3M7GA 1SFKA 2LC2A 1WJAA 3QYEA 2DMNA 2IGMA 2CWEA 3M1EA 2QA4I 2DN0A 3MZHA 3JRDA 3A01A 3J7AO 2HQAA 1HW5A 2EILH 4Y15A 1MSEC 3O3KA 2YUSA 2V1UA 2XF7A 2V6CA 3E6MA 1HXDA 3CUOA 5GP9A 1ZQ3P 1LFBA 1JKOC 2Y69H 1QPMA 2KQRA 3BLYA 1C0WA 4L5JA 5IYCJ 2K02A 3JRBA 4XN0A 2WADA 4QPOA 3FXJA 2IP2A 4N9HA 5CQEA 4B43A 5J8FA 2VONA 4IHXA 2VODA 4LG0A 4NQWA 2PJRB 1B1BA 2ID3A 4QIWN 1R1TA 3BPVA 2DBBA 4GYGA 3MKLA 4MTDA 2IVMA 5CVIA 2DW4A 3G1MA 1GHCA 5HNHA 2R7WA 1K6YA 2HQNA 4HV5A 1WH7A 2IS4A 1MBGA 3QU3A 2W7NA 3QPTA 3V42A 2EJRA 2RKHA 3V7SA 1R00A 2GA1A 4A3LJ 2PX9A 5KK1A 1W7PD 4B09A 4BYYA 2JVHA 4ZYHA 1O57A 2MLKA 5EGOA 4MEYF 5K7HA 4A3GJ 4I09A 4I99C 3TDUC 1ZRDA 4DZPA 4ZJZA 2OZUA 3VYRB 1Z7LA 3T5XA 1W7PA 2RDPA 3TBIA 1TQMA 4OIQF 3PFIA 2RGVA 5HLHA 5ILVA 4YFKF 1EF4A 2H6CA 2AXTC 2FBKA 5B5EC 2E5ZA 2JZYA 1F36A 1OYYA 1OCOH 3GBGA 3SZGA 4BY1J 4LGWA 1LB2A 5DCFA 1T2KA 2L7MP 1HSJA 4XL9A 3ELKA 1YX5A 4D1QA 5IT9K 1IRZA 1U3EM 2H8RA 2RV8A 2KJBA 2CQXA 5LEKA 2E36A 1BBYA 4ZTJA 2PMZN 3QODA 4EQQA 4HLXA 4MGRA 3R61A 1PJRA 2MYSA 3KP6A 3SDBA 4AVZA 1G59A 3EDPA 2NXNB 4O3MA 2K9QA 1W0UA 2NVUB 1ZGJA 2GLOA 1JI8A 3CDLA 1O3RA 4NC8A 2DO7A 3F22A 4H4KC 5BOXA 3TDZC 2WBMA 3ROUA 1SD7A 4G7ZF 3FXMA 1F43A 1XSXA 3OY9A 2A5WA 3TQNA 3WTUC 3DLAA 3DKWA 4O5VA 1D1CA 1R4MB 4I02A 4IZZA 3A0HC 4M71A 5CVRA 1D1AA 4M3GA 1HA8A 3DKYA 3G71I 1S7AA 2PLYA 4B1RA 4EJWA 2BY1A 3M8JA 2JVGA 2A68F 3H9GA 1JTYA 4D7NA 2HVQA 3RKXA 3BR0A 2IRFG 3CO7C 4G6TB 1ZLJA 3MVPA 5JHFA 4BBRJ 3A4CA 1IC8A 4RAFA 1ZLKA 2DTZA 1BW5A 3FBNB 2FJ1A 4A3IJ 2HTSA 3GMEA 3MKYB 2JA7J 2L9SA 2ZO4A 3RKQA 3WTVC 4A3DJ 2FQ4A 4U7DA 3EPZA 1XPXA 2E2IJ 4BQAA 3ZXSA 3CMAI 4WWCA 3OYGA 2RN7A 1FPQA 2QWWA 3Q9SA 1K61A 1H0MA 2XAFA 3KFWX 1MBKA 2JPCA 3P9KA 4UVAA 4E7SA 1IF1A 1VQMI 2WV1A 4U0WA 2HEOA 2O9LA 4CCKA 1RIOH 1HBXG 1MJAA 3J81K 2HZDA 2Y0SN 5E1ZB 3CCMI 3G4SI 1XX5A 5GAGJ 1VQNI 2GIVA 2QSHX 2XGDA 2E60A 2HWVA 2COBA 3EUKL 1TW2A 5C44J 1HKQA 4RGXA 1ZELA 5JR3A 3VYUB 3REOA 3EYIA 2COMA 2K3FA 4HA8A 2OTJI 1JGGA 1ZN2A 2ZXHA 2M7AA 5J4YA 1XMXA 1YI2I 4XOTA 5L3EA 2M30A 2D45A 1WI9A 1YJNI 5F1RA 2NYXA 5CQGA 5H20A 4D5FA 3GW2A 1Y8RB 4L9VA 1REPC 4CUGA 2NVQJ 2H1KA 4KNYA 4IOAF 3OYNA 3JRCA 1YS6A 5E8IA 1VNDA 3QYFA 3S2HJ 3E5QA 2P5KA 2P4WA 3GEZA 1E3HA 1FJLA 2P8TA 1I6HJ 3R6SA 4HV6A 5FD6A 2R7UA 4AVPA 1UG0A 5FO5A 3D5LA 4D5CA 1RR7A 4Q5SF 2A61A 4LB5A 1K78A 5E3OA 4BNCA 3K2ZA 1FT9A 5LGUA 3DPUA 2WAFA 3EUAA 1MBHA 2P7CB 4UUVA 1YE9A 5ICCA 3OYKA 2IGNA 3CLQA 1LDKB 1LQ1A 3HTSB 1ETVA 2M1BA 2PFBA 4IQJA 4BJTA 2V79A 1I50J 1V4RA 3SDGA 2CJJA 1KU2A 3IV5A 1LEBA 1YIOA 3B6AA 2M0MA 4MHGA 3H9JA 5B1AH 3FIWA 5FROA 1P6RA 1YFHA 3PNYA 5D8LB 4ZYEA 3MFKA 4DYRA 4BH9A 4HAMA 1X1BA 2EFNA 2MBFA 2BEOA 1LEAA 1WPKA 5K5OA 1SVMA 1AHDP 4IOCF 4M6YA 5ERIA 1YW7A 5IOZA 4JP0A 5F0CA 2XB0X 3RPUD 4HQEA 3W6VA 2WV0A 3LSKA 4IRIA 1A6QA 3BZ6A 5IYDJ 1IXRC 3BT9A 4ESJA 4BAYA 3BR3A 4HNTA 5LHHA 2GZWA 4U7BA 3J81Z 3HXLA 2V6EA 1HQCA 5L3CA 1Z1DA 2DTRA 2DYRH 2DT5A 3I59A 2BHZA 3KIOA 5D5WB 1HOMA 1SAUA 3IRQA 2XB5A 2N8GA 4XKCA 4IJAA 2R7DA 5LHIA 1W36D 3KLOA 4FISA 2V1NA 4HOBA 2R7VA 1ZG1A 3O6BB 2JT1A 3V7CA 3FMRA 1JKPC 2XPVA 3HM5A 3S1RJ 5D5VB 3K0LA 4AC0A 2JTVA 3CF5F 2O0QA 1PUFB 3OV8A 1TWAJ 4NNJA 4XMYA 4A0XA 3HKZA 1WQ2A 3M8FA 3M1CA 4MIMA 3A03A 3CC4I 2X6OA 4HF2A 3NWSA 1SD5A 3HPGA 2OPTA 3L2RA 2VKHA 4PFOA 4M3DA 5JFRA 3JSOA 5D4RA 1ETQA 1PP8F 3KYCB 2HOAA 3VB2A 2YU3A 2DMTA 3SEZA 2E2HJ 3M4OJ 4XLHA 1D0YA 2F5FA 3GZ5A 3SQNA 1KU9A 1HCRA 5LLQA 2HYFA 2QLZA 3G1LA 4A3MJ 4UNOA 3ABMH 4C3IJ 2BXZA 2Y0MA 1LPQA 3PQKA 2AXLA 2W85A 4KMUX 3V8JA 1ZH5A 2O03A 5E1WA 1VQKI 2R3SA 1UMQA 2A3SA 2PJRA 2EZLA 5B66C 4LK0F 3DTEA 5F0FA 4JK1X 3OL3A 4GGGA 4KFCA 4LG0B 4RAGA 3S1MJ 1TTYA 2JSPA 1ZR4A 3I9V2 1BR1A 2OV7A 2VKEA 2IPQX 3A1YA 4UVBA 4P55A 2W24A 3GWZA 3NEUA 4C2UA 2R7SA 4BKXA 3HGYA 3MD2A 1B8IA 3LA7A 3WG7H 2GIZA 2LYCA 4YFNF 1Z91A 3GYHX 1QQIA 5K5QA 2IA1A 5GPCA 1ETXA 2YPRA 1X4OA 2LKXA 2ELKA 3D1NI 3S15J 3J7YJ 5F08A 1MW7A 1W7PB 5J1UA 1QVTA 3WU1B 2FXAA 1NG7A 3EETA 1FBSA 2LH9A 4CDGA 3RDIA 1S72I 1HW2A 4MFEA 1WGXA 4L5EA 1R23A 1IRGA 1D8KA 5HLGA 3KP5A 4U0YA 5E8GA 1W5SA 3KP7A 3F72A 4TV7A 1TT0A 1XD7A 1WI3A 3Q9VA 4IHWA 3HZJA 2IGOA 3W2WA 4B44A 1ZG5A 3HB9A 2DOEA 4Q4ZF 1MBFA 4JX5A 4KN7X 1D8JA 3K2AA 2VPLA 2OQGA 3W6KB 2JPBA 1M1EB 3JRHA 1G3SA 3BROA 4HDVA 1D0XA 1LNWA 2MH9A 3HHHA 1P9QC 3HOWJ 1BIBA 3H5AA 3DXJF 2L7ZA 4IF4A 2VJIA 1B4AA 2R5YB 2STTA 2MLGA 3S2DJ 2H1LA 1YLFA 1VQ4I 3SZTA 5HDNA 4EVIA 4RGRA 5HDGA 2OQRA 4EM1A 3TGNA 1Q1HA 4EJOA 1U8RA 3UKGA 4C3HJ 5FKLA 1QZEA 5GAHJ 3L1PA 4C30A 4G6DA 4P5OA 4C2MJ 5FKKA 4CHUA 1J5YA 2X9DA 1D5VA 1QHHD 1NH3A 4M9ZA 5FLXK 4XNFA 2HQ5A 1KQ9A 5IY5H 4BJ5C 4BY7J 1WCMJ 3WODF 3PIPF 3CCRI 4RGSA 2H6BA 2ME6A 1IN7A 3K4LA 2X6YA 3DBLB 3PIOF 4NUBA 3OR1C 4XBFA 4JOMA 4EM0B 2BYVE 1RKWA 2M34A 1D1BA 4LK1F 2UV1A 5EG0B 1MNDA 5JHUA 1P7JA 1H8AC 4J19A 1I6XA 3BTCA 4N4OB 4ASNA 5K5RA 1FTTA 3WTYC 2AUAA 1IN5A 1GDTA 1TWCJ 3I53A 4BGDA 2P6SA 2FBHA 2YX7A 3I54A 4GXOA 5K7ZA 3CLOA 2NVYJ 4RM3A 3SEQA 1R1VA 4XM3A 4IQ4A 2YX4A 4XOPA 2QKMB 3ZQ7A 2WWYA 2UUZA 3VSLA 1RUNA 2RQQA 3E97A 4ZTFA 1RUOA 2VQCA 2R7RA 1A36A 1MD0A 5J47A 2K85A 2DFHA 4N0BA 3TW7A 1BR2A 2LMDA 2V26A 1MGTA 3GTGJ 4RMNA 2CQNA 1E17A 1TWHJ 2DFIA 2F4MB 5HDKA 3I55I 1KYZA 1R6RA 2QQ9A 4E4HA 2NS0A 5KCMA 3QAHA 2L7KA 4A6DA 2LY9A 3ZCOA 2KRCA 2JK3A 2F5EA 1BIAA 1RRJA 2GAUA 4BE1A 5M5YJ 3RTRA 4PJJA 2ZXJA 4JQFA 3DTKA 1IRFA 1XTAA 5KVRA 1VQPI 1W5CC 1BN5A 2JA8J 3R4KA 1B59A 2R93J 1Y0NA 3LSMA 1UHSA 2LF8A 4OOIA 4LITA 4MQ9F 1Z67A 4D0PA 3PNVA 5CVUA 1FYLA 5TISC 4V19K 2NVTJ 5ICEA 4XLEA 5GTIC 5L3BA 1IZ1A 4B8XA 4ESFA 1OCZH 5E17F 2QSFX 1MMNA 1W4MA 1BI3A 2GXGA 2K4JA 2W82A 2ZMEC 3PSFA 3QP5A 4MNUA 5CVJA 5IOYA 1R22A 2I5UA 4ENKA 3OYJA 1TC3C 5KHDA 5L3DA 1ZHFA 2E5NA 3WTTC 1MH3A 1H9GA 2E7XA 3GVAA 1QZZA 2DCEA 5TGTA 3CDHA 5FFZA 2LNBA 1DGWY 2VL8A 2CW0F 2RNGA 1Z77A 1N77A 3AG3H 4KA4A 1IGNA 3OR2C 2EA4A 2BXYA 3AAFA 2XPWA 1R9TJ 1H9TA 1VZ0A 3OS1A 2Q1ZB 4F3QA 2F5DA 4CCMA 4LIVA 3BG6A 5L3GA 4E70A 1Z0XA 2A5YB 2K9SA 2V9KA 4MTEA 3CCVI 1U0JA 4R79A 1Z6RA 2KIUA 3HOYJ 1HSTA 1SMYF 4AYBA 5FLMJ 4A5MA 1O3SA 4KYWA 3ZQGA 3M3YJ 3V7RA 1DGRM 3BG3A 2K40A 5IP6A 2ISYA 2V1XA 2CV1A 2GXBA 1HLVA 2L9RA 1HW1A 3PO3J 1WVRA 1Z05A 3I59B 2JA2A 4IRHA 3BJAA 1ZGAA 1K6OA 3ZN0A 3QWLA 5F1JA 3F8NA 3ZOBA 1WHUA 2BV6A 3I5UA 2WA0A 3FXRA 4XKVA 1V5EA 4CCNA 2JUGA 3BG7A 1FOWA 2ID6A 2IBDA 2GA2A 2KP6A 3K70D 1UJ8A 5HVQC 2OCCH 4LJZF 2VBXA 5CJ9A 3IH4A 1ZARA 3S1QJ 4C9YA 4DQ2A 1ZGWA 5J4VA 2R4GA 1DPRA 1XSDA 3S32A 1HDDC 4HYEA 5C4JJ 1AKHB 5FKMA 2Z33A 2R7ZJ 2Y75A 1MBJA 2AO9A 1T95A 2CUEA 4M74A 2FF4A 2WC2A 3BWGA 4ZDPA 2QBYB 5H2FC 4IKFA 2JRTA 3KZIC 3WGHA 2UZKA 4RLFA 2DMQA 2Y9YA 3FXUA 3EUHA 3D0SA 3DTIA 3HSRA 4QLCU 1XMKA 2OF7A 4RB0A 2Z3YA 4B3XA 2PQ8A 1ZG3A 2PG4A 1MSFC 2GXAA 4CSWA 1Y1VJ 1J09A 5EZHA 2HXIA 2RNJA 4M6XA 3RQIA 4XLNF 5DEQA 5DM6F 4WXDA 3FXKA 1GV5A 1GUUA 2F2EA 3HOXJ 2LK2A 3WU2C 3F9KA 2KIQA 4EGYA 1S9HA 1FOYA 2M0CA 5AIPA 3WGGA 1QPIA 4I0AA 5BPDA 2ZSHB 2RAEA 4FASD 3LMMA 4OAZA 2Y9ZA 2O8KA 2CW8A 1VI0A 2KL4A 3CMYA 3NWTA 3L00A 4IL6C 1B8IB 3B6CA 4M9XA 1DU0A 2OUMA 1YRNB 3CF2A 2KHMA 3DFGA 3HOUJ 1ULYA 3HRUA 1MDMB 2ZFUA 1VQOI 5F6FA 4RBOA 1W0TA 1IUFA 1UZCA 4HLYA 1WJ5A 2E19A 2VC0A 1DPUA 1JGSA 2VXDA 2LR8A 2DQLA 1IRXA 2AS5F 2KLOA 4CZCA
chains in the Genus database with same CATH topology
2IGNA 1LDKB 4F92B 1WJEA 3CMMA 1X4PA 4IQJA 3TMOA 1FMWA 4BJTA 2JQNA 4DBRA 1Z3XA 3DPLC 2O5RA 3J7AY 2L9NA 2KZVA 2M0MA 4HSRA 4F93B 3H9JA 5FROA 4C2TA 4PSXA 4Y4RA 1MMGA 2VLAA 1EA3A 3PNYA 3OS0A 5CPRB 4BQQA 1X1BA 4XONA 1LKXA 2A6TA 3K4JA 4YRVA 3S3NA 4DJAA 1E0EA 4GRIA 2IXSA 3VWBA 3DQVC 3RPUD 2XDVA 3LSKA 4ANJA 2HU9A 4KISA 2ELJA 2WY8Q 2X51A 4BUPA 4CCLA 4HNTA 3K70C 1Y56A 3KEYA 2M7BA 4U7BA 3HXLA 2V6EA 2F5VA 3HOSA 2WAQA 2CS3A 1SAUA 4ZDOA 1KONA 4XQFA 4OAYA 2HW2A 1BOBA 2XF5A 4XKCA 3KYLA 3OYAA 3S93A 1W36D 3RQ4A 4ZC3A 2V1NA 2CFOA 2R7VA 2CUZA 3OYCA 3CJQB 2O0QA 2XSJC 3S8PA 4BDYA 4BS9A 3E1SA 2IS6A 3HUGB 2CMPA 3LSGA 4NNJA 2LOOA 3KX2A 4XMYA 3HKZA 3K10A 3FKJA 3QYBA 3M1CA 4PK4A 2UWMA 4PSWA 1YX3A 2DT7B 3NWSA 3ZRGA 4ITVA 4BXFA 2HDWA 3HPGA 3L2RA 2VIXA 2VKHA 4PFOA 2DT6A 2FUG2 2M4GA 3W2VA 4XKWA 4BQNA 2KRHA 3K4NA 3VSKA 2KMUA 4E7LA 3FHNA 3SEZA 3IAS2 4XLHA 2E1MC 1D0YA 3RCOA 3OWTA 3I3LA 1Z3YA 3OYKA 2PMZA 3ZQQA 2HVRA 4N4NB 3W3CA 2OC6A 4XORA 2PJRA 3S3MA 4CA0A 4X0GA 1X1DA 2HPMA 4E7IA 3DTEA 5CKTA 3OL3A 3K4MA 2BOLA 5FRNA 4QPQA 2JSPA 3I9V2 1BR1A 3C2HA 2OV7A 4E7ZA 4BQOA 4XLAA 2KPMA 2DXIA 3A1YA 3OIQA 1MNEA 1X1CA 4C2UA 2R7SA 1N75A 3MD2A 4DOZA 3DWLE 5HNFA 2CH0A 4BEHB 2LYCA 3OYBA 3MMYB 1DQUA 4HEA2 4XKBA 1X4OA 3PUBA 3OYMA 4XN3A 3LSIA 1MW7A 3BC8A 3CESA 1GLNA 3H35A 3K4CA 4Y3OA 4BJ6C 1NG7A 2LH9A 4BE0A 2BW3B 4E7KA 3OYHA 3AL0C 2WAEA 2WY7Q 3AKZA 3W2AA 4DBQA 1WFXA 4RM2A 4OWRB 4P1WA 2F6CA 4U87A 3ZR8X 4CCJA 3AFHA 3D5RC 4BACA 1TT0A 1D0ZA 2DOAA 2IGOA 3W2WA 4B44A 2LY1A 2P0WA 1ERDA 4PFPA 3DPTA 4PUSA 2WB1A 3TL4X 2VPLA 4Y33A 1V5FA 4XLFA 1Y6IA 3BCAA 1D0XA 1P9QC 3H5AA 3DEEA 3OYIA 2VJIA 2Y0SA 4II3A 4J00A 4EATA 1QU3A 4PJLA 3A2KA 2R7XA 3HOTA 4LIUA 4PJMA 2IS2A 3IAM2 1MMDA 1W36C 4HG2A 2HVSA 3MKZA 3K4BA 1UELB 3LL7A 3OOUA 4P5OA 3OIPA 2V4JC 4C30A 5KNLA 2CV0A 3OL4A 1QHHD 3H9QA 2LREA 1LVKA 3K6GA 1T0FC 1BR4A 3OYFA 4B47A 2R7TA 1WJBA 4XNFA 2X1EA 3H5RA 2LBFA 3ONQA 4BJ5C 2O0PA 2M4KA 2VJJA 3DU6A 3QOEA 2BVLA 2RREA 2XAUA 4CCOA 2W00A 3CP2A 3K4LA 2X6YA 4NUBA 3OR1C 4JOMA 2XF6A 1D1BA 3H5NA 1Z21A 2UV1A 4FETA 1MNDA 2VQLA 3VYSB 4II2A 3PSIA 1NG6A 4N4OB 4HPQA 2GOXB 4LG3A 2Q2EB 3CJRB 2VXZA 4PJNA 2K3PA 3HC7A 3OYEA 3PL8A 4BL0B 4BGDA 3UNGC 4RM3A 3SEQA 4XR6A 4XM3A 4IQ4A 2XC7A 2K9MA 4XOPA 1QHGA 2QKMB 4DIQA 1SFKA 2LC2A 1WJAA 1WJDA 2UUZA 2LG4A 3QYEA 3VSLA 2IGMA 2RQQA 2L5QA 4ZTFA 5FRMA 1UAAA 2HQAA 2VQCA 3CZ6A 2R7RA 2X1DA 3HL2A 1BR2A 2XF7A 3OYDA 2V26A 4NC7A 2MFZA 2Z16A 4RMNA 3SYTA 4F91B 1R6RA 2KQRA 3BLYA 4E4HA 5KCMA 2ZSIB 2L7KA 4XN0A 2WADA 4QPOA 5CQEA 3ZCOA 2GOMA 2KRCA 4B43A 4BE2A 1LFPA 4BE1A 3DKXA 2X1CA 4HNUA 3OMYA 3RTRA 2PJRB 2VQGA 4PJJA 1N78A 3FDYA 4JQFA 3DTKA 2Z1DA 2KDOA 2X6WA 1DP3A 3FBIB 1FMVA 5HNHA 2R7WA 1WJFA 1K6YA 2F4IA 3LSMA 2R7OA 2IS4A 2W7NA 3V42A 2W4SA 4LITA 4MLOA 1MMAA 3PNVA 3LSHA 1V5GA 2JVHA 2LRDA 4YEJA 4XLEA 1AA7A 4ZJZA 3VYRB 3L2WA 1MMNA 1Z7LA 3PSFA 3TBIA 2W82A 4YELA 3OYJA 4F55A 3HPHA 3OS2A 5KHDA 2E5NA 4ZDLA 2E5ZA 3GBGA 3SZGA 3L2VA 2BVMA 3H0DA 2DCEA 1G8XA 5TGTA 4XL9A 4D1QA 1YX5A 3VYTB 4BU2A 1DGWY 4KITB 2VL8A 2RNGA 1N77A 3OR2C 4ZTJA 3QODA 4E7HA 3MKWB 3L2QA 4F52A 1YE9A 1VZ0A 3OS1A 2Q1ZB 1PJRA 2MYSA 3SDBA 4AVZA 4F3QA 4CCMA 2Z2SB 1G59A 4ZYAA 4LIVA 3BG6A 2I8DA 4E6KG 2VKDA 2CUJA 1WJCA 2V9KA 2DJIA 1U0JA 2M3AA 2VB6A 4R79A 1JI8A 3AL0B 4NC8A 4AYBA 4H4KC 4IX7A 4RLQA 2WBMA 3DU5A 1DGRM 3IP4B 2CV1A 3OY9A 2A5WA 4KT6A 3HG9A 3DLAA 3OYLA 1D1CA 2R7QA 3RSNA 4IZZA 4HSTA 3G2BA 2JA2A 4B48A 3S3OA 1D1AA 1HA8A 3DKYA 2WA0A 4BDZA 4XKVA 1V5EA 4CCNA 2JUGA 3M8JA 3BG7A 2JVGA 3H9GA 2LBFB 3K70D 2KP6A 2HVQA 2V7FA 5HVQC 3C2GA 3EUHC 2IGKA 4G6TB 2VASA 4C9YA 2ZXIA 2X6XA 5JHFA 2R4GA 3A4CA 3S32A 3IUOA 3FBNB 4KJZA 2VJ5A 2LY2A 3MKYB 2HNHA 2L9SA 5HLTA 3ZGKA 4DGWB 2W1OA 1T95A 2K9LA 4ZDPA 3EPZA 2L2OA 3U21A 3ZXSA 4IKFA 3OYGA 3LFUA 3BCBA 4RLFA 3K4KA 3DTIA 4E7SA 2VQHA 2MABA 2QKLB 4CCKA 4B3XA 4CSWA 1J09A 4D9JA 4EYYQ 2HZDA 2NOJB 2CV2A 2MD0A 2MC4A 1X1AA 2E60A 1OLTA 3EUKL 3F9KA 2IS1A 1S9HA 1ZELA 3E0JB 3PFYA 3VDXA 3VYUB 2E1MB 2HPIA 2ZSHB 2ZXHA 3UR3C 2M7AA 4FASD 3LMMA 4OAZA 4XOTA 3L2UA 2K5CA 2CW7A 5CQGA 4BEHA 2CW8A 4NQWB 1X19A 2KL4A 3PJRA 4CUGA 3NWTA 3N05A 3OYNA 2VJ4A 3QYFA 4CH7A 5LD2C 4AU7A 2X85A 3PNTA 2OUMA 3CF2A 2KHMA 2R7UA 4HRIA 3D5SC 1OR7C 1UG0A 2AQFA 3D5LA 2ZFUA 2BW3A 2AQEA 1WJ5A 5LFAA 4E7JA 4J01A 3DPUA 1TZLA 1PYVA 2VXDA 2WAFA 3CP8A 3EUAA 5HOOA 1IRXA 4XLCA 2KLOA 4CZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFX A; 
#chains in the Genus database with same CATH topology
 4F92 B;  2DA2 A;  3GTK J;  1WJE A;  3CMM A;  1FMW A;  2M87 A;  2VKV A;  3KZY A;  4DBR A;  1OR7 A;  1YQA A;  2O5R A;  3J7A Y;  3PUF A;  4HSR A;  1QO0 D;  3RYP A;  2Z5U A;  2CQ7 A;  3JRI A;  1ZR2 A;  1EA3 A;  4G7H F;  2J5P A;  1T8I A;  1FYM A;  2R5Y A;  5DV5 A;  2G9W A;  3C3W A;  2FRH A;  4EJV A;  2FA5 A;  3I64 A;  1YO5 C;  4Y52 J;  2HYJ A;  2YR2 A;  2KFD A;  1RZ4 A;  1LKX A;  2EFW A;  1S3J A;  2O61 A;  2F5C A;  3NAR A;  4YRV A;  1E0E A;  4DJA A;  1SAX A;  1ENH A;  2IXS A;  4AID A;  2OCE A;  1S7O A;  2XDV A;  3GLL A;  5FB2 A;  4ANJ A;  1FWZ A;  1G4D A;  3K1N A;  3GTM J;  3K9T A;  3F6V A;  4KIS A;  1LVA A;  3GUD A;  3QU6 A;  5LRR A;  2DA1 A;  2PEX A;  2NNN A;  3DBR B;  4KT5 C;  2VUM J;  3FM3 A;  2M7B A;  1YW9 A;  1HDP A;  2K7L A;  3HOS A;  1K83 J;  1FBU A;  4CYC B;  4Y13 A;  1EJ9 A;  3IL2 A;  2L3D A;  2WAQ A;  2YSR A;  1X2N A;  1SVL A;  2LVS A;  1JKR C;  1FC3 A;  1FEX A;  2ZC2 A;  3CUQ B;  4BHP A;  4C3J J;  3S93 A;  5EG0 A;  4G9Y A;  4ZC3 A;  2EFQ A;  2CFO A;  3F3X A;  3CCU I;  4G8X A;  3RI4 A;  1EH8 A;  1B72 B;  2B63 J;  2RVC A;  2CUZ A;  2DA4 A;  4ABZ A;  3OYC A;  2OD5 A;  3F8B A;  4G6Q A;  2XSJ C;  5DS9 A;  1ON1 A;  2EV0 A;  2XSD C;  2EWN A;  3LSG A;  2LOO A;  3K69 A;  3QP6 A;  3QYB A;  4PK4 A;  3WU0 A;  3JTG A;  4RB3 C;  2ESN A;  2RC4 A;  2WB1 N;  3GTP J;  2VIX A;  3M9A A;  2JWT A;  2FUG 2;  2L02 A;  2QEX I;  1PP7 U;  5DCM A;  4A2U A;  5FKO A;  4BQN A;  2KIM A;  3JCU C;  2XGX A;  2EZI A;  4E7L A;  3K1M A;  3ERE D;  4ZYD A;  3ECH A;  1JT6 A;  3RCO A;  2Y31 A;  3OWT A;  2H09 A;  3I3L A;  3CCE I;  2HDC A;  4ZZD A;  4N4N B;  5HLI A;  1FP2 A;  1DP7 P;  3W3C A;  1H88 C;  3IC7 A;  5E1X A;  1YOV B;  2JSC A;  5LGN A;  1VQ9 I;  3GZN B;  1R7J A;  1X1D A;  2DDA A;  2QQA A;  2HOE A;  2HPM A;  1GXQ A;  1ZKG A;  4MO7 A;  4NB5 A;  4KMF A;  4QPQ A;  2F4O B;  3IWZ A;  4WCG A;  3HRM A;  2IW5 A;  1VFC A;  4I01 A;  3VOE A;  2KPM A;  4BQO A;  2YU9 J;  1T98 A;  2CSO A;  4CXF A;  2FML A;  4IHY A;  1MNE A;  2HI3 A;  4CZZ A;  1E2X A;  4I2O A;  1ZTR A;  2R7F A;  3ABT A;  2QYO A;  3R0A A;  5HNF A;  4FQG A;  5EJC A;  4PZJ A;  2QZ8 A;  4BEH B;  3IHU A;  5ED4 A;  4RS8 A;  5EEA A;  3GF2 A;  1DQU A;  3M8E A;  3CCJ I;  4XKB A;  2M5W A;  2D2W A;  2P81 A;  2LP0 A;  1IDZ A;  1UST A;  4CIC A;  3PUB A;  1XGN A;  3MEX A;  4MFD A;  2CU7 A;  3H3Z A;  4XN3 A;  2DMU A;  3CES A;  1FNN A;  1IW7 F;  2W57 A;  4YFX F;  3NRV A;  1IO2 A;  1UB9 A;  2LLK A;  2ZJP F;  5LRS A;  3GFM A;  2A07 F;  2KDZ A;  1GV2 A;  2DFE A;  2WAE A;  1BI0 A;  2WY7 Q;  5FGM A;  3AKZ A;  4WF2 A;  1OIS A;  1WFX A;  4NC6 A;  4OWR B;  4WXH A;  4CCJ A;  3ESW B;  4BAC A;  2TDX A;  2DOA A;  2P5V A;  2EIK H;  2HGC A;  4FHT A;  4A6E A;  3H3V K;  1POG A;  3BR2 A;  3V4G A;  4K2E A;  3TO6 A;  4PFP A;  3DPT A;  4UUT A;  2UXX A;  4Y33 A;  5DUK A;  4A93 J;  1V5F A;  4UY8 I;  1Y6I A;  2XGE A;  2HDD A;  2HXO A;  2ECB A;  4II3 A;  1UG2 A;  1FX7 A;  4PJL A;  1QU3 A;  5TRD A;  3A2K A;  1ZK8 A;  2EH3 A;  4B4C A;  3F8M A;  5LEJ A;  4YG2 F;  2IS2 A;  4UB8 C;  3RPU A;  3IWF A;  1IN4 A;  3LL7 A;  3IKT A;  1U9O A;  2CUF A;  4D7M A;  5M5W J;  4LLL A;  4JX6 A;  3OYF A;  5DM7 F;  1WJB A;  3ABL H;  1SMT A;  1RES A;  5E3N A;  1CQT A;  1AU7 A;  5JI6 A;  4QWQ A;  3G1O A;  1RET A;  2M45 A;  2VJJ A;  3GX4 X;  5M3F J;  3QOE A;  3WTX C;  4CCO A;  2K27 A;  3CP2 A;  1XGO A;  1BOA A;  2XKP A;  3FMQ A;  2DAO A;  3LAJ A;  2CYY A;  4R8H A;  1AKH A;  1Z21 A;  1PVE A;  4FET A;  3ZQF A;  4UUS B;  3U1K A;  3CCY A;  3PSI A;  1NG6 A;  4RDU A;  1J9I A;  4HPQ A;  1T08 B;  1V54 H;  4RGU A;  5IYB J;  1O7F A;  1IAW A;  2QBY A;  3AG4 H;  1X3U A;  3OYE A;  3PL8 A;  2KT0 A;  2NS7 A;  2E1O A;  4Y17 A;  2M8E A;  3UNG C;  2JA5 J;  1I39 A;  1Q1V A;  1LUJ B;  3BY6 A;  2GWR A;  1MH4 A;  2EFP A;  2G7U A;  2MW8 A;  3WTZ A;  4FT8 A;  4DIQ A;  1WJD A;  1S29 A;  1VQ8 I;  4M3B A;  2VE8 A;  5ICG A;  2OU2 A;  1XS9 A;  3FXO A;  3P7N A;  2M8G X;  2X1D A;  4PGG A;  2DPD A;  2X4H A;  1KQ0 A;  4PGH A;  3JSP A;  4MEX F;  3OYD A;  3EYY A;  1VQL I;  2MFZ A;  2Z16 A;  3Q0W A;  3SYT A;  1SD6 A;  4F91 B;  3CQZ J;  1Y0U A;  5J1Y A;  2ZSI B;  1FZP B;  4BE2 A;  1R58 A;  3DKX A;  1TT5 B;  1QZY A;  2X1C A;  3SHF A;  4HNU A;  2IJL A;  3GFL A;  3MN2 A;  3I4P A;  2VQG A;  1N78 A;  2WAQ N;  3FDY A;  3QRF F;  2Z1D A;  3JAM K;  1QGP A;  3JR9 A;  1DP3 A;  1U8B A;  4FE7 A;  1YRN A;  1WJF A;  3H36 A;  1KGS A;  1ON2 A;  1R5H A;  2F4I A;  1Z6T A;  4RAZ A;  3C2B A;  1MDM A;  2QUF A;  1HKS A;  1WSU A;  2W4S A;  4R1H A;  3GTQ J;  2QF7 A;  1XC5 A;  5IP9 J;  2VC1 A;  1V5G A;  2LRD A;  3LSH A;  2R0Q C;  4YEJ A;  1FSE A;  1QRY A;  1SFE A;  2A69 F;  2EV5 A;  2EZK A;  5F0H A;  1AA7 A;  3L2W A;  1R5G A;  1JXS A;  4ENN A;  1U5T B;  1APL C;  3ZMT A;  2L0K A;  4XRS G;  4F55 A;  4QTR A;  4V2G A;  2BY2 A;  2BY3 A;  4L18 B;  3LA2 A;  2OTL I;  4ZDL A;  4A3K J;  3WE3 A;  1YS7 A;  2BVM A;  3TO9 A;  4WX9 A;  1G8X A;  5J1R A;  3BG5 A;  3VYT B;  4AIH A;  3H0G J;  3N97 A;  4BU2 A;  2JN6 A;  2XAH A;  1TWF J;  4KIT B;  4A5N A;  1JE8 A;  1K4T A;  3F0C A;  1U6G A;  4UV9 A;  3ZMZ A;  1FTZ A;  2KRF A;  3WGI A;  1O3Q A;  3BZK A;  3L2Q A;  4F52 A;  1ITY A;  2CGP A;  2QM3 A;  2Z2S B;  1U9N A;  2JUC A;  2I8D A;  2VKD A;  5EF6 A;  3KP4 A;  1WJC A;  2DJI A;  2M3A A;  1RKT A;  2KIS A;  3AL0 B;  3HRS A;  5ILU A;  2E34 A;  4GFB A;  3RKY A;  4IX7 A;  2ZB9 A;  4CYC A;  3DU5 A;  4EV0 A;  3KP3 A;  5DYM A;  4A3B J;  2MH2 A;  5D5U B;  3CUQ A;  1NK2 P;  4L9J A;  5ICF A;  3OYL A;  4Q48 A;  2R5Z B;  1J75 A;  2OZ6 A;  1ZRF A;  5EDN A;  1P4A A;  1P4X A;  3G2B A;  5H6R A;  3PO2 J;  3OOP A;  3S3O A;  2TCT A;  1B72 A;  3N4M A;  2YS9 A;  2B0L A;  1S7E A;  4A3J J;  4OIO F;  1VQ6 I;  3LWF A;  4PJ0 C;  2ECC A;  3BQY A;  3KLN A;  2V7F A;  1E3O C;  3JRG A;  3EUH C;  2FE3 A;  2IGK A;  1WZ2 A;  1R5I D;  3OSG A;  3JAM Z;  2X6X A;  3H1C A;  3QQA A;  3NAU A;  2ZCW A;  4KJZ A;  4BBS J;  1GT0 C;  3GTO J;  2LY2 A;  2HNH A;  5HLT A;  4DGW B;  5J40 A;  3O2P E;  2K9L A;  2L2O A;  1OCT C;  3DLL F;  1KYW A;  2DDB A;  4L9N A;  5D4S A;  3CCS I;  6PAX A;  3LFU A;  4OIR F;  3K4K A;  2VQH A;  5DCM B;  3V8L A;  2MAB A;  2QKL B;  2ZBK A;  3BR6 A;  2LSO A;  1SD4 A;  2BE5 F;  4A0Z A;  1OPC A;  2FU4 A;  4KIC A;  4D9J A;  2VBZ A;  4EYY Q;  3HSE A;  1IV6 A;  4OMY A;  1IJW C;  2NOJ B;  2OBP A;  1EH6 A;  2D5V A;  2MC4 A;  4EM2 A;  2HOS A;  4ZZL A;  3QOP A;  1TWG J;  4GO1 A;  3SZP A;  4IO9 F;  3BTJ A;  2FOK A;  1XCB A;  3AG1 H;  3LQR A;  1XDS A;  3VDX A;  1D5Y A;  4OMZ A;  2E1M B;  1LJ9 A;  1S8N A;  2QSG X;  2E1N A;  3UR3 C;  3T1B A;  3EQL F;  1X2M A;  3GZ6 A;  3L2U A;  2BHY A;  1TQI A;  2K5C A;  2CW7 A;  4BEH A;  5BMZ A;  1FSH A;  4QSH A;  1ETO A;  2VN2 A;  4BXX J;  2DOF A;  1ACI A;  4RB2 C;  2VOO A;  5LD2 C;  2X85 A;  3PNT A;  3KE2 A;  2VBY A;  2XV4 S;  2V9V A;  3FMS A;  3HKZ N;  2QQB A;  4HRI A;  4X6A J;  1FLI A;  1OR7 C;  3OIO A;  1A35 A;  4LD5 A;  1YIT I;  3QPL A;  4HX8 A;  3GFJ A;  3MQ0 A;  1BW6 A;  2AQE A;  4E7J A;  3U1D A;  4J01 A;  3CD6 I;  4A12 A;  3KET A;  3T8T A;  1AWC A;  2HS5 A;  2DI3 A;  5HOO A;  1G6N A;  4XLC A;  5FKN A;  4W1U A;  2EZH A;  1T6S A;  5L3F A;  2HYG D;  3L9F A;  1ONV A;  2KIF A;  4HNV A;  1Z3X A;  4L9T A;  3DPL C;  2L9N A;  4F93 B;  2VT2 A;  2W48 A;  1FYK A;  3OSF A;  5DUI A;  1G3W A;  4C2T A;  4IRG A;  4PSX A;  4Y4R A;  2E35 A;  2EV6 A;  4IPA A;  1JTX A;  2IAI A;  5DTD A;  4XK4 A;  1VF9 A;  2XRN A;  4EGZ A;  1SFO J;  1JT0 A;  2XIG A;  3KCC A;  1G3T A;  5D8K B;  1F4K A;  3K4J A;  2VT3 A;  2PN6 A;  4BHC A;  2FOW A;  1U78 A;  3HOZ J;  1JKQ C;  3IRR A;  5E79 C;  5M5X J;  3DQV C;  1A04 A;  1U2W A;  2VI6 A;  3H3U A;  1O7L A;  3RIR A;  3ZMV A;  2AHQ A;  2ESH A;  1TQP A;  1SVO A;  2HU9 A;  2ELJ A;  3HTU A;  1V55 H;  5IPA A;  4Z6Y A;  2WY8 Q;  3J7Z I;  3JRE A;  2X51 A;  3LQQ A;  4BUP A;  4NDL A;  3MWM A;  3DV8 A;  4HDU A;  1Y56 A;  5F04 A;  1ODD A;  3I58 A;  4JBA A;  3ISP A;  3Q0U A;  4HF1 A;  4DW6 A;  2CS3 A;  2G0E A;  5J6X A;  1YW8 A;  3E6C C;  1G2H A;  5B3S H;  2XRO A;  4CGZ A;  4DNC A;  2H94 A;  4XQF A;  3LSJ A;  4OAY A;  1BOB A;  5E18 F;  1R71 A;  3KYL A;  2HOT A;  3OYA A;  1KU3 A;  4WK8 F;  2ZJQ F;  3HIF A;  4UUS A;  5C4X J;  4LOC A;  3WHB A;  3F23 A;  5K1Y A;  1OCP A;  2Y30 A;  3HJE A;  3J80 K;  2A6E F;  2PBI A;  3CJQ B;  3CME I;  3S8P A;  5EYR A;  3HEF A;  2L4M A;  4BDY A;  1JJ8 C;  4BS9 A;  2DQR A;  3ZN1 A;  3E1S A;  2IS6 A;  5BQT A;  3ZP5 A;  2XVC A;  3HUG B;  1IXC A;  2CMP A;  1OYW A;  4KIB A;  5D5X B;  3K10 A;  3FKJ A;  2BY0 A;  3BJO A;  1BC7 C;  2UWM A;  3O8G A;  1YX3 A;  1UFM A;  2DT7 B;  3KPH A;  3R60 A;  3AG2 H;  4UHT A;  4ITV A;  5D6E A;  1JHF A;  4G7O F;  2BZT A;  2HDW A;  1L3L A;  2JMW A;  3E5U A;  3CDI A;  3M07 A;  1R36 A;  5LBQ A;  4HBL A;  4U88 A;  2M4G A;  4H0E A;  1YHQ I;  1B6A A;  2DOD A;  1P2F A;  2KKO A;  4XKW A;  3K4N A;  3VSK A;  2W25 A;  3IAS 2;  3K1P A;  1EV7 A;  2E1M C;  1PDN C;  1T56 A;  2XUB A;  2O8X A;  2I10 A;  2V9P A;  4KUM A;  3DP7 A;  3GLX A;  3SJM A;  1Z3Y A;  3GCM A;  1OQY A;  1MJ9 A;  1OCR H;  1V3F A;  3GO5 A;  2QGU A;  2DA5 A;  4NBQ A;  2EA2 A;  3WE2 A;  1TP4 A;  5KAI C;  3LOC A;  4S0H B;  3RPQ A;  1F1Z A;  5TJJ A;  4X0G A;  3B02 A;  1T39 A;  4E7I A;  1JHH A;  2K4B A;  5CKT A;  5HS9 A;  5A2Q Z;  2FX0 A;  3ASO H;  1YJ9 I;  2XGC A;  5BNG A;  5FRN A;  1UHM A;  3F21 A;  4HZF A;  3RKW A;  2MGQ A;  1YIJ I;  3T0Y A;  4I98 B;  4XLA A;  1Y8Q B;  1CGP A;  3OIQ A;  2PJP A;  3LA3 A;  1IUY A;  1X1C A;  1ETY A;  1K79 A;  2MA3 A;  1N75 A;  4Y7N J;  3HHG A;  4AIK A;  2CH0 A;  2LD5 A;  4IVN A;  3OYB A;  1BC8 C;  2R92 J;  4HEA 2;  1U5T A;  3BJ6 A;  4IHS A;  4I76 A;  3DEU A;  2XKO A;  3OYM A;  2M2E A;  2L7F P;  3LSI A;  2ZNZ A;  3GTL J;  4JYK A;  2FQ3 A;  4HW0 A;  2GQQ A;  3BC8 A;  1JUM A;  1SAN A;  2ZFW A;  1AOY A;  3TKY A;  5FFX A;  4BJ6 C;  5JLW A;  2QQ8 A;  2MC3 A;  2L01 A;  2JQ7 A;  2EIJ H;  4S04 A;  2NNY A;  2BW3 B;  3RZD J;  2O7O A;  3Q3S A;  3HOV J;  3OYH A;  1LDD A;  3JRF A;  1EH7 A;  2ZNY A;  1STZ A;  4FX0 A;  3ZQI A;  4DBQ A;  4RM2 A;  2F6C A;  4U87 A;  4A69 C;  2CFX A;  3AFH A;  3HBL A;  4Z2Y A;  3MZ8 A;  3J80 Z;  1MBE A;  3IKV A;  1GVD A;  2UXN A;  1P92 A;  3RJP A;  1LE8 A;  3S2W A;  2LY1 A;  2EFO A;  1RNL A;  3B73 A;  4IXA A;  3TL4 X;  1RR8 C;  4LFU A;  1TBX A;  1SEU A;  2OA4 A;  2ZME A;  1FOK A;  4XLF A;  3CO6 C;  3BCA A;  2EBI A;  3DEE A;  3LST A;  4P96 A;  5GPA A;  3BZC A;  4KIG A;  1CF7 B;  2DJN A;  3CJT B;  1OCC H;  3TOA A;  3SFZ A;  2R7X A;  2CRG A;  3HOT A;  2ZJ2 A;  4LIU A;  4DZJ A;  3ZQL A;  2C6Y A;  3IAM 2;  1MMD A;  1W36 C;  3MZY A;  2R5Z A;  1J7K A;  3MKZ A;  3OIP A;  4YIR X;  3S16 J;  2DA3 A;  3ML6 A;  2CQK A;  3H9Q A;  1Z9C A;  1LVK A;  1NTC A;  4OIP F;  1BR4 A;  3C1D A;  4B47 A;  3ZQH A;  2XAQ A;  2X1E A;  1TLH B;  2ZKZ A;  3H5R A;  4GYI A;  4UV8 A;  3TP3 A;  4EEF G;  2Q8K A;  2O0P A;  3I56 I;  3C7J A;  3DU6 A;  2BVL A;  5EZG A;  3TOB A;  2M9H A;  3F8F A;  3S14 J;  5E3M A;  2VPR A;  2XF6 A;  3U9G A;  4XID A;  4M3E A;  3H5N A;  4GDF A;  2VQL A;  3VYS B;  3S1N J;  1USS A;  2NAZ A;  4RA2 A;  5GTH C;  1T0F A;  4KN4 X;  3GXO A;  2JRM A;  3QPH A;  2Q2E B;  2VXZ A;  2K3P A;  1J0R A;  1W5T A;  1J59 A;  1BM9 A;  4LLN A;  5FD5 A;  1KA8 A;  1I1G A;  4XR6 A;  1NHA A;  2Q0O A;  2FEZ A;  1H89 C;  2K9M A;  1O4X A;  1QHG A;  2XPU A;  4A3E J;  4P9F A;  2RQP A;  3IH2 A;  3VEP A;  3E6B A;  4LMY A;  2LG4 A;  2Y48 A;  2XAG A;  2JA6 J;  2L5Q A;  5FRM A;  4IHT A;  1UAA A;  2JJ7 A;  3CZ6 A;  3VPR A;  4L0Z B;  3HL2 A;  3SFI A;  2NVX J;  3MCZ A;  4AYB N;  4XSZ F;  2ADU A;  2XAJ A;  5KAF C;  4NC7 A;  2Z99 A;  1OKR A;  1WH5 A;  3P9I A;  1GXP A;  2H8W A;  3DCF A;  2GOM A;  1I1S A;  2NS8 A;  1LFP A;  2VBW A;  5FJ8 J;  2HFH A;  1N25 A;  4HF0 A;  2ACJ A;  1MKM A;  1XB4 A;  3OMY A;  5IT9 Z;  5LGT A;  1I5Z A;  2BBY A;  1XMA A;  2E2J J;  2LFB A;  2H27 A;  3CTA A;  2KDO A;  1I27 A;  1OMI A;  2X6W A;  5J3L A;  2DU9 A;  4FTH A;  3FBI B;  1FMV A;  3BQZ A;  3WHC A;  3KYD B;  2R7O A;  3BP8 A;  1P4W A;  4G94 A;  5DDG A;  4MLO A;  4DYQ A;  3X2Q H;  1MMA A;  1S5L C;  4B3A A;  3RYR A;  3E6D A;  1E3P A;  1MZB A;  1LFU P;  4A3F J;  4S05 A;  4IEJ A;  4RB1 A;  2LDU A;  1XDU A;  3E7L A;  4YEL A;  2EPF A;  2O0Y A;  3HPH A;  3ZQC A;  3KEQ A;  3OS2 A;  2IT0 A;  1OYI A;  3E5X A;  1BI2 A;  1L0O C;  3JRA A;  2FMY A;  5AON A;  5BPI A;  3FXL A;  4G12 A;  3L2V A;  2OJE D;  3H0D A;  1IN8 A;  2A05 A;  2ICW G;  2HR3 A;  4UB6 C;  3ERM A;  3L2C A;  3TP0 A;  3FF5 A;  3Q5F A;  2GBY A;  4M73 A;  4M72 A;  1D3Y A;  2IA2 A;  3Q0V A;  4BXU A;  4ESB A;  4E7H A;  3MKW B;  2PMH A;  3CUQ C;  3P5J A;  2PI0 A;  1XCV A;  3PQJ A;  4ZYA A;  4E6K G;  4HX7 A;  3GTJ J;  3ASN H;  5F64 A;  2CUJ A;  1HC8 A;  1S6L A;  2VB6 A;  4ENJ A;  1ZAO A;  1A6I A;  5HOD A;  1FY7 A;  2ELH A;  5DD8 A;  1ETW A;  4RLQ A;  3WG9 A;  2L4A A;  3IP4 B;  4KT6 A;  5E20 A;  3HG9 A;  3HSF A;  2R7Q A;  3RSN A;  4ENM A;  3FKI J;  4HST A;  4OU0 A;  4B48 A;  3CC2 I;  3LAP A;  1DDN A;  5JLX A;  1WWX A;  1FBQ A;  1XGS A;  4BDZ A;  3FM5 A;  5IP7 J;  1FP1 D;  4F7Z A;  3DEW A;  3DBH B;  5M3M J;  1P7I A;  2LBF B;  2HKX A;  2D1V A;  4V2F A;  3FK6 A;  3HUG A;  5J8C A;  1T38 A;  3C2G A;  3H92 A;  2IEK A;  2VAS A;  4FCY A;  2ZXI A;  2DK5 A;  4W97 A;  1X58 A;  1BJZ A;  3IUO A;  2GM4 A;  2FSW A;  1DUX C;  2VJ5 A;  2HQR A;  1K4S A;  1F9N A;  2V1D A;  3BTI A;  3ZGK A;  2W1O A;  5E3L A;  5CYV A;  3L09 A;  3MAJ A;  3U21 A;  3BCB A;  3FX3 A;  2DLL A;  1TNS A;  5FLV A;  3TO7 A;  4NHJ A;  5JVT A;  3ZPL A;  4PDK A;  2O6G E;  1XSV A;  2CV2 A;  4AWX B;  2MD0 A;  3A01 B;  1TL8 A;  2G7H A;  5ILS A;  1X1A A;  4ZH4 F;  3NQO A;  5CVV A;  5EEG A;  1A31 A;  3L7W A;  3ZMD A;  1OLT A;  1R1U A;  1MNM C;  2QVO A;  5K7F A;  5JVG F;  1QBJ A;  3KZZ A;  2IS1 A;  1X3Z B;  3E0J B;  3PFY A;  4HQM A;  2HPI A;  4YII A;  2IA0 A;  2L54 A;  1WRJ A;  3KP2 A;  2PMU A;  3FZV A;  1YYV A;  4NQW B;  5H6Q A;  1X19 A;  3JW4 A;  3PJR A;  1Z7U A;  2Y2Z A;  1QVU A;  3N05 A;  3U2R A;  2X0L A;  2VJ4 A;  2VE9 A;  1NK3 P;  3I4M J;  4CH7 A;  3P9C A;  3BOQ A;  4AU7 A;  4ON0 A;  2CQQ A;  3D5S C;  2AQF A;  1RPW A;  2BW3 A;  2OAZ A;  1X3W B;  1ZRE A;  3E3V A;  2Z9O A;  1IG7 A;  5LFA A;  5EGO B;  1YTY A;  1YG2 A;  1TZL A;  3RZO J;  1PYV A;  3CP8 A;  1IXS B;  3SXY A;  2D1H A;  1K7A A;  5BS6 A;  1X4P A;  3TMO A;  4CYD A;  2JQN A;  1VTN C;  3CC7 I;  1I3A A;  4A3C J;  1FIA A;  2XAS A;  2KZV A;  5AIQ A;  3ZMS A;  4EJU A;  2DA6 A;  1MMG A;  2VLA A;  1LE8 B;  2A6H F;  3OS0 A;  2STW A;  5CPR B;  2ZJR F;  4BQQ A;  4ETS A;  4UVC A;  1CF7 A;  3DF8 A;  1YJW I;  3BPX A;  2ZME B;  3I71 A;  4XON A;  4I6Z A;  3S17 J;  3BR5 A;  5GAE J;  2A6T A;  4XRM A;  1XG1 A;  4DYC A;  5LHG A;  3S3N A;  3A0B C;  3K7A J;  3QPS A;  4GRI A;  3VWB A;  1QNT A;  2FD5 A;  4MQV A;  3FXQ A;  3VFZ A;  3HYI A;  3VOD A;  1XGM A;  3TW6 A;  4XLP F;  1UCR A;  4CCL A;  3K70 C;  3T8R A;  1DU6 A;  2EB7 A;  3BR1 A;  1ZYR F;  3KEY A;  2F5V A;  4AIJ A;  3I0T A;  4HX4 A;  4FE4 A;  1BA5 A;  5GAD J;  4XIC A;  1PUE E;  4BHB A;  2E7W A;  2HTJ A;  4AM3 A;  4ZDO A;  4RAY A;  1KON A;  2HW2 A;  2XF5 A;  4IHV A;  2LKP A;  1G3Y A;  1BL0 A;  1ORK A;  3RQ4 A;  1TNT A;  2MSY A;  3PM1 A;  2E1C A;  2K86 A;  2ME0 A;  1GVJ A;  3CCL I;  1QA6 A;  2NRA C;  3C18 A;  2Q2E A;  4LLG F;  4I0B A;  3CJN A;  1IN6 A;  5HS8 A;  1LDJ A;  2QCO A;  2LKS A;  3BG9 A;  3KX2 A;  1IDY A;  5B1B H;  2EQR A;  4M9S A;  3JTH A;  4L0Y B;  4PSW A;  2EK5 A;  2BGC A;  3ZRG A;  4BXF A;  3ABU A;  3LNQ A;  1F5T A;  2LTP A;  2O3F A;  1FOX A;  2DT6 A;  3W2V A;  1JUS A;  2ZXW H;  2KRH A;  5IT3 A;  2ISZ A;  2HZT A;  2KMU A;  3FHN A;  2QEN A;  4L5I A;  1O3T A;  4M6V A;  1TW3 A;  1SC7 A;  2KJC A;  2X48 A;  2E71 A;  1B9N A;  3WTW C;  1R49 A;  1JUP A;  2TRT A;  2MD5 A;  2PMZ A;  3ZQQ A;  1UHW A;  2HVR A;  2DYS H;  5CLS A;  3LSP A;  2OC6 A;  4XOR A;  5F27 A;  1FIP A;  3S3M A;  4YIF A;  4CA0 A;  2LF7 A;  3K4M A;  1U5T C;  2BOL A;  4XRS A;  1B9M A;  3HGG A;  1OJL A;  1RI7 A;  2MG4 A;  3C2H A;  2P6T A;  3F8C A;  4P9U A;  2VOP A;  1SFX A;  4E7Z A;  1J2X A;  2B7E A;  2DXI A;  1A5J A;  3LFK A;  2W84 A;  3ULQ B;  1RC9 A;  3BTL A;  3BDD A;  4DOZ A;  3DWL E;  3G3Z A;  2K9N A;  3MMY B;  2P7V B;  3HRT A;  3R0J A;  1VQ7 I;  3FWE A;  1ZRC A;  3G6E I;  4X1E A;  3COA C;  3KEO A;  2FNA A;  4ZYG A;  1KQ8 A;  2P5L C;  2B9S A;  1GLN A;  3H35 A;  3K4C A;  5DD4 A;  4AD9 A;  4Y3O A;  4BE0 A;  3I4N J;  4E7K A;  1K78 B;  1BJA A;  4O6J A;  3AL0 C;  3O8H A;  5FLX Z;  2KZG A;  3HDD A;  1OFC X;  9ANT A;  5A2Q K;  1Y39 A;  1VQ5 I;  3W2A A;  4XSX F;  4GCV A;  4P1W A;  1WKM A;  3ZR8 X;  4A0Y A;  4KDP A;  4CO8 A;  1MIJ A;  3D5R C;  1D0Z A;  1BI1 A;  2J5O A;  1W1W E;  1MJB A;  2P0W A;  1ERD A;  2CG4 A;  4PUS A;  2WB1 A;  1EKE A;  2L9V A;  3ZMU A;  3OYI A;  2HKO A;  2Y0S A;  5C3E J;  4J00 A;  4EAT A;  4UXN A;  4U0V A;  4PJM A;  2F48 A;  2XHK A;  2HVS A;  4HG2 A;  3WTS C;  3IH3 A;  3FHZ A;  3K4B A;  1UEL B;  3OOU A;  2V4J C;  3V8K A;  3TED A;  2EIM H;  1MMS A;  4FX4 A;  1R4N B;  4KIF A;  4XRF A;  5KNL A;  2CV0 A;  4AUX A;  3OL4 A;  4M3F A;  4Q47 A;  3G73 A;  2LRE A;  3K6G A;  2FNP A;  1T0F C;  3W6J B;  3CCQ I;  2R7T A;  1X1P A;  4PCQ A;  2CO5 A;  4EMS A;  2LBF A;  3ONQ A;  1SFU A;  2M4K A;  1Y1W J;  1KU7 A;  3F6O A;  1T33 A;  2RRE A;  2XAU A;  3A02 A;  2W00 A;  2WTE A;  2EIN H;  4OIN F;  2DPU A;  3LSR A;  1ETK A;  3ECO A;  4N9I A;  5EEH A;  2DMP A;  2DA7 A;  1JJ6 C;  4JX4 A;  2DFF A;  4EJT A;  3FK7 A;  4I7H A;  4II2 A;  1KZH A;  1XN7 A;  2DK8 A;  1PUF A;  1HF0 A;  4WXC A;  2GOX B;  4LG3 A;  1I3Q J;  1IV8 A;  2XRL A;  4LB6 B;  3CJR B;  4PJN A;  3HC7 A;  4BL0 B;  2NOG A;  3FIS A;  2FBI A;  5D6F A;  2XC7 A;  3ABK H;  2ETH A;  5HS7 A;  1HKT A;  3GFI A;  3M7G A;  1SFK A;  2LC2 A;  1WJA A;  3QYE A;  2DMN A;  2IGM A;  2CWE A;  3M1E A;  2QA4 I;  2DN0 A;  3MZH A;  3JRD A;  3A01 A;  3J7A O;  2HQA A;  1HW5 A;  2EIL H;  4Y15 A;  1MSE C;  3O3K A;  2YUS A;  2V1U A;  2XF7 A;  2V6C A;  3E6M A;  1HXD A;  3CUO A;  5GP9 A;  1ZQ3 P;  1LFB A;  1JKO C;  2Y69 H;  1QPM A;  2KQR A;  3BLY A;  1C0W A;  4L5J A;  5IYC J;  2K02 A;  3JRB A;  4XN0 A;  2WAD A;  4QPO A;  3FXJ A;  2IP2 A;  4N9H A;  5CQE A;  4B43 A;  5J8F A;  2VON A;  4IHX A;  2VOD A;  4LG0 A;  4NQW A;  2PJR B;  1B1B A;  2ID3 A;  4QIW N;  1R1T A;  3BPV A;  2DBB A;  4GYG A;  3MKL A;  4MTD A;  2IVM A;  5CVI A;  2DW4 A;  3G1M A;  1GHC A;  5HNH A;  2R7W A;  1K6Y A;  2HQN A;  4HV5 A;  1WH7 A;  2IS4 A;  1MBG A;  3QU3 A;  2W7N A;  3QPT A;  3V42 A;  2EJR A;  2RKH A;  3V7S A;  1R00 A;  2GA1 A;  4A3L J;  2PX9 A;  5KK1 A;  1W7P D;  4B09 A;  4BYY A;  2JVH A;  4ZYH A;  1O57 A;  2MLK A;  5EGO A;  4MEY F;  5K7H A;  4A3G J;  4I09 A;  4I99 C;  3TDU C;  1ZRD A;  4DZP A;  4ZJZ A;  2OZU A;  3VYR B;  1Z7L A;  3T5X A;  1W7P A;  2RDP A;  3TBI A;  1TQM A;  4OIQ F;  3PFI A;  2RGV A;  5HLH A;  5ILV A;  4YFK F;  1EF4 A;  2H6C A;  2AXT C;  2FBK A;  5B5E C;  2E5Z A;  2JZY A;  1F36 A;  1OYY A;  1OCO H;  3GBG A;  3SZG A;  4BY1 J;  4LGW A;  1LB2 A;  5DCF A;  1T2K A;  2L7M P;  1HSJ A;  4XL9 A;  3ELK A;  1YX5 A;  4D1Q A;  5IT9 K;  1IRZ A;  1U3E M;  2H8R A;  2RV8 A;  2KJB A;  2CQX A;  5LEK A;  2E36 A;  1BBY A;  4ZTJ A;  2PMZ N;  3QOD A;  4EQQ A;  4HLX A;  4MGR A;  3R61 A;  1PJR A;  2MYS A;  3KP6 A;  3SDB A;  4AVZ A;  1G59 A;  3EDP A;  2NXN B;  4O3M A;  2K9Q A;  1W0U A;  2NVU B;  1ZGJ A;  2GLO A;  1JI8 A;  3CDL A;  1O3R A;  4NC8 A;  2DO7 A;  3F22 A;  4H4K C;  5BOX A;  3TDZ C;  2WBM A;  3ROU A;  1SD7 A;  4G7Z F;  3FXM A;  1F43 A;  1XSX A;  3OY9 A;  2A5W A;  3TQN A;  3WTU C;  3DLA A;  3DKW A;  4O5V A;  1D1C A;  1R4M B;  4I02 A;  4IZZ A;  3A0H C;  4M71 A;  5CVR A;  1D1A A;  4M3G A;  1HA8 A;  3DKY A;  3G71 I;  1S7A A;  2PLY A;  4B1R A;  4EJW A;  2BY1 A;  3M8J A;  2JVG A;  2A68 F;  3H9G A;  1JTY A;  4D7N A;  2HVQ A;  3RKX A;  3BR0 A;  2IRF G;  3CO7 C;  4G6T B;  1ZLJ A;  3MVP A;  5JHF A;  4BBR J;  3A4C A;  1IC8 A;  4RAF A;  1ZLK A;  2DTZ A;  1BW5 A;  3FBN B;  2FJ1 A;  4A3I J;  2HTS A;  3GME A;  3MKY B;  2JA7 J;  2L9S A;  2ZO4 A;  3RKQ A;  3WTV C;  4A3D J;  2FQ4 A;  4U7D A;  3EPZ A;  1XPX A;  2E2I J;  4BQA A;  3ZXS A;  3CMA I;  4WWC A;  3OYG A;  2RN7 A;  1FPQ A;  2QWW A;  3Q9S A;  1K61 A;  1H0M A;  2XAF A;  3KFW X;  1MBK A;  2JPC A;  3P9K A;  4UVA A;  4E7S A;  1IF1 A;  1VQM I;  2WV1 A;  4U0W A;  2HEO A;  2O9L A;  4CCK A;  1RIO H;  1HBX G;  1MJA A;  3J81 K;  2HZD A;  2Y0S N;  5E1Z B;  3CCM I;  3G4S I;  1XX5 A;  5GAG J;  1VQN I;  2GIV A;  2QSH X;  2XGD A;  2E60 A;  2HWV A;  2COB A;  3EUK L;  1TW2 A;  5C44 J;  1HKQ A;  4RGX A;  1ZEL A;  5JR3 A;  3VYU B;  3REO A;  3EYI A;  2COM A;  2K3F A;  4HA8 A;  2OTJ I;  1JGG A;  1ZN2 A;  2ZXH A;  2M7A A;  5J4Y A;  1XMX A;  1YI2 I;  4XOT A;  5L3E A;  2M30 A;  2D45 A;  1WI9 A;  1YJN I;  5F1R A;  2NYX A;  5CQG A;  5H20 A;  4D5F A;  3GW2 A;  1Y8R B;  4L9V A;  1REP C;  4CUG A;  2NVQ J;  2H1K A;  4KNY A;  4IOA F;  3OYN A;  3JRC A;  1YS6 A;  5E8I A;  1VND A;  3QYF A;  3S2H J;  3E5Q A;  2P5K A;  2P4W A;  3GEZ A;  1E3H A;  1FJL A;  2P8T A;  1I6H J;  3R6S A;  4HV6 A;  5FD6 A;  2R7U A;  4AVP A;  1UG0 A;  5FO5 A;  3D5L A;  4D5C A;  1RR7 A;  4Q5S F;  2A61 A;  4LB5 A;  1K78 A;  5E3O A;  4BNC A;  3K2Z A;  1FT9 A;  5LGU A;  3DPU A;  2WAF A;  3EUA A;  1MBH A;  2P7C B;  4UUV A;  1YE9 A;  5ICC A;  3OYK A;  2IGN A;  3CLQ A;  1LDK B;  1LQ1 A;  3HTS B;  1ETV A;  2M1B A;  2PFB A;  4IQJ A;  4BJT A;  2V79 A;  1I50 J;  1V4R A;  3SDG A;  2CJJ A;  1KU2 A;  3IV5 A;  1LEB A;  1YIO A;  3B6A A;  2M0M A;  4MHG A;  3H9J A;  5B1A H;  3FIW A;  5FRO A;  1P6R A;  1YFH A;  3PNY A;  5D8L B;  4ZYE A;  3MFK A;  4DYR A;  4BH9 A;  4HAM A;  1X1B A;  2EFN A;  2MBF A;  2BEO A;  1LEA A;  1WPK A;  5K5O A;  1SVM A;  1AHD P;  4IOC F;  4M6Y A;  5ERI A;  1YW7 A;  5IOZ A;  4JP0 A;  5F0C A;  2XB0 X;  3RPU D;  4HQE A;  3W6V A;  2WV0 A;  3LSK A;  4IRI A;  1A6Q A;  3BZ6 A;  5IYD J;  1IXR C;  3BT9 A;  4ESJ A;  4BAY A;  3BR3 A;  4HNT A;  5LHH A;  2GZW A;  4U7B A;  3J81 Z;  3HXL A;  2V6E A;  1HQC A;  5L3C A;  1Z1D A;  2DTR A;  2DYR H;  2DT5 A;  3I59 A;  2BHZ A;  3KIO A;  5D5W B;  1HOM A;  1SAU A;  3IRQ A;  2XB5 A;  2N8G A;  4XKC A;  4IJA A;  2R7D A;  5LHI A;  1W36 D;  3KLO A;  4FIS A;  2V1N A;  4HOB A;  2R7V A;  1ZG1 A;  3O6B B;  2JT1 A;  3V7C A;  3FMR A;  1JKP C;  2XPV A;  3HM5 A;  3S1R J;  5D5V B;  3K0L A;  4AC0 A;  2JTV A;  3CF5 F;  2O0Q A;  1PUF B;  3OV8 A;  1TWA J;  4NNJ A;  4XMY A;  4A0X A;  3HKZ A;  1WQ2 A;  3M8F A;  3M1C A;  4MIM A;  3A03 A;  3CC4 I;  2X6O A;  4HF2 A;  3NWS A;  1SD5 A;  3HPG A;  2OPT A;  3L2R A;  2VKH A;  4PFO A;  4M3D A;  5JFR A;  3JSO A;  5D4R A;  1ETQ A;  1PP8 F;  3KYC B;  2HOA A;  3VB2 A;  2YU3 A;  2DMT A;  3SEZ A;  2E2H J;  3M4O J;  4XLH A;  1D0Y A;  2F5F A;  3GZ5 A;  3SQN A;  1KU9 A;  1HCR A;  5LLQ A;  2HYF A;  2QLZ A;  3G1L A;  4A3M J;  4UNO A;  3ABM H;  4C3I J;  2BXZ A;  2Y0M A;  1LPQ A;  3PQK A;  2AXL A;  2W85 A;  4KMU X;  3V8J A;  1ZH5 A;  2O03 A;  5E1W A;  1VQK I;  2R3S A;  1UMQ A;  2A3S A;  2PJR A;  2EZL A;  5B66 C;  4LK0 F;  3DTE A;  5F0F A;  4JK1 X;  3OL3 A;  4GGG A;  4KFC A;  4LG0 B;  4RAG A;  3S1M J;  1TTY A;  2JSP A;  1ZR4 A;  3I9V 2;  1BR1 A;  2OV7 A;  2VKE A;  2IPQ X;  3A1Y A;  4UVB A;  4P55 A;  2W24 A;  3GWZ A;  3NEU A;  4C2U A;  2R7S A;  4BKX A;  3HGY A;  3MD2 A;  1B8I A;  3LA7 A;  3WG7 H;  2GIZ A;  2LYC A;  4YFN F;  1Z91 A;  3GYH X;  1QQI A;  5K5Q A;  2IA1 A;  5GPC A;  1ETX A;  2YPR A;  1X4O A;  2LKX A;  2ELK A;  3D1N I;  3S15 J;  3J7Y J;  5F08 A;  1MW7 A;  1W7P B;  5J1U A;  1QVT A;  3WU1 B;  2FXA A;  1NG7 A;  3EET A;  1FBS A;  2LH9 A;  4CDG A;  3RDI A;  1S72 I;  1HW2 A;  4MFE A;  1WGX A;  4L5E A;  1R23 A;  1IRG A;  1D8K A;  5HLG A;  3KP5 A;  4U0Y A;  5E8G A;  1W5S A;  3KP7 A;  3F72 A;  4TV7 A;  1TT0 A;  1XD7 A;  1WI3 A;  3Q9V A;  4IHW A;  3HZJ A;  2IGO A;  3W2W A;  4B44 A;  1ZG5 A;  3HB9 A;  2DOE A;  4Q4Z F;  1MBF A;  4JX5 A;  4KN7 X;  1D8J A;  3K2A A;  2VPL A;  2OQG A;  3W6K B;  2JPB A;  1M1E B;  3JRH A;  1G3S A;  3BRO A;  4HDV A;  1D0X A;  1LNW A;  2MH9 A;  3HHH A;  1P9Q C;  3HOW J;  1BIB A;  3H5A A;  3DXJ F;  2L7Z A;  4IF4 A;  2VJI A;  1B4A A;  2R5Y B;  2STT A;  2MLG A;  3S2D J;  2H1L A;  1YLF A;  1VQ4 I;  3SZT A;  5HDN A;  4EVI A;  4RGR A;  5HDG A;  2OQR A;  4EM1 A;  3TGN A;  1Q1H A;  4EJO A;  1U8R A;  3UKG A;  4C3H J;  5FKL A;  1QZE A;  5GAH J;  3L1P A;  4C30 A;  4G6D A;  4P5O A;  4C2M J;  5FKK A;  4CHU A;  1J5Y A;  2X9D A;  1D5V A;  1QHH D;  1NH3 A;  4M9Z A;  5FLX K;  4XNF A;  2HQ5 A;  1KQ9 A;  5IY5 H;  4BJ5 C;  4BY7 J;  1WCM J;  3WOD F;  3PIP F;  3CCR I;  4RGS A;  2H6B A;  2ME6 A;  1IN7 A;  3K4L A;  2X6Y A;  3DBL B;  3PIO F;  4NUB A;  3OR1 C;  4XBF A;  4JOM A;  4EM0 B;  2BYV E;  1RKW A;  2M34 A;  1D1B A;  4LK1 F;  2UV1 A;  5EG0 B;  1MND A;  5JHU A;  1P7J A;  1H8A C;  4J19 A;  1I6X A;  3BTC A;  4N4O B;  4ASN A;  5K5R A;  1FTT A;  3WTY C;  2AUA A;  1IN5 A;  1GDT A;  1TWC J;  3I53 A;  4BGD A;  2P6S A;  2FBH A;  2YX7 A;  3I54 A;  4GXO A;  5K7Z A;  3CLO A;  2NVY J;  4RM3 A;  3SEQ A;  1R1V A;  4XM3 A;  4IQ4 A;  2YX4 A;  4XOP A;  2QKM B;  3ZQ7 A;  2WWY A;  2UUZ A;  3VSL A;  1RUN A;  2RQQ A;  3E97 A;  4ZTF A;  1RUO A;  2VQC A;  2R7R A;  1A36 A;  1MD0 A;  5J47 A;  2K85 A;  2DFH A;  4N0B A;  3TW7 A;  1BR2 A;  2LMD A;  2V26 A;  1MGT A;  3GTG J;  4RMN A;  2CQN A;  1E17 A;  1TWH J;  2DFI A;  2F4M B;  5HDK A;  3I55 I;  1KYZ A;  1R6R A;  2QQ9 A;  4E4H A;  2NS0 A;  5KCM A;  3QAH A;  2L7K A;  4A6D A;  2LY9 A;  3ZCO A;  2KRC A;  2JK3 A;  2F5E A;  1BIA A;  1RRJ A;  2GAU A;  4BE1 A;  5M5Y J;  3RTR A;  4PJJ A;  2ZXJ A;  4JQF A;  3DTK A;  1IRF A;  1XTA A;  5KVR A;  1VQP I;  1W5C C;  1BN5 A;  2JA8 J;  3R4K A;  1B59 A;  2R93 J;  1Y0N A;  3LSM A;  1UHS A;  2LF8 A;  4OOI A;  4LIT A;  4MQ9 F;  1Z67 A;  4D0P A;  3PNV A;  5CVU A;  1FYL A;  5TIS C;  4V19 K;  2NVT J;  5ICE A;  4XLE A;  5GTI C;  5L3B A;  1IZ1 A;  4B8X A;  4ESF A;  1OCZ H;  5E17 F;  2QSF X;  1MMN A;  1W4M A;  1BI3 A;  2GXG A;  2K4J A;  2W82 A;  2ZME C;  3PSF A;  3QP5 A;  4MNU A;  5CVJ A;  5IOY A;  1R22 A;  2I5U A;  4ENK A;  3OYJ A;  1TC3 C;  5KHD A;  5L3D A;  1ZHF A;  2E5N A;  3WTT C;  1MH3 A;  1H9G A;  2E7X A;  3GVA A;  1QZZ A;  2DCE A;  5TGT A;  3CDH A;  5FFZ A;  2LNB A;  1DGW Y;  2VL8 A;  2CW0 F;  2RNG A;  1Z77 A;  1N77 A;  3AG3 H;  4KA4 A;  1IGN A;  3OR2 C;  2EA4 A;  2BXY A;  3AAF A;  2XPW A;  1R9T J;  1H9T A;  1VZ0 A;  3OS1 A;  2Q1Z B;  4F3Q A;  2F5D A;  4CCM A;  4LIV A;  3BG6 A;  5L3G A;  4E70 A;  1Z0X A;  2A5Y B;  2K9S A;  2V9K A;  4MTE A;  3CCV I;  1U0J A;  4R79 A;  1Z6R A;  2KIU A;  3HOY J;  1HST A;  1SMY F;  4AYB A;  5FLM J;  4A5M A;  1O3S A;  4KYW A;  3ZQG A;  3M3Y J;  3V7R A;  1DGR M;  3BG3 A;  2K40 A;  5IP6 A;  2ISY A;  2V1X A;  2CV1 A;  2GXB A;  1HLV A;  2L9R A;  1HW1 A;  3PO3 J;  1WVR A;  1Z05 A;  3I59 B;  2JA2 A;  4IRH A;  3BJA A;  1ZGA A;  1K6O A;  3ZN0 A;  3QWL A;  5F1J A;  3F8N A;  3ZOB A;  1WHU A;  2BV6 A;  3I5U A;  2WA0 A;  3FXR A;  4XKV A;  1V5E A;  4CCN A;  2JUG A;  3BG7 A;  1FOW A;  2ID6 A;  2IBD A;  2GA2 A;  2KP6 A;  3K70 D;  1UJ8 A;  5HVQ C;  2OCC H;  4LJZ F;  2VBX A;  5CJ9 A;  3IH4 A;  1ZAR A;  3S1Q J;  4C9Y A;  4DQ2 A;  1ZGW A;  5J4V A;  2R4G A;  1DPR A;  1XSD A;  3S32 A;  1HDD C;  4HYE A;  5C4J J;  1AKH B;  5FKM A;  2Z33 A;  2R7Z J;  2Y75 A;  1MBJ A;  2AO9 A;  1T95 A;  2CUE A;  4M74 A;  2FF4 A;  2WC2 A;  3BWG A;  4ZDP A;  2QBY B;  5H2F C;  4IKF A;  2JRT A;  3KZI C;  3WGH A;  2UZK A;  4RLF A;  2DMQ A;  2Y9Y A;  3FXU A;  3EUH A;  3D0S A;  3DTI A;  3HSR A;  4QLC U;  1XMK A;  2OF7 A;  4RB0 A;  2Z3Y A;  4B3X A;  2PQ8 A;  1ZG3 A;  2PG4 A;  1MSF C;  2GXA A;  4CSW A;  1Y1V J;  1J09 A;  5EZH A;  2HXI A;  2RNJ A;  4M6X A;  3RQI A;  4XLN F;  5DEQ A;  5DM6 F;  4WXD A;  3FXK A;  1GV5 A;  1GUU A;  2F2E A;  3HOX J;  2LK2 A;  3WU2 C;  3F9K A;  2KIQ A;  4EGY A;  1S9H A;  1FOY A;  2M0C A;  5AIP A;  3WGG A;  1QPI A;  4I0A A;  5BPD A;  2ZSH B;  2RAE A;  4FAS D;  3LMM A;  4OAZ A;  2Y9Z A;  2O8K A;  2CW8 A;  1VI0 A;  2KL4 A;  3CMY A;  3NWT A;  3L00 A;  4IL6 C;  1B8I B;  3B6C A;  4M9X A;  1DU0 A;  2OUM A;  1YRN B;  3CF2 A;  2KHM A;  3DFG A;  3HOU J;  1ULY A;  3HRU A;  1MDM B;  2ZFU A;  1VQO I;  5F6F A;  4RBO A;  1W0T A;  1IUF A;  1UZC A;  4HLY A;  1WJ5 A;  2E19 A;  2VC0 A;  1DPU A;  1JGS A;  2VXD A;  2LR8 A;  2DQL A;  1IRX A;  2AS5 F;  2KLO A;  4CZC A; 
#chains in the Genus database with same CATH homology
 2IGN A;  1LDK B;  4F92 B;  1WJE A;  3CMM A;  1X4P A;  4IQJ A;  3TMO A;  1FMW A;  4BJT A;  2JQN A;  4DBR A;  1Z3X A;  3DPL C;  2O5R A;  3J7A Y;  2L9N A;  2KZV A;  2M0M A;  4HSR A;  4F93 B;  3H9J A;  5FRO A;  4C2T A;  4PSX A;  4Y4R A;  1MMG A;  2VLA A;  1EA3 A;  3PNY A;  3OS0 A;  5CPR B;  4BQQ A;  1X1B A;  4XON A;  1LKX A;  2A6T A;  3K4J A;  4YRV A;  3S3N A;  4DJA A;  1E0E A;  4GRI A;  2IXS A;  3VWB A;  3DQV C;  3RPU D;  2XDV A;  3LSK A;  4ANJ A;  2HU9 A;  4KIS A;  2ELJ A;  2WY8 Q;  2X51 A;  4BUP A;  4CCL A;  4HNT A;  3K70 C;  1Y56 A;  3KEY A;  2M7B A;  4U7B A;  3HXL A;  2V6E A;  2F5V A;  3HOS A;  2WAQ A;  2CS3 A;  1SAU A;  4ZDO A;  1KON A;  4XQF A;  4OAY A;  2HW2 A;  1BOB A;  2XF5 A;  4XKC A;  3KYL A;  3OYA A;  3S93 A;  1W36 D;  3RQ4 A;  4ZC3 A;  2V1N A;  2CFO A;  2R7V A;  2CUZ A;  3OYC A;  3CJQ B;  2O0Q A;  2XSJ C;  3S8P A;  4BDY A;  4BS9 A;  3E1S A;  2IS6 A;  3HUG B;  2CMP A;  3LSG A;  4NNJ A;  2LOO A;  3KX2 A;  4XMY A;  3HKZ A;  3K10 A;  3FKJ A;  3QYB A;  3M1C A;  4PK4 A;  2UWM A;  4PSW A;  1YX3 A;  2DT7 B;  3NWS A;  3ZRG A;  4ITV A;  4BXF A;  2HDW A;  3HPG A;  3L2R A;  2VIX A;  2VKH A;  4PFO A;  2DT6 A;  2FUG 2;  2M4G A;  3W2V A;  4XKW A;  4BQN A;  2KRH A;  3K4N A;  3VSK A;  2KMU A;  4E7L A;  3FHN A;  3SEZ A;  3IAS 2;  4XLH A;  2E1M C;  1D0Y A;  3RCO A;  3OWT A;  3I3L A;  1Z3Y A;  3OYK A;  2PMZ A;  3ZQQ A;  2HVR A;  4N4N B;  3W3C A;  2OC6 A;  4XOR A;  2PJR A;  3S3M A;  4CA0 A;  4X0G A;  1X1D A;  2HPM A;  4E7I A;  3DTE A;  5CKT A;  3OL3 A;  3K4M A;  2BOL A;  5FRN A;  4QPQ A;  2JSP A;  3I9V 2;  1BR1 A;  3C2H A;  2OV7 A;  4E7Z A;  4BQO A;  4XLA A;  2KPM A;  2DXI A;  3A1Y A;  3OIQ A;  1MNE A;  1X1C A;  4C2U A;  2R7S A;  1N75 A;  3MD2 A;  4DOZ A;  3DWL E;  5HNF A;  2CH0 A;  4BEH B;  2LYC A;  3OYB A;  3MMY B;  1DQU A;  4HEA 2;  4XKB A;  1X4O A;  3PUB A;  3OYM A;  4XN3 A;  3LSI A;  1MW7 A;  3BC8 A;  3CES A;  1GLN A;  3H35 A;  3K4C A;  4Y3O A;  4BJ6 C;  1NG7 A;  2LH9 A;  4BE0 A;  2BW3 B;  4E7K A;  3OYH A;  3AL0 C;  2WAE A;  2WY7 Q;  3AKZ A;  3W2A A;  4DBQ A;  1WFX A;  4RM2 A;  4OWR B;  4P1W A;  2F6C A;  4U87 A;  3ZR8 X;  4CCJ A;  3AFH A;  3D5R C;  4BAC A;  1TT0 A;  1D0Z A;  2DOA A;  2IGO A;  3W2W A;  4B44 A;  2LY1 A;  2P0W A;  1ERD A;  4PFP A;  3DPT A;  4PUS A;  2WB1 A;  3TL4 X;  2VPL A;  4Y33 A;  1V5F A;  4XLF A;  1Y6I A;  3BCA A;  1D0X A;  1P9Q C;  3H5A A;  3DEE A;  3OYI A;  2VJI A;  2Y0S A;  4II3 A;  4J00 A;  4EAT A;  1QU3 A;  4PJL A;  3A2K A;  2R7X A;  3HOT A;  4LIU A;  4PJM A;  2IS2 A;  3IAM 2;  1MMD A;  1W36 C;  4HG2 A;  2HVS A;  3MKZ A;  3K4B A;  1UEL B;  3LL7 A;  3OOU A;  4P5O A;  3OIP A;  2V4J C;  4C30 A;  5KNL A;  2CV0 A;  3OL4 A;  1QHH D;  3H9Q A;  2LRE A;  1LVK A;  3K6G A;  1T0F C;  1BR4 A;  3OYF A;  4B47 A;  2R7T A;  1WJB A;  4XNF A;  2X1E A;  3H5R A;  2LBF A;  3ONQ A;  4BJ5 C;  2O0P A;  2M4K A;  2VJJ A;  3DU6 A;  3QOE A;  2BVL A;  2RRE A;  2XAU A;  4CCO A;  2W00 A;  3CP2 A;  3K4L A;  2X6Y A;  4NUB A;  3OR1 C;  4JOM A;  2XF6 A;  1D1B A;  3H5N A;  1Z21 A;  2UV1 A;  4FET A;  1MND A;  2VQL A;  3VYS B;  4II2 A;  3PSI A;  1NG6 A;  4N4O B;  4HPQ A;  2GOX B;  4LG3 A;  2Q2E B;  3CJR B;  2VXZ A;  4PJN A;  2K3P A;  3HC7 A;  3OYE A;  3PL8 A;  4BL0 B;  4BGD A;  3UNG C;  4RM3 A;  3SEQ A;  4XR6 A;  4XM3 A;  4IQ4 A;  2XC7 A;  2K9M A;  4XOP A;  1QHG A;  2QKM B;  4DIQ A;  1SFK A;  2LC2 A;  1WJA A;  1WJD A;  2UUZ A;  2LG4 A;  3QYE A;  3VSL A;  2IGM A;  2RQQ A;  2L5Q A;  4ZTF A;  5FRM A;  1UAA A;  2HQA A;  2VQC A;  3CZ6 A;  2R7R A;  2X1D A;  3HL2 A;  1BR2 A;  2XF7 A;  3OYD A;  2V26 A;  4NC7 A;  2MFZ A;  2Z16 A;  4RMN A;  3SYT A;  4F91 B;  1R6R A;  2KQR A;  3BLY A;  4E4H A;  5KCM A;  2ZSI B;  2L7K A;  4XN0 A;  2WAD A;  4QPO A;  5CQE A;  3ZCO A;  2GOM A;  2KRC A;  4B43 A;  4BE2 A;  1LFP A;  4BE1 A;  3DKX A;  2X1C A;  4HNU A;  3OMY A;  3RTR A;  2PJR B;  2VQG A;  4PJJ A;  1N78 A;  3FDY A;  4JQF A;  3DTK A;  2Z1D A;  2KDO A;  2X6W A;  1DP3 A;  3FBI B;  1FMV A;  5HNH A;  2R7W A;  1WJF A;  1K6Y A;  2F4I A;  3LSM A;  2R7O A;  2IS4 A;  2W7N A;  3V42 A;  2W4S A;  4LIT A;  4MLO A;  1MMA A;  3PNV A;  3LSH A;  1V5G A;  2JVH A;  2LRD A;  4YEJ A;  4XLE A;  1AA7 A;  4ZJZ A;  3VYR B;  3L2W A;  1MMN A;  1Z7L A;  3PSF A;  3TBI A;  2W82 A;  4YEL A;  3OYJ A;  4F55 A;  3HPH A;  3OS2 A;  5KHD A;  2E5N A;  4ZDL A;  2E5Z A;  3GBG A;  3SZG A;  3L2V A;  2BVM A;  3H0D A;  2DCE A;  1G8X A;  5TGT A;  4XL9 A;  4D1Q A;  1YX5 A;  3VYT B;  4BU2 A;  1DGW Y;  4KIT B;  2VL8 A;  2RNG A;  1N77 A;  3OR2 C;  4ZTJ A;  3QOD A;  4E7H A;  3MKW B;  3L2Q A;  4F52 A;  1YE9 A;  1VZ0 A;  3OS1 A;  2Q1Z B;  1PJR A;  2MYS A;  3SDB A;  4AVZ A;  4F3Q A;  4CCM A;  2Z2S B;  1G59 A;  4ZYA A;  4LIV A;  3BG6 A;  2I8D A;  4E6K G;  2VKD A;  2CUJ A;  1WJC A;  2V9K A;  2DJI A;  1U0J A;  2M3A A;  2VB6 A;  4R79 A;  1JI8 A;  3AL0 B;  4NC8 A;  4AYB A;  4H4K C;  4IX7 A;  4RLQ A;  2WBM A;  3DU5 A;  1DGR M;  3IP4 B;  2CV1 A;  3OY9 A;  2A5W A;  4KT6 A;  3HG9 A;  3DLA A;  3OYL A;  1D1C A;  2R7Q A;  3RSN A;  4IZZ A;  4HST A;  3G2B A;  2JA2 A;  4B48 A;  3S3O A;  1D1A A;  1HA8 A;  3DKY A;  2WA0 A;  4BDZ A;  4XKV A;  1V5E A;  4CCN A;  2JUG A;  3M8J A;  3BG7 A;  2JVG A;  3H9G A;  2LBF B;  3K70 D;  2KP6 A;  2HVQ A;  2V7F A;  5HVQ C;  3C2G A;  3EUH C;  2IGK A;  4G6T B;  2VAS A;  4C9Y A;  2ZXI A;  2X6X A;  5JHF A;  2R4G A;  3A4C A;  3S32 A;  3IUO A;  3FBN B;  4KJZ A;  2VJ5 A;  2LY2 A;  3MKY B;  2HNH A;  2L9S A;  5HLT A;  3ZGK A;  4DGW B;  2W1O A;  1T95 A;  2K9L A;  4ZDP A;  3EPZ A;  2L2O A;  3U21 A;  3ZXS A;  4IKF A;  3OYG A;  3LFU A;  3BCB A;  4RLF A;  3K4K A;  3DTI A;  4E7S A;  2VQH A;  2MAB A;  2QKL B;  4CCK A;  4B3X A;  4CSW A;  1J09 A;  4D9J A;  4EYY Q;  2HZD A;  2NOJ B;  2CV2 A;  2MD0 A;  2MC4 A;  1X1A A;  2E60 A;  1OLT A;  3EUK L;  3F9K A;  2IS1 A;  1S9H A;  1ZEL A;  3E0J B;  3PFY A;  3VDX A;  3VYU B;  2E1M B;  2HPI A;  2ZSH B;  2ZXH A;  3UR3 C;  2M7A A;  4FAS D;  3LMM A;  4OAZ A;  4XOT A;  3L2U A;  2K5C A;  2CW7 A;  5CQG A;  4BEH A;  2CW8 A;  4NQW B;  1X19 A;  2KL4 A;  3PJR A;  4CUG A;  3NWT A;  3N05 A;  3OYN A;  2VJ4 A;  3QYF A;  4CH7 A;  5LD2 C;  4AU7 A;  2X85 A;  3PNT A;  2OUM A;  3CF2 A;  2KHM A;  2R7U A;  4HRI A;  3D5S C;  1OR7 C;  1UG0 A;  2AQF A;  3D5L A;  2ZFU A;  2BW3 A;  2AQE A;  1WJ5 A;  5LFA A;  4E7J A;  4J01 A;  3DPU A;  1TZL A;  1PYV A;  2VXD A;  2WAF A;  3CP8 A;  3EUA A;  5HOO A;  1IRX A;  4XLC A;  2KLO A;  4CZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...