1WFXA

Crystal structure of ape0204 from aeropyrum pernix
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
180
structure length
180
Chain Sequence
VRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable RNA 2'-phosphotransferase
publication title Crystal Structure of the RNA 2'-Phosphotransferase from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 46
structure length 180
sequence length 180
ec nomenclature ec 2.7.-.-:
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wfxA01
3.20.170.30 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 1wfxA02
1WFXA
chains in the Genus database with same CATH superfamily
1D0YA 1DQUA 2GM4A 2W48A 4C3IJ 1JJ6C 4UY8I 3VB2A 1ZKGA 2DQLA 2V1XA 3ZRGA 4EEFG 4RAFA 3ZQQA 4WX9A 5IYBJ 4IHTA 1BR1A 1IXRC 4IRGA 3RPUD 1HOMA 4E7SA 5EZGA 2ZMEC 1FJLA 2ZJRF 1B6AA 3F22A 1V5FA 4ANJA 2DA7A 1ULYA 3G1MA 2DA5A 3LA7A 2R5ZA 2PI0A 4MEYF 4HAMA 5M3FJ 2FNPA 4JK1X 3CO6C 1T98A 3E5UA 4CXFA 1FOYA 1F5TA 4OINF 2IPQX 3FBIB 3PNTA 2O03A 1SFKA 2OU2A 3CCJI 1DP7P 3WU2C 3ABUA 4M3BA 2MW8A 3S3NA 2XV4S 1AU7A 2JT1A 4LB6B 1YS6A 3ZMDA 2WV1A 2LG4A 4G94A 3QYFA 2LD5A 2Y9ZA 3L09A 4L5EA 3ABKH 4LMYA 1UMQA 2JA2A 4C3HJ 3L2RA 4MLOA 5HODA 3B6CA 1H9GA 2GXAA 1ZYRF 1CF7B 2DCEA 1SD4A 2K9QA 3W6JB 9ANTA 4IOAF 5ICFA 2AQFA 1FIAA 3HGGA 5C44J 4PSXA 2NS7A 3RYPA 1D5VA 2Z33A 4W1UA 3J81K 3U21A 2ADUA 1R58A 1OCZH 3BDDA 3NWTA 1JT0A 3GUDA 1IO2A 1ACIA 3G2BA 5HDGA 2JPBA 5L3EA 2E2HJ 4B48A 4J01A 3ZMSA 2VASA 1VQMI 3VSLA 1TZLA 1X1DA 1BI1A 1KYZA 3RQIA 4CDGA 1AOYA 4ZH4F 2CFOA 3BTCA 2DYSH 2NYXA 3QPSA 4AIDA 1D5YA 2IS1A 3N05A 2E7XA 2CSOA 3WG7H 2NNNA 3GTQJ 4OMYA 4G7HF 4RB2C 4X0GA 2AUAA 5DEQA 4ON0A 3OYKA 2WY7Q 1DUXC 3H5RA 4CYDA 4BAYA 4RB0A 2QQ8A 2Z9OA 2DA1A 3SEZA 3GYHX 2CWEA 2LF7A 3GCMA 3H92A 1R71A 3LL7A 4HRIA 1LFBA 5B1BH 3FHNA 4PJLA 3TEDA 1I1GA 2MA3A 5JLWA 3ASNH 1FSEA 4V2FA 4XQFA 1LE8A 1VQ4I 5M5XJ 2JTVA 2KIMA 2V9VA 4PFOA 2LOOA 1GLNA 4ETSA 5E79C 3K2AA 2STTA 5LFAA 3GTLJ 1JHHA 4BHBA 1A35A 3CCYA 3S93A 2XPUA 1S7OA 2ZBKA 2BOLA 5L3CA 1Z77A 1MJBA 1CQTA 3MD2A 4AVZA 1FSHA 5K7FA 2W00A 3Q0VA 4EM1A 2HYJA 2K4BA 1FBSA 4FT8A 6PAXA 3L7WA 3DPUA 3MCZA 2VXDA 4ESJA 2RN7A 2XUBA 2ZO4A 3H9QA 3O6BB 4X1EA 3IWZA 2R7XA 5B66C 1MBGA 1CGPA 3M1CA 2ID6A 1J0RA 3CCSI 4N0BA 1MBEA 1V55H 2IGKA 2XB5A 3CMEI 1F4KA 1W5SA 3PO3J 3IRRA 5GTHC 3P9IA 4P5OA 4EQQA 3K1MA 2FMYA 4A3DJ 2BV6A 3F8CA 3K10A 3GZ6A 4NC8A 1I6XA 3EUHC 3F21A 4B09A 3D0SA 2A6HF 2VB6A 2XPWA 1G3YA 1QPMA 3I55I 4A5NA 4ZYDA 2R5YA 2KLOA 4D5FA 1IV6A 4FE7A 2IS4A 2HOAA 2YU9J 1BN5A 1BJAA 1D0XA 2CQKA 2E5NA 5L3BA 1K7AA 3BR3A 2BW3A 1USSA 1Y0UA 3CF5F 4KIFA 3GTPJ 2WB1A 1N75A 2O3FA 4AC0A 3S15J 3D1NI 3L00A 2CUFA 3IP4B 3A02A 4HSTA 4Z6YA 1WWXA 3RQ4A 2LP0A 1USTA 1KGSA 2ZB9A 2FE3A 4B44A 2ZNZA 3PIOF 3CUOA 3JAMZ 4CCJA 4DBQA 5J4YA 4EM0B 3RDIA 4CSWA 4BDZA 1TLHB 2PX9A 1OPCA 2KDZA 4QPOA 3HRTA 1JT6A 4UVBA 3JRFA 2Y0MA 2DA2A 3BCBA 4BQOA 3VOEA 2BY3A 1XDUA 4HF2A 1MW7A 2O0PA 2HVRA 2PQ8A 3KP6A 1XMXA 3LSHA 4JP0A 3MWMA 4CZCA 2VJIA 2VOPA 4A3FJ 3C1DA 3DLLF 2PJPA 3PM1A 1DPRA 3HOVJ 3M9AA 3HSRA 3MZYA 2GOXB 4RMNA 1LPQA 4IHYA 2HW2A 4BYYA 2D1HA 2RVCA 3KLOA 3QU3A 2WAQN 3RZDJ 4C30A 3RZOJ 3FWEA 4XM3A 5EF6A 2QSGX 3CESA 3KP5A 3CCUI 2V9KA 2LTPA 1R7JA 2M0MA 3K7AJ 2QWWA 3CO7C 1AKHB 3CCVI 2XKPA 2DLLA 4UUSB 3MKYB 3E3VA 2ZC2A 3S1NJ 2EFOA 1JHFA 3OYEA 3K4NA 4XIDA 1RR7A 3CC7I 4M71A 1PP7U 3IH4A 1JTYA 3HC7A 5TGTA 3K4MA 3IUOA 4BXUA 2E60A 1WSUA 1U78A 1LVAA 4ZZDA 3CCRI 3ZQLA 1O3RA 1LFUP 1U6GA 1UCRA 5ICEA 2BY2A 2O0YA 2W84A 1J7KA 3BG6A 2CH0A 3OL3A 2X1CA 4C2UA 2QBYA 3V7SA 5J40A 3E5XA 2ECBA 5HS7A 5A2QK 1STZA 3E97A 5J4VA 1X3ZB 4I6ZA 1XTAA 5C3EJ 1WPKA 3FF5A 2Q1ZB 3QPLA 3CMAI 1T08B 1H9TA 4L5IA 4MQVA 2OQRA 4L5JA 4I01A 4ZYEA 3OYLA 1ZGJA 2QQBA 2CUZA 3VYTB 4LLGF 4KICA 5CQEA 3VYSB 3L1PA 4BL0B 2R7TA 3RKWA 2V1UA 3DWLE 2X51A 2YUSA 5LBQA 4RAZA 4XLPF 4LOCA 1I3QJ 3G6EI 4AM3A 3E0JB 3CC4I 1ZGAA 1YIOA 1DU6A 2NS8A 4LITA 3TW7A 1VF9A 5J1YA 4MFDA 2JZYA 1ZRFA 5KCMA 5EGOB 2DODA 3I53A 2P5LC 4A3KJ 2ISZA 3KIOA 4NB5A 5AONA 2WAEA 2RKHA 2Y31A 2V79A 2BEOA 2B9SA 1E3HA 3P9KA 3WU1B 4A3BJ 2AO9A 3NWSA 5L3DA 4HLXA 1RIOH 4U7DA 3FXUA 4G6TB 2A6TA 2VJJA 4UUSA 2ETHA 3GX4X 2GBYA 5KHDA 3K4KA 4L0ZB 2CFXA 3J81Z 2ESNA 3FXMA 3LSGA 1ETYA 4FISA 4PDKA 1GUUA 2GIZA 1PYVA 2G7HA 5IP7J 1MJ9A 2XAHA 4WF2A 3W2VA 4IVNA 3WE3A 2W1OA 3PO2J 3V7CA 2FEZA 3EPZA 4JX5A 2X6YA 3FX3A 2QQ9A 2YX4A 3E5QA 2FA5A 3GFMA 1TL8A 1FX7A 4B47A 3WTUC 3ZN1A 3QPTA 4R1HA 2ME6A 4HQEA 3BG9A 4BEHB 4E70A 2JUCA 1FC3A 4DYQA 5E20A 3CCMI 2BE5F 1W5CC 4RGXA 4NHJA 2L4MA 1DP3A 2EIMH 1BBYA 1XB4A 4CCOA 2LYCA 2P6TA 3LA3A 2EV5A 2JUGA 2ISYA 2GA1A 2VPRA 1OR7C 1IJWC 1YITI 4II2A 1MBJA 1V3FA 1KU2A 3CDHA 3OYJA 3PUFA 1JXSA 2BHYA 3A03A 1R4MB 4JX6A 4YRVA 3CDIA 3K9TA 4IPAA 4DBRA 3WGIA 3L9FA 2XGEA 1BW6A 4IZZA 4IKFA 5IYDJ 5J1UA 1I6HJ 1KONA 3K0LA 2NAZA 3PNVA 3T8RA 4AWXB 1FMWA 2XPVA 1P2FA 2BY0A 3F3XA 4A93J 1H0MA 4HDVA 2HQRA 3BJ6A 2VI6A 3BC8A 3F6OA 1U5TC 3KX2A 4ZDOA 3TDZC 2FBHA 2FD5A 5F0FA 3DCFA 1OMIA 2MFZA 3LSIA 3DBRB 4AVPA 2VC1A 2LMDA 2YPRA 1YS7A 4UVCA 4BHPA 4Q5SF 3OIQA 1EV7A 2LSOA 1LEBA 2ZJQF 4J19A 4RBOA 4A5MA 1P9QC 2Y69H 4HF1A 1FZPB 4OIPF 1RETA 2PMZN 4LLNA 2Q2EB 3G1OA 3BROA 4ZTFA 3RJPA 4LJZF 4DZJA 4BEHA 4OAZA 1LQ1A 1YRNB 2KIFA 1PDNC 1RRJA 2I5UA 2EWNA 3O8GA 3JREA 4BH9A 3EUKL 3CQZJ 4XOTA 1N25A 2RC4A 3U1KA 1MNMC 1WJ5A 2HNHA 2K9SA 3KP2A 3DTIA 2DU9A 3HHHA 3QWLA 4KMUX 2PJRB 2X85A 4ENMA 5FKNA 5LRSA 3LSRA 4IQ4A 3RIRA 4QIWN 2LKPA 4QTRA 3OSGA 2W85A 4MHGA 4Y4RA 2BXZA 2XVCA 5BPIA 3WG9A 5JR3A 4FE4A 3GTJJ 3K6GA 1FLIA 4A3JJ 3PNYA 1I5ZA 4U0VA 1MMGA 4HX4A 1GDTA 4KNYA 1Z9CA 2IGNA 2XHKA 2DDBA 5HDNA 2IEKA 2OA4A 3E7LA 3GFJA 3J80K 4HA8A 5CLSA 2QQAA 1HA8A 5GTIC 2XF5A 4XLCA 3GFLA 2WAQA 4F52A 4XN0A 1JE8A 3JCUC 2F5EA 1T0FA 3I64A 3ML6A 4WXDA 5J8FA 2L9RA 4BBRJ 1IGNA 1ZG1A 1IC8A 2VKEA 4KIBA 2GXBA 2MYSA 2Q2EA 2BXYA 2QA4I 2EB7A 2AXTC 5E8IA 1YRNA 3DBLB 5F27A 5FFXA 4B4CA 2NRAC 3QOPA 1OYWA 3Q3SA 4TV7A 1R5GA 2QKLB 4U0YA 1FTTA 3I4PA 3GVAA 3A4CA 1FP2A 2QYOA 5J47A 3CUQB 5CQGA 3OYGA 1IW7F 2NVXJ 2EV6A 1SD5A 4A69C 2EPFA 3DEWA 4GDFA 2QSFX 1P4WA 2KJBA 4XRMA 2DT5A 1J9IA 4HEA2 2COBA 2ESHA 3BOQA 2VT2A 2L54A 4CH7A 4KYWA 2R7DA 3H3VK 3I5UA 3BR0A 1BI2A 4XMYA 3WHBA 4HNVA 1T33A 2BZTA 5KK1A 5HLHA 1AHDP 1BOBA 2HOEA 2HKOA 5DS9A 3K70C 2HDCA 3HOYJ 2E19A 4BGDA 1FYMA 1TTYA 3JTHA 2PMHA 2EFQA 3AG1H 1F36A 1OCTC 4L9VA 5A2QZ 2QM3A 4EV0A 3M8FA 1HKSA 5JHFA 2TCTA 4BBSJ 5L3FA 1ZARA 1OCCH 3EETA 1Y6IA 3DTKA 5K7HA 1PUFA 4M3GA 3DKXA 3LSKA 1FOWA 1ZLKA 3V8LA 4ZJZA 3FMSA 2L9NA 3WHCA 1K4SA 4OMZA 4BQQA 1XMAA 3P7NA 2A68F 2MC3A 5FKKA 3FK6A 2IRFG 2EA2A 4M73A 3LFUA 1ON2A 1V5EA 3AG4H 2H94A 1O3TA 2CW0F 1U8RA 4WXCA 4UUTA 5K5QA 5BNGA 5D8KB 3ZOBA 1R5HA 3B02A 5BS6A 1IRZA 2R5ZB 1FIPA 2DXIA 4XKVA 2JJ7A 4UUVA 4ABZA 5E1XA 2FQ4A 4KA4A 2O6GE 4DIQA 4RGUA 3M3YJ 3OS0A 2DW4A 2ZFUA 4MIMA 3U1DA 3OYFA 1W0TA 2L7ZA 3BTLA 3FM3A 1MBFA 3M8JA 1YHQI 1HW5A 3LSJA 4ENKA 1SD7A 3AKZA 1AA7A 1QZEA 3MKWB 1HC8A 4J00A 2R92J 4XRSA 2DO7A 1JKPC 1R5ID 2DTZA 1YW9A 1YOVB 1IXCA 2OQGA 3V8JA 3CJQB 5LHHA 1BI0A 1T6SA 1QRYA 1BOAA 2A5YB 2F6CA 3OYNA 2HWVA 5H6QA 2GOMA 1PJRA 3PIPF 1WJBA 2A69F 1G3SA 1U9NA 2G0EA 3DPLC 2JWTA 1E0EA 4CUGA 4A2UA 5D8LB 4E7KA 1ZHFA 3H36A 1HBXG 2H8RA 2P6SA 3ZP5A 3DKYA 4ZZLA 2VQLA 2WTEA 1B4AA 2X48A 2DOAA 2JRTA 3CUQC 2ZFWA 1F1ZA 4L9NA 2X0LA 3LOCA 4JX4A 3S3OA 3ZQGA 2CW8A 1D1AA 1XCBA 1TWFJ 3DLAA 1WGXA 3G1LA 2ELKA 3H3UA 4F92B 1ZRCA 3VFZA 5J3LA 1MZBA 2MGQA 4DYRA 3BZKA 5EJCA 2COMA 1LE8B 4D7NA 1JGSA 4G6DA 5DM6F 3JRGA 4MTDA 2EIJH 2UV1A 2KKOA 2OD5A 2PMZA 4YIFA 2OZUA 3KP7A 5M5WJ 2HTJA 4BXFA 3LA2A 1OISA 1QZZA 3S16J 4ZDPA 1Q1VA 3LFKA 4EJOA 2O0QA 3CCLI 2NVQJ 2W57A 3F23A 2RGVA 3ZQ7A 4EM2A 1MD0A 4F93B 2LH9A 3FXKA 3IKVA 3EYIA 4PCQA 3MEXA 1MMSA 2H27A 1JUPA 2M3AA 3TQNA 3B73A 3F6VA 2L7MP 2WC2A 4HX8A 1GV5A 5F0CA 1S5LC 1ZAOA 2E5ZA 4ITVA 3H9GA 1PVEA 2MG4A 2O8XA 2VN2A 2XAJA 4IHVA 3RKXA 1FNNA 1ERDA 2IP2A 3DPTA 2VBYA 3C18A 3FM5A 4PZJA 2H1LA 4X6AJ 5DD8A 1I50J 1ZN2A 5CPRB 4A0XA 3IHUA 1ZK8A 2EZLA 4M6VA 1UG2A 2EINH 2KIUA 3FMRA 4G6QA 3S2WA 3CC2I 2X1DA 1JJ8C 2XGXA 3I58A 3IKTA 2R5YB 1Z6TA 1U0JA 3BG7A 3BZCA 1UZCA 2LY2A 4HW0A 2JA8J 4A6EA 1LDKB 2GZWA 3CMMA 4ZC3A 1MDMA 5AIQA 4A3MJ 2BW3B 2HQ5A 1SANA 1YW8A 2HR3A 2LDUA 1FYLA 1SVLA 3QPHA 3RYRA 5F64A 3QYEA 3DU5A 2Y48A 3J80Z 1TW3A 1BW5A 2IGMA 5BMZA 1G59A 4E7ZA 3MQ0A 4UB6C 1FBQA 2YX7A 5F0HA 3G71I 3S2HJ 1BC7C 1Y8QB 1JI8A 2R7ZJ 4IRHA 1K61A 3ESWB 1RESA 4HF0A 1IF1A 4OIRF 3OS1A 3ASOH 3LAJA 5DUKA 3S8PA 5HNHA 5JVTA 2DFFA 3NEUA 4BXXJ 2P7CB 4H0EA 4OAYA 1ETKA 2AQEA 2CJJA 2HXIA 4P9UA 2LKXA 1YFHA 1QA6A 4PK4A 4XKCA 3IAS2 3WTYC 5E3MA 1R4NB 3L2CA 3TP0A 4I99C 5GPCA 2R93J 2QF7A 5F1JA 2E1CA 2KRHA 2EA4A 2EZHA 2LNBA 2OPTA 3KP3A 1YG2A 3W6VA 4EJTA 1VQ6I 4Q48A 1EA3A 3O3KA 4UNOA 4G9YA 1ZH5A 3FXJA 5IT9K 3ECHA 4IJAA 4B43A 4ZYGA 1VTNC 1IN6A 1D0ZA 1FT9A 5FRNA 1HSJA 2E1MB 2F4IA 3OYAA 3TOBA 1ZR2A 3TP3A 4CHUA 4B8XA 1R1TA 1F43A 2CQNA 3RKQA 5E1WA 2DBBA 2DAOA 3E6CC 5K7ZA 3GFIA 3BPXA 1S7AA 2FBKA 3V42A 3O8HA 3F8MA 4JQFA 1HDPA 2JSPA 4GYIA 3TO6A 3IC7A 2HDDA 1DPUA 1OCRH 5ILSA 1X3UA 3A01A 2Z2SB 2EBIA 4FTHA 4F91B 5GADJ 1BIAA 1N78A 4I0BA 2QBYB 3V8KA 1YX3A 1O57A 2R7VA 3C2GA 2EIKH 5EZHA 3FKJA 4RDUA 5GAGJ 4D9JA 4IQJA 4M3DA 1SFOJ 2X1EA 3P9CA 4P55A 1W1WE 3NAUA 5C4XJ 3GLLA 3T0YA 3TO9A 1MSFC 1ZREA 2JN6A 1O3QA 2CQ7A 3S2DJ 4PGGA 5LRRA 5HLTA 1KYWA 2HU9A 3H9JA 1IUFA 1X19A 2MD5A 3KEYA 2KRFA 3WGGA 3HEFA 1KQ9A 2EV0A 3FK7A 4UB8C 3UR3C 3W6KB 1WKMA 3G73A 4KN4X 1WH7A 5IOYA 2M7BA 4M6YA 4UVAA 5JVGF 2M4GA 1H89C 1R00A 4WCGA 1I27A 2YR2A 3K2ZA 5J8CA 3L2UA 3CMYA 3HSFA 3MN2A 4KJZA 5FKOA 1ZRDA 2F4MB 3DKWA 3PUBA 5LGNA 4BJ5C 2D1VA 3ZMZA 4IL6C 3FISA 1YJNI 1YTYA 4EGYA 2QZ8A 1U2WA 3C2BA 1WZ2A 2FX0A 2KHMA 2XGDA 4AD9A 1XC5A 2STWA 2V6EA 5M5YJ 3OYIA 2FQ3A 2OC6A 4D1QA 3PL8A 1MBHA 3W2WA 1YO5C 3QQAA 5CVJA 1X1CA 4NUBA 3OIOA 5DCMA 3BWGA 3JRCA 4F7ZA 1Z0XA 3A0BC 3GF2A 1K78B 1PUEE 1X4PA 3JRDA 2OV7A 1QPIA 3QRFF 4RA2A 3TL4X 3AL0B 4O3MA 2OCCH 2QSHX 2DI3A 2KISA 3AG2H 2VQGA 2NVUB 4BJTA 2O61A 3SEQA 1ETXA 1IV8A 2JMWA 1NHAA 3MMYB 5F08A 1LVKA 5C4JJ 1R23A 1XMKA 2CRGA 2LF8A 3BR6A 4HLYA 1B72A 1SMYF 3VODA 4A3IJ 2E1MC 2IS2A 1FBUA 4CCNA 3JRBA 1WH5A 3CTAA 5FRMA 1FMVA 1VQLI 1TWHJ 2Z99A 4EVIA 2DA6A 1NTCA 4OWRB 2V1DA 3BT9A 1POGA 2TRTA 3GMEA 4XLEA 2MLKA 1YQAA 1JGGA 3HXLA 2NXNB 3BCAA 4XLHA 5B3SH 3NRVA 1P4AA 1GVJA 3LMMA 2M1BA 1FP1D 4XL9A 4XLNF 3IV5A 1ZG3A 1QNTA 2BGCA 2GIVA 4ZYHA 1HKTA 1EKEA 4CCKA 2JPCA 3BZ6A 4V2GA 3V4GA 3OSFA 1FWZA 2P5KA 1UHMA 2F5CA 2J5PA 2R7FA 1YLFA 3N97A 4BDYA 2PLYA 4RB1A 1OYYA 3L2VA 1OFCX 2F48A 2KZGA 1ETOA 1JUMA 1R36A 1KU7A 3QAHA 4HG2A 1T2KA 3CP2A 2DMQA 1K78A 2HTSA 2H09A 3HM5A 1XX5A 1SAXA 3ZN0A 1MSEC 4G7ZF 4U87A 4IHSA 2HVQA 2GA2A 4Y17A 1D8KA 1W7PD 3IWFA 4DJAA 1V5GA 3HG9A 4FX4A 2QUFA 1U5TA 3CLOA 3KEOA 2KZVA 1DGRM 1IN8A 1WRJA 2HS5A 3H1CA 5GAHJ 5B5EC 5FJ8J 3E6DA 2HZDA 3T1BA 1S29A 3ISPA 1S8NA 3S1QJ 2CG4A 1MIJA 5KAFC 3ZR8X 3A2KA 1SD6A 2ZKZA 1UB9A 3J7ZI 3ELKA 1J75A 1ON1A 3TBIA 3MVPA 2WWYA 5E18F 1ZLJA 4DNCA 2LFBA 4M74A 2FOKA 2RNGA 3H0GJ 1W0UA 3GTGJ 1QZYA 2FJ1A 2R4GA 5FLVA 1C0WA 3TOAA 4NNJA 3ABTA 4HYEA 5FD6A 3HDDA 1IRXA 1QU3A 3OYBA 3REOA 2YSRA 5CVUA 2KP6A 3N4MA 2WAFA 5J1RA 3E6BA 4XSZF 1QVUA 2VL8A 3JRAA 2CYYA 3MFKA 4KMFA 3R4KA 4KDPA 3BP8A 3TW6A 3ZGKA 2MLGA 1V4RA 3KPHA 3TMOA 4G12A 4D7MA 1WJDA 2ECCA 1MGTA 4YIIA 2KT0A 5DUIA 2PBIA 1XDSA 2NOGA 3KFWX 2M7AA 3MZ8A 4UXNA 3TDUC 3K4LA 1XGSA 3VDXA 2V4JC 2VBWA 2YU3A 3A1YA 2A6EF 2C6YA 1VQOI 1HSTA 5KNLA 5IT9Z 1ONVA 3HOTA 3KYCB 4F3QA 1LDJA 3DBHB 3FZVA 2VJ4A 4JYKA 3WTZA 4A0ZA 4M6XA 1W4MA 1T39A 2QENA 3CP8A 1P4XA 3R60A 2VLAA 1EH8A 1Z6RA 2ELHA 4RAYA 3SFZA 2VE9A 1OCPA 1QHGA 3E6MA 1R1VA 4MTEA 4BE1A 3KEQA 2WADA 2I8DA 1JKOC 2JQNA 4S04A 5JHUA 3OIPA 2P7VB 4H4KC 3ZQCA 3P5JA 4FHTA 3IL2A 3MZHA 3VWBA 3GZ5A 3HSEA 2R3SA 2K40A 2O9LA 4HOBA 5F1RA 1SVMA 1HKQA 1OCOH 2ZSIB 1G8XA 3AAFA 3SJMA 2E36A 3I4NJ 3FXOA 3GLXA 3RKYA 3U9GA 3HRSA 2Z16A 4MQ9F 3ULQB 2DMUA 3OMYA 3EUAA 3WTXC 2I10A 1PUFB 2HFHA 4BS9A 1YJ9I 1BR2A 1VFCA 3KYDB 2K27A 3GWZA 2WA0A 2L9SA 4GXOA 1P7IA 5E3NA 4MNUA 1B9NA 2Y30A 4LD5A 2VBZA 4MGRA 5DTDA 1WJAA 3OOPA 1P7JA 2BYVE 1ETQA 2G9WA 3SXYA 4RAGA 2IA0A 3FKIJ 3LAPA 1J5YA 3OR1C 1FY7A 4BY1J 5TRDA 1QQIA 4ZTJA 5ERIA 3Q0WA 1I3AA 3ZMUA 5LHIA 2D5VA 5AIPA 4Z2YA 1E3PA 2FBIA 2NOJB 3WGHA 4ESFA 3ABLH 2M0CA 1W36C 3HJEA 1HLVA 3FXRA 4ZDLA 4LK1F 3HRUA 4M72A 4NBQA 2A3SA 2GXGA 1QVTA 3FIWA 1LKXA 2JVGA 4E7HA 1BIBA 3FBNB 2HI3A 2KJCA 1P6RA 2CQXA 4E7JA 1GT0C 4G7OF 2IXSA 3HPGA 3R0JA 4LFUA 2VC0A 3DTEA 4RGRA 1ITYA 1BL0A 2Q0OA 2MABA 3CCQI 2CGPA 3LSPA 2CUEA 2DT6A 2DPDA 3S3MA 3TGNA 2K9NA 5H6RA 2CS3A 1SEUA 3QP6A 3HKZA 4PJJA 4BQNA 3WU0A 2E71A 5DDGA 1HW1A 1U8BA 1FOXA 4WXHA 1T0FC 2GWRA 1YI2I 4BE0A 4HPQA 4KT6A 2E2JJ 3CCEI 4I2OA 2DMPA 1R49A 1I39A 3I71A 1GHCA 4YELA 1BM9A 2UUZA 2VE8A 1NH3A 5D5WB 2PMUA 4GRIA 3R6SA 3K69A 4U88A 1FPQA 4DQ2A 1EH6A 4EMSA 2MD0A 2QVOA 2TDXA 2CMPA 2RQPA 4PGHA 2JVHA 1QO0D 1EF4A 5CVVA 3SYTA 1OJLA 4Q47A 5K5OA 1R9TJ 2K85A 4E4HA 1RI7A 2XASA 4HQMA 3DXJF 1S6LA 4FCYA 2IGOA 3HOWJ 2NS0A 3OR2C 5FO5A 2K3PA 4DW6A 5EG0A 4PFPA 1B59A 1MNEA 3EDPA 4EJUA 2M87A 3MKZA 1G3WA 2HKXA 2F4OB 4HSRA 3OYDA 4RS8A 1ZTRA 4EGZA 5LLQA 3PFYA 2E1NA 2PFBA 4U0WA 1XN7A 3SDBA 1Y1VJ 3RCOA 5IY5H 1Y1WJ 4MFEA 4B3XA 3L2QA 2HVSA 4XICA 1ZELA 1BR4A 1Y39A 3IH3A 5IYCJ 1LDDA 2AHQA 4CYCB 4AIHA 2VKVA 4FX0A 5FB2A 1GVDA 1WQ2A 3DEEA 3H3ZA 1XG1A 2XAQA 2ZMEA 2VXZA 3K70D 2XF7A 3K1NA 4BKXA 1IZ1A 2ZSHB 5LEJA 4MEXF 1WHUA 4HBLA 2XDVA 2XSDC 1Z1DA 3F8NA 4BUPA 3CJTB 2HEOA 1X58A 5HOOA 4ASNA 1WVRA 3IAM2 1APLC 1YW7A 2HPIA 3GEZA 1HF0A 2XAUA 1D8JA 3FDYA 3JSPA 2E34A 1EH7A 4I76A 4WK8F 3TO7A 2LY9A 2FNAA 4P9FA 1KU9A 2KFDA 4OIOF 4S05A 4JBAA 3H5AA 2VUMJ 2FMLA 2W82A 2MSYA 5EEGA 2EH3A 2R7WA 1RUOA 3ZPLA 3GO5A 2W24A 2N8GA 3F0CA 3I9V2 3PJRA 4GGGA 4LG0A 1MDMB 5IOZA 3SFIA 1G3TA 5ED4A 1HW2A 3ABMH 2DA4A 1MH3A 4QSHA 3HGYA 5TJJA 3JRHA 4A0YA 1WCMJ 1RZ4A 5CJ9A 3UKGA 2BVMA 4RLFA 3M4OJ 2IT0A 5FLXK 4GFBA 2UXNA 3ZMVA 3ECOA 2L02A 4IHWA 2CV2A 1XSDA 4CYCA 2DPUA 2K02A 3I54A 5K1YA 2R7RA 4NDLA 2K86A 4I0AA 5BPDA 5TISC 2E1OA 3KCCA 3I4MJ 5FLMJ 5D4SA 2H6BA 3HTUA 4RLQA 2XF6A 4F55A 3CLQA 4Y13A 1VI0A 4FETA 2RAEA 3BQYA 3WTTC 2EQRA 4M9SA 2R0QC 4B1RA 2F5FA 2W25A 2CO5A 1MMNA 4BACA 3HL2A 2WBMA 3OV8A 2EFPA 4DGWB 4N9HA 2FU4A 5E3OA 2KPMA 4XSXF 1JUSA 1KA8A 3RSNA 2IW5A 3S17J 2M2EA 5M3MJ 1LNWA 4GYGA 5ICCA 2AXLA 3DF8A 2DMNA 3OWTA 3ZMTA 1SFXA 3SZPA 4YFNF 5E17F 3ZCOA 1LEAA 3T5XA 1UG0A 4LIVA 4O5VA 1B8IB 1WJFA 2FUG2 3SQNA 5H20A 4XLFA 3M7GA 2M30A 5FROA 1VQ9I 4BY7J 1J59A 1XGMA 4HNTA 5CVRA 3A01B 1ETVA 2HYFA 3PSFA 4I02A 4EJVA 4L0YB 4L9JA 2BVLA 2DFIA 2DQRA 1BA5A 4HZFA 3PSIA 3JRIA 2E2IJ 2L7FP 3COAC 1HCRA 2XB0X 1TT0A 1IAWA 1IN4A 1UHSA 2M8GX 4HV6A 5HNFA 3AFHA 2V26A 4OOIA 5GAEJ 2F5DA 1DGWY 4PJ0C 2A61A 3EUHA 3KP4A 1K4TA 4KT5C 3DEUA 2ZCWA 4BJ6C 1P92A 2BBYA 2OAZA 1YJWI 1FEXA 3EQLF 3JW4A 1TNTA 3F9KA 3SZGA 1TNSA 3HOZJ 1A36A 2ZXHA 1WI9A 4Y15A 3H5NA 3HB9A 4P96A 2EFWA 2D45A 2ZXWH 1SC7A 2LC2A 1VQ8I 2RREA 4RGSA 1VQPI 1CF7A 2XRLA 1QHHD 1TW2A 5D4RA 3BY6A 3HPHA 4DZPA 4CGZA 5CKTA 5DYMA 4XBFA 3I56I 1NK2P 3D5SC 3HYIA 2F5VA 1IUYA 2XAFA 1FOKA 2VJ5A 2LVSA 1E17A 1W7PB 2XKOA 1X1PA 3BLYA 1LFPA 4M3FA 2L9VA 3PQJA 3ZQHA 5D5XB 5LHGA 2M9HA 4BHCA 5BQTA 5IPAA 3FHZA 2KMUA 3KZYA 5HLIA 3WTVC 4AYBA 1B8IA 1WI3A 3NQOA 1YIJI 1SFEA 4G8XA 3ZXSA 3WTWC 2DJNA 2KDOA 2LBFB 4IHXA 4ESBA 2FXAA 1REPC 4A3LJ 5E3LA 1IXSB 3FXLA 4W97A 1SVOA 1Q1HA 3HOUJ 2KIQA 2XSJC 3GXOA 5LGUA 1ZQ3P 3G3ZA 3OYMA 2GQQA 5DCMB 2FSWA 1Z3YA 3X2QH 4IO9F 3LWFA 4OIQF 2M45A 1JKRC 3Q5FA 3GTOJ 2LKSA 2WY8Q 5EEAA 2DK8A 2EJRA 1BC8C 1TWGJ 3LSMA 5LGTA 5DM7F 4A3CJ 2HGCA 2RNJA 3M07A 1YX5A 3ZQIA 1A6IA 2JK3A 2VKHA 2IAIA 2V9PA 3VSKA 1MKMA 4XLAA 5HS8A 2XRNA 1OYIA 1B72B 4XR6A 2O5RA 3VPRA 2FF4A 3S1RJ 4D5CA 2XROA 2UXXA 4PJNA 1B9MA 3BG3A 2BY1A 1BJZA 1WJEA 4YIRX 3HZJA 1YE9A 5D5VB 4A3GJ 1W7PA 2CU7A 2QKMB 2IA2A 3F8BA 3GBGA 1XCVA 1IRFA 3R61A 3L2WA 1BI3A 1WJCA 3HHGA 3DQVC 3K4JA 4PJMA 2XIGA 1D1BA 1HXDA 2QLZA 1U9OA 1ETWA 2CQQA 2LBFA 1R1UA 3GTMJ 1TWCJ 3UNGC 2B7EA 2JQ7A 4E7IA 2FRHA 2X4HA 4NC7A 2P8TA 4UV8A 4AU7A 2PN6A 2HXOA 3IRQA 3ZQFA 5ILUA 4NC6A 1S9HA 2H8WA 2HZTA 1XPXA 1X3WB 4C9YA 5LD2C 4BE2A 2LRDA 3O2PE 1PP8F 3E1SA 4CICA 2R7SA 3FXQA 1OKRA 1WFXA 3BG5A 3DV8A 1O4XA 4AIKA 3CD6I 1NG6A 2DTRA 1DDNA 2K7LA 3I0TA 3LQRA 1VQKI 1Y56A 1U5TB 3HKZN 1X2NA 3QU6A 2Y75A 4EATA 3AG3H 1L0OC 5H2FC 5IP9J 5BOXA 2JA7J 2A05A 2A5WA 4KUMA 3J7AO 4YFKF 4KISA 4LLLA 2M34A 3W2AA 1QBJA 3CJNA 3LNQA 3CJRB 2NVTJ 3OOUA 3HOXJ 2F2EA 4OU0A 4Y3OA 5FLXZ 1GV2A 2R7OA 1R22A 1G4DA 3HUGB 2QEXI 3LQQA 3SDGA 1D3YA 4EYYQ 1XGOA 4FQGA 4EJWA 5HLGA 1VQ5I 1O3SA 2VQHA 2KL4A 4S0HB 2EFNA 3K4CA 5B1AH 1VQ7I 5F6FA 1UFMA 3EYYA 2X9DA 3G4SI 2DFHA 1XSVA 4BU2A 4P1WA 2E35A 5CVIA 4CZZA 2L7KA 2ZJPF 5DV5A 4AIJA 1H8AC 2K3FA 2CW7A 1OR7A 2Y0SN 1AKHA 4M9ZA 3PQKA 1KQ0A 1X2MA 4O6JA 1T56A 1ORKA 2V7FA 4XORA 1TT5B 2ZXJA 4NQWB 4XK4A 3U2RA 1YYVA 1LUJB 3ROUA 4E7LA 2XAGA 5IT3A 3NARA 3TKYA 4CO8A 1ZG5A 5D6FA 4AUXA 3HBLA 2DK5A 2M5WA 1W5TA 3D5LA 3DFGA 2A07F 3S32A 1X1AA 5FGMA 1VQNI 2DJIA 1TP4A 4LK0F 2LR8A 4KFCA 4IOCF 1RKTA 1OLTA 1MBKA 2EZKA 2Y2ZA 2OJED 4HDUA 4PSWA 3C3WA 4QLCU 1J2XA 1TBXA 2LY1A 2G7UA 4QWQA 1XGNA 5ICGA 2L2OA 2X6OA 4XN3A 5IP6A 3CDLA 1SFUA 4HX7A 3KLNA 2OTJI 2K5CA 3WTSC 3M1EA 3IH2A 1FYKA 4CCMA 3GZNB 3VYRB 4M9XA 3HUGA 2ICWG 3I59B 4Y7NJ 5J6XA 1OQYA 1K6YA 4IEJA 4YG2F 3HOSA 2O7OA 3QODA 2MBFA 3B6AA 1IN5A 4U7BA 3HIFA 3OY9A 3JTGA 1MMDA 3BQZA 2K4JA 2UZKA 1NG7A 4MO7A 5EGOA 1G6NA 1I1SA 3BR5A 3W3CA 1RR8C 2H6CA 1SAUA 1T38A 1LB2A 2E7WA 2L0KA 4I09A 1Z7UA 3BPVA 5E1ZB 3AL0C 2EZIA 1L3LA 3KYLA 2X6WA 5F04A 3J7AY 3KZZA 4Q4ZF 3HRMA 2R7QA 2VIXA 3ONQA 4NQWA 3OYHA 4V19K 1X1BA 1B1BA 1LJ9A 4IF4A 1K79A 4I7HA 2HQNA 1HDDC 2LK2A 2KQRA 1DU0A 5HS9A 2DOEA 5FD5A 3M8EA 1K83J 2ZXIA 3CF2A 5FFZA 2CV1A 2RV8A 4LGWA 1IDZA 4A3EJ 4ENNA 5JLXA 4C3JJ 3FMQA 1ZR4A 2KRCA 3BTIA 5ILVA 2RQQA 3BJAA 1UAAA 2OTLI 2DMTA 2L5QA 2XGCA 1Z05A 5EEHA 2MH9A 4XNFA 4M3EA 5CYVA 2L4AA 4D0PA 2DT7B 1EJ9A 3I59A 4BNCA 1Z91A 2CUJA 1U3EM 1FTZA 2Z3YA 2D2WA 1XS9A 1IG7A 4UHTA 2Y9YA 3QOEA 1TQPA 1SMTA 4E6KG 3WODF 3LSTA 5JFRA 2P0WA 1O7LA 2HOTA 2ZNYA 4XKBA 3K1PA 2CV0A 1UJ8A 2BHZA 2FOWA 2DFEA 3C7JA 2ID3A 3V7RA 2LLKA 2R7UA 3SZTA 5D5UB 4FASD 2VT3A 2HOSA 2IVMA 3QYBA 2MH2A 2VBXA 4RM2A 2W7NA 1S7EA 5K5RA 1RKWA 1XD7A 4GCVA 4IRIA 5EDNA 4CCLA 3H35A 1Y0NA 2EK5A 4HV5A 2ME0A 5JI6A 1TWAJ 1RC9A 4HNUA 2OF7A 2Q8KA 3F72A 3BR2A 2MC4A 3CZ6A 4R8HA 3BTJA 3F8FA 3Q0UA 3S1MJ 5HDKA 4C2TA 1ODDA 2J5OA 5EG0B 2DYRH 2VOOA 1KQ8A 2Z5UA 4XRSG 3MKLA 3KETA 2ZJ2A 2VONA 3A0HC 2Z1DA 3J7YJ 1XSXA 2VODA 5KAIC 1O7FA 2P5VA 4PUSA 3VEPA 2OUMA 5HVQC 1K6OA 2JA6J 1KU3A 1IN7A 1A31A 2RDPA 4UV9A 2DOFA 2ZMEB 1V54H 2OBPA 3DU6A 4LG3A 1UHWA 4XKWA 3GTKJ 3HTSB 4QPQA 4A6DA 4DOZA 2WV0A 2PJRA 2VPLA 4LIUA 3OL4A 4KITB 3RPUA 2DN0A 4I98B 3C2HA 4L18B 4Y33A 4KIGA 4AYBN 5LEKA 2NNYA 2HQAA 1GXPA 3JR9A 2PEXA 1Z21A 2W4SA 1D1CA 1IDYA 1QGPA 5FKLA 1H88C 2IS6A 2XC7A 1S3JA 4KN7X 2M8EA 5DCFA 5L3GA 2OZ6A 2V6CA 4B3AA 1RNLA 3RPQA 1RUNA 2O8KA 2UWMA 1X4OA 4XRFA 3KZIC 2QCOA 2AS5F 4N9IA 3R0AA 3OYCA 3T8TA 1A5JA 5FKMA 4CA0A 1ZGWA 1A04A 3OS2A 2B0LA 3ERMA 1F9NA 2HYGD 2IBDA 5D6EA 1Z67A 4GO1A 1TC3C 4LG0B 4DYCA 2JSCA 1Z7LA 2Y0SA 4JOMA 1Z3XA 1E3OC 4L9TA 3JAMK 1VNDA 1E2XA 2JRMA 5EYRA 2LREA 4ZYAA 4IXAA 3RI4A 2WB1N 3BR1A 4XONA 2ACJA 2ELJA 3JSOA 2JA5J 1J09A 4K2EA 1W36D 4WWCA 2HPMA 2X6XA 3RTRA 1JKQC 4A12A 3S14J 2EILH 4YEJA 4XOPA 1HQCA 4N4NB 4LB5A 2B63J 2VQCA 1KZHA 2L01A 1T95A 2OCEA 3CUQA 5E8GA 2VKDA 1G2HA 4ENJA 2K9LA 3QP5A 1A6QA 2P4WA 3H0DA 3DP7A 2IA1A 2QGUA 3D5RC 1JTXA 2NVYJ 3PFIA 1MH4A 2P81A 1MMAA 2L3DA 1GXQA 1S72I 1IRGA 2K9MA 3ERED 3MAJA 1N77A 2H1KA 3Q9VA 5GPAA 3VYUB 4R79A 2V1NA 1VZ0A 2IJLA 4RM3A 3K4BA 1TQIA 4C2MJ 2GLOA 1UELB 2M4KA 1R6RA 4Y52J 1AWCA 3I3LA 4BQAA 4IX7A 5DD4A 3WE2A 4RB3C 2DDAA 5GP9A 3Q9SA 1MJAA 1M1EB 1ENHA 1T8IA 2PG4A 5KVRA 1NK3P 1TQMA 2HDWA 4N4OB 2YS9A 3GW2A 2DA3A 3BJOA 2GAUA 3SHFA 1MNDA 3KE2A 4YFXF 1Y8RB 1RPWA 4II3A
chains in the Genus database with same CATH topology
4AYBA 2XF5A 1D0YA 4XLCA 1DQUA 2WAQA 4F52A 4XN0A 3ZXSA 2KDOA 2LBFB 4BDYA 3L2VA 3ZRGA 2XSJC 3ZQQA 1BR1A 3RPUD 2MYSA 4HG2A 4E7SA 3OYMA 3CP2A 1Z3YA 1V5FA 4ANJA 2WY8Q 4U87A 2QKLB 2HVQA 3A4CA 4DJAA 3LSMA 1V5GA 5CQGA 3OYGA 3HG9A 3FBIB 1YX5A 3PNTA 2KZVA 1SFKA 1DGRM 2VKHA 4HEA2 3S3NA 2HZDA 3VSKA 4XLAA 4CH7A 2LG4A 4XR6A 2O5RA 3QYFA 4XMYA 3A2KA 3ZR8X 2JA2A 3L2RA 1BOBA 4MLOA 3TBIA 3K70C 4PJNA 4BGDA 2DCEA 2AQFA 2RNGA 1WJEA 2R4GA 1YE9A 4PSXA 3U21A 4NNJA 5JHFA 2QKMB 3NWTA 1IRXA 1QU3A 3OYBA 3GBGA 2KP6A 3G2BA 1Y6IA 4B48A 3L2WA 2WAFA 3DTKA 4J01A 1WJCA 2VASA 2VL8A 3DQVC 3DKXA 3VSLA 3K4JA 3LSKA 4PJMA 1TZLA 1D1BA 4ZJZA 1X1DA 2L9NA 3ZGKA 2LBFA 3TMOA 4BQQA 3UNGC 2CFOA 1WJDA 2IS1A 3N05A 2M7AA 4E7IA 3K4LA 3LFUA 1V5EA 4NC7A 3VDXA 2V4JC 4AU7A 3A1YA 4X0GA 5KNLA 1S9HA 3OYKA 2WY7Q 3HOTA 3H5RA 4C9YA 5LD2C 4F3QA 4BE2A 2LRDA 2VJ4A 3SEZA 3E1SA 2R7SA 3LL7A 1WFXA 4HRIA 2DXIA 4XKVA 3FHNA 4PJLA 3CP8A 4XQFA 2VLAA 4DIQA 1NG6A 3OS0A 2ZFUA 1Y56A 3OYFA 4EATA 4PFOA 1QHGA 2A5WA 4BE1A 2LOOA 1GLNA 2WADA 2I8DA 4KISA 3M8JA 2JQNA 3W2AA 3OIPA 5LFAA 4H4KC 3CJRB 3AKZA 3OOUA 3S93A 1AA7A 2BOLA 3MKWB 3VWBA 4Y3OA 4J00A 3MD2A 4AVZA 2R7OA 3HUGB 2W00A 2ZSIB 4EYYQ 1G8XA 3CJQB 3DPUA 2VXDA 2VQHA 2F6CA 3H9QA 3OYNA 2R7XA 2KL4A 2GOMA 1PJRA 2Z16A 1WJBA 3K4CA 3M1CA 3OMYA 3EUAA 2IGKA 3DPLC 4BS9A 1BR2A 4BU2A 4P1WA 1E0EA 2L7KA 2WA0A 2L9SA 4CUGA 4E7KA 4P5OA 2CW7A 3DKYA 2VQLA 1WJAA 3K10A 4NC8A 2DOAA 3EUHC 2V7FA 4XORA 2VB6A 4NQWB 3S3OA 2KLOA 3OR1C 2CW8A 4ZTJA 1D1AA 2IS4A 1D0XA 4E7LA 3DLAA 2E5NA 4F92B 2BW3A 2NOJB 1W36C 3D5LA 4ZDLA 3S32A 1X1AA 2WB1A 1N75A 2UV1A 2DJIA 4E7HA 1LKXA 2JVGA 3FBNB 3IP4B 1OLTA 2PMZA 4HSTA 4E7JA 4PSWA 3RQ4A 2IXSA 3HPGA 2LY1A 4B44A 4BXFA 2L2OA 3DTEA 4XN3A 4CCJA 4DBQA 2MABA 4CSWA 4BDZA 4ZDPA 2O0QA 2K5CA 2DT6A 3S3MA 4QPOA 4CCMA 2CS3A 3VYRB 3BCBA 3HKZA 4F93B 4PJJA 2LH9A 4BQOA 4BQNA 1K6YA 3HOSA 1MW7A 2O0PA 2HVRA 3QODA 2M3AA 3LSHA 4U7BA 1T0FC 3OY9A 4CZCA 1MMDA 2VJIA 1NG7A 4BE0A 2E5ZA 4ITVA 4HPQA 4KT6A 3H9GA 3W3CA 1SAUA 4RMNA 2GOXB 2HW2A 1ERDA 4YELA 3DPTA 2UUZA 4C30A 4XM3A 3CESA 3AL0C 2V9KA 2M0MA 4GRIA 3KYLA 2X6WA 3J7AY 5CPRB 2R7QA 5FRMA 2VIXA 3ONQA 3OYHA 1X1BA 2X1DA 2MD0A 2CMPA 3MKYB 2KQRA 1U0JA 3BG7A 2JVHA 2LY2A 3SYTA 3OYEA 3K4NA 1LDKB 3CMMA 4ZC3A 4E4HA 2BW3B 2IGOA 3HC7A 5TGTA 3K4MA 3IUOA 3OR2C 2E60A 2K3PA 2ZXIA 3CF2A 2CV1A 4PFPA 3QYEA 3DU5A 1MNEA 3MKZA 2IGMA 3BG6A 4HSRA 2CH0A 3OL3A 4E7ZA 3OYDA 1G59A 2X1CA 4C2UA 2KRCA 2RQQA 3PFYA 1UAAA 1JI8A 3SDBA 3RCOA 2L5QA 4B3XA 2Q1ZB 3OS1A 3L2QA 2HVSA 1ZELA 4XNFA 1BR4A 3S8PA 5HNHA 3OYLA 2DT7B 2CUZA 4OAYA 2AQEA 3DEEA 2CUJA 3VYTB 2VXZA 3K70D 5CQEA 2XF7A 3VYSB 4BL0B 2R7TA 4PK4A 3QOEA 4XKCA 2ZSHB 3DWLE 2X51A 3IAS2 4E6KG 2XDVA 2P0WA 3E0JB 4XKBA 4LITA 2CV0A 4BUPA 2KRHA 5KCMA 1EA3A 5HOOA 2R7UA 2WAEA 3IAM2 4FASD 4B43A 2HPIA 1D0ZA 2XAUA 3NWSA 3FDYA 5FRNA 3QYBA 2E1MB 2F4IA 3OYAA 4RM2A 2W7NA 4G6TB 2A6TA 4CCLA 2VJJA 3H35A 3H5AA 5KHDA 3K4KA 2W82A 3V42A 4HNUA 2R7WA 4JQFA 2JSPA 3I9V2 3PJRA 3LSGA 3CZ6A 2MC4A 1PYVA 4C2TA 3W2VA 2Z2SB 2W1OA 4F91B 3EPZA 1N78A 2BVMA 2X6YA 4RLFA 2Z1DA 1YX3A 2R7VA 4PUSA 3C2GA 4B47A 2OUMA 3FKJA 2CV2A 4D9JA 4IQJA 4BEHB 5HVQC 2X1EA 2R7RA 1DP3A 4CCOA 3DU6A 4LG3A 2LYCA 2JUGA 5HLTA 2HU9A 4XKWA 3H9JA 1OR7C 4QPQA 1X19A 4RLQA 4DOZA 3KEYA 4II2A 2XF6A 2PJRA 4F55A 2VPLA 4LIUA 3OL4A 4KITB 3UR3C 3OYJA 4FETA 3C2HA 4Y33A 4YRVA 4DBRA 2M7BA 2HQAA 4IZZA 4IKFA 2W4SA 1MMNA 1Z21A 4BACA 1KONA 3HL2A 2WBMA 3PNVA 1D1CA 2M4GA 4DGWB 1FMWA 2IS6A 2KPMA 2XC7A 3L2UA 3RSNA 4KJZA 2UWMA 1X4OA 3BC8A 3KX2A 4ZDOA 3OWTA 3PUBA 3OYCA 4BJ5C 4CA0A 3ZCOA 2MFZA 3OS2A 1UG0A 3LSIA 4LIVA 1WJFA 2FUG2 1Z7LA 2Y0SA 2KHMA 1Z3XA 4JOMA 4XLFA 5FROA 3OIQA 2LREA 4ZYAA 4HNTA 2V6EA 3PSFA 3OYIA 4XONA 2OC6A 2ELJA 4D1QA 3PL8A 2BVLA 3W2WA 1J09A 1P9QC 1W36D 1X1CA 4NUBA 2HPMA 2X6XA 3RTRA 3PSIA 2Q2EB 1X4PA 4YEJA 4XOPA 2OV7A 1TT0A 4ZTFA 4N4NB 4BEHA 5HNFA 3AFHA 4OAZA 2V26A 3TL4X 3AL0B 2VQCA 1DGWY 1T95A 2VQGA 2VKDA 4BJTA 4BJ6C 2K9LA 3SEQA 3MMYB 3H0DA 1LVKA 3F9KA 3EUKL 3SZGA 3D5RC 4XOTA 2ZXHA 1MMAA 2IS2A 2E1MC 1WJ5A 3H5NA 2HNHA 4CCNA 2K9MA 2LC2A 3DTIA 2RREA 2PJRB 2X85A 1N77A 1FMVA 3VYUB 4R79A 2V1NA 4IQ4A 1QHHD 1VZ0A 4RM3A 3K4BA 4OWRB 1UELB 4Y4RA 3HPHA 2M4KA 1R6RA 5CKTA 4XLEA 3I3LA 3K6GA 4IX7A 3HXLA 3D5SC 2F5VA 3PNYA 1MMGA 3BCAA 2VJ5A 4XLHA 2IGNA 3LMMA 4XL9A 3BLYA 2HDWA 4N4OB 1LFPA 1MNDA 4CCKA 1HA8A 4II3A 2KMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFX A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  1DQU A;  2GM4 A;  2W48 A;  4C3I J;  1JJ6 C;  4UY8 I;  3VB2 A;  1ZKG A;  2DQL A;  2V1X A;  3ZRG A;  4EEF G;  4RAF A;  3ZQQ A;  4WX9 A;  5IYB J;  4IHT A;  1BR1 A;  1IXR C;  4IRG A;  3RPU D;  1HOM A;  4E7S A;  5EZG A;  2ZME C;  1FJL A;  2ZJR F;  1B6A A;  3F22 A;  1V5F A;  4ANJ A;  2DA7 A;  1ULY A;  3G1M A;  2DA5 A;  3LA7 A;  2R5Z A;  2PI0 A;  4MEY F;  4HAM A;  5M3F J;  2FNP A;  4JK1 X;  3CO6 C;  1T98 A;  3E5U A;  4CXF A;  1FOY A;  1F5T A;  4OIN F;  2IPQ X;  3FBI B;  3PNT A;  2O03 A;  1SFK A;  2OU2 A;  3CCJ I;  1DP7 P;  3WU2 C;  3ABU A;  4M3B A;  2MW8 A;  3S3N A;  2XV4 S;  1AU7 A;  2JT1 A;  4LB6 B;  1YS6 A;  3ZMD A;  2WV1 A;  2LG4 A;  4G94 A;  3QYF A;  2LD5 A;  2Y9Z A;  3L09 A;  4L5E A;  3ABK H;  4LMY A;  1UMQ A;  2JA2 A;  4C3H J;  3L2R A;  4MLO A;  5HOD A;  3B6C A;  1H9G A;  2GXA A;  1ZYR F;  1CF7 B;  2DCE A;  1SD4 A;  2K9Q A;  3W6J B;  9ANT A;  4IOA F;  5ICF A;  2AQF A;  1FIA A;  3HGG A;  5C44 J;  4PSX A;  2NS7 A;  3RYP A;  1D5V A;  2Z33 A;  4W1U A;  3J81 K;  3U21 A;  2ADU A;  1R58 A;  1OCZ H;  3BDD A;  3NWT A;  1JT0 A;  3GUD A;  1IO2 A;  1ACI A;  3G2B A;  5HDG A;  2JPB A;  5L3E A;  2E2H J;  4B48 A;  4J01 A;  3ZMS A;  2VAS A;  1VQM I;  3VSL A;  1TZL A;  1X1D A;  1BI1 A;  1KYZ A;  3RQI A;  4CDG A;  1AOY A;  4ZH4 F;  2CFO A;  3BTC A;  2DYS H;  2NYX A;  3QPS A;  4AID A;  1D5Y A;  2IS1 A;  3N05 A;  2E7X A;  2CSO A;  3WG7 H;  2NNN A;  3GTQ J;  4OMY A;  4G7H F;  4RB2 C;  4X0G A;  2AUA A;  5DEQ A;  4ON0 A;  3OYK A;  2WY7 Q;  1DUX C;  3H5R A;  4CYD A;  4BAY A;  4RB0 A;  2QQ8 A;  2Z9O A;  2DA1 A;  3SEZ A;  3GYH X;  2CWE A;  2LF7 A;  3GCM A;  3H92 A;  1R71 A;  3LL7 A;  4HRI A;  1LFB A;  5B1B H;  3FHN A;  4PJL A;  3TED A;  1I1G A;  2MA3 A;  5JLW A;  3ASN H;  1FSE A;  4V2F A;  4XQF A;  1LE8 A;  1VQ4 I;  5M5X J;  2JTV A;  2KIM A;  2V9V A;  4PFO A;  2LOO A;  1GLN A;  4ETS A;  5E79 C;  3K2A A;  2STT A;  5LFA A;  3GTL J;  1JHH A;  4BHB A;  1A35 A;  3CCY A;  3S93 A;  2XPU A;  1S7O A;  2ZBK A;  2BOL A;  5L3C A;  1Z77 A;  1MJB A;  1CQT A;  3MD2 A;  4AVZ A;  1FSH A;  5K7F A;  2W00 A;  3Q0V A;  4EM1 A;  2HYJ A;  2K4B A;  1FBS A;  4FT8 A;  6PAX A;  3L7W A;  3DPU A;  3MCZ A;  2VXD A;  4ESJ A;  2RN7 A;  2XUB A;  2ZO4 A;  3H9Q A;  3O6B B;  4X1E A;  3IWZ A;  2R7X A;  5B66 C;  1MBG A;  1CGP A;  3M1C A;  2ID6 A;  1J0R A;  3CCS I;  4N0B A;  1MBE A;  1V55 H;  2IGK A;  2XB5 A;  3CME I;  1F4K A;  1W5S A;  3PO3 J;  3IRR A;  5GTH C;  3P9I A;  4P5O A;  4EQQ A;  3K1M A;  2FMY A;  4A3D J;  2BV6 A;  3F8C A;  3K10 A;  3GZ6 A;  4NC8 A;  1I6X A;  3EUH C;  3F21 A;  4B09 A;  3D0S A;  2A6H F;  2VB6 A;  2XPW A;  1G3Y A;  1QPM A;  3I55 I;  4A5N A;  4ZYD A;  2R5Y A;  2KLO A;  4D5F A;  1IV6 A;  4FE7 A;  2IS4 A;  2HOA A;  2YU9 J;  1BN5 A;  1BJA A;  1D0X A;  2CQK A;  2E5N A;  5L3B A;  1K7A A;  3BR3 A;  2BW3 A;  1USS A;  1Y0U A;  3CF5 F;  4KIF A;  3GTP J;  2WB1 A;  1N75 A;  2O3F A;  4AC0 A;  3S15 J;  3D1N I;  3L00 A;  2CUF A;  3IP4 B;  3A02 A;  4HST A;  4Z6Y A;  1WWX A;  3RQ4 A;  2LP0 A;  1UST A;  1KGS A;  2ZB9 A;  2FE3 A;  4B44 A;  2ZNZ A;  3PIO F;  3CUO A;  3JAM Z;  4CCJ A;  4DBQ A;  5J4Y A;  4EM0 B;  3RDI A;  4CSW A;  4BDZ A;  1TLH B;  2PX9 A;  1OPC A;  2KDZ A;  4QPO A;  3HRT A;  1JT6 A;  4UVB A;  3JRF A;  2Y0M A;  2DA2 A;  3BCB A;  4BQO A;  3VOE A;  2BY3 A;  1XDU A;  4HF2 A;  1MW7 A;  2O0P A;  2HVR A;  2PQ8 A;  3KP6 A;  1XMX A;  3LSH A;  4JP0 A;  3MWM A;  4CZC A;  2VJI A;  2VOP A;  4A3F J;  3C1D A;  3DLL F;  2PJP A;  3PM1 A;  1DPR A;  3HOV J;  3M9A A;  3HSR A;  3MZY A;  2GOX B;  4RMN A;  1LPQ A;  4IHY A;  2HW2 A;  4BYY A;  2D1H A;  2RVC A;  3KLO A;  3QU3 A;  2WAQ N;  3RZD J;  4C30 A;  3RZO J;  3FWE A;  4XM3 A;  5EF6 A;  2QSG X;  3CES A;  3KP5 A;  3CCU I;  2V9K A;  2LTP A;  1R7J A;  2M0M A;  3K7A J;  2QWW A;  3CO7 C;  1AKH B;  3CCV I;  2XKP A;  2DLL A;  4UUS B;  3MKY B;  3E3V A;  2ZC2 A;  3S1N J;  2EFO A;  1JHF A;  3OYE A;  3K4N A;  4XID A;  1RR7 A;  3CC7 I;  4M71 A;  1PP7 U;  3IH4 A;  1JTY A;  3HC7 A;  5TGT A;  3K4M A;  3IUO A;  4BXU A;  2E60 A;  1WSU A;  1U78 A;  1LVA A;  4ZZD A;  3CCR I;  3ZQL A;  1O3R A;  1LFU P;  1U6G A;  1UCR A;  5ICE A;  2BY2 A;  2O0Y A;  2W84 A;  1J7K A;  3BG6 A;  2CH0 A;  3OL3 A;  2X1C A;  4C2U A;  2QBY A;  3V7S A;  5J40 A;  3E5X A;  2ECB A;  5HS7 A;  5A2Q K;  1STZ A;  3E97 A;  5J4V A;  1X3Z B;  4I6Z A;  1XTA A;  5C3E J;  1WPK A;  3FF5 A;  2Q1Z B;  3QPL A;  3CMA I;  1T08 B;  1H9T A;  4L5I A;  4MQV A;  2OQR A;  4L5J A;  4I01 A;  4ZYE A;  3OYL A;  1ZGJ A;  2QQB A;  2CUZ A;  3VYT B;  4LLG F;  4KIC A;  5CQE A;  3VYS B;  3L1P A;  4BL0 B;  2R7T A;  3RKW A;  2V1U A;  3DWL E;  2X51 A;  2YUS A;  5LBQ A;  4RAZ A;  4XLP F;  4LOC A;  1I3Q J;  3G6E I;  4AM3 A;  3E0J B;  3CC4 I;  1ZGA A;  1YIO A;  1DU6 A;  2NS8 A;  4LIT A;  3TW7 A;  1VF9 A;  5J1Y A;  4MFD A;  2JZY A;  1ZRF A;  5KCM A;  5EGO B;  2DOD A;  3I53 A;  2P5L C;  4A3K J;  2ISZ A;  3KIO A;  4NB5 A;  5AON A;  2WAE A;  2RKH A;  2Y31 A;  2V79 A;  2BEO A;  2B9S A;  1E3H A;  3P9K A;  3WU1 B;  4A3B J;  2AO9 A;  3NWS A;  5L3D A;  4HLX A;  1RIO H;  4U7D A;  3FXU A;  4G6T B;  2A6T A;  2VJJ A;  4UUS A;  2ETH A;  3GX4 X;  2GBY A;  5KHD A;  3K4K A;  4L0Z B;  2CFX A;  3J81 Z;  2ESN A;  3FXM A;  3LSG A;  1ETY A;  4FIS A;  4PDK A;  1GUU A;  2GIZ A;  1PYV A;  2G7H A;  5IP7 J;  1MJ9 A;  2XAH A;  4WF2 A;  3W2V A;  4IVN A;  3WE3 A;  2W1O A;  3PO2 J;  3V7C A;  2FEZ A;  3EPZ A;  4JX5 A;  2X6Y A;  3FX3 A;  2QQ9 A;  2YX4 A;  3E5Q A;  2FA5 A;  3GFM A;  1TL8 A;  1FX7 A;  4B47 A;  3WTU C;  3ZN1 A;  3QPT A;  4R1H A;  2ME6 A;  4HQE A;  3BG9 A;  4BEH B;  4E70 A;  2JUC A;  1FC3 A;  4DYQ A;  5E20 A;  3CCM I;  2BE5 F;  1W5C C;  4RGX A;  4NHJ A;  2L4M A;  1DP3 A;  2EIM H;  1BBY A;  1XB4 A;  4CCO A;  2LYC A;  2P6T A;  3LA3 A;  2EV5 A;  2JUG A;  2ISY A;  2GA1 A;  2VPR A;  1OR7 C;  1IJW C;  1YIT I;  4II2 A;  1MBJ A;  1V3F A;  1KU2 A;  3CDH A;  3OYJ A;  3PUF A;  1JXS A;  2BHY A;  3A03 A;  1R4M B;  4JX6 A;  4YRV A;  3CDI A;  3K9T A;  4IPA A;  4DBR A;  3WGI A;  3L9F A;  2XGE A;  1BW6 A;  4IZZ A;  4IKF A;  5IYD J;  5J1U A;  1I6H J;  1KON A;  3K0L A;  2NAZ A;  3PNV A;  3T8R A;  4AWX B;  1FMW A;  2XPV A;  1P2F A;  2BY0 A;  3F3X A;  4A93 J;  1H0M A;  4HDV A;  2HQR A;  3BJ6 A;  2VI6 A;  3BC8 A;  3F6O A;  1U5T C;  3KX2 A;  4ZDO A;  3TDZ C;  2FBH A;  2FD5 A;  5F0F A;  3DCF A;  1OMI A;  2MFZ A;  3LSI A;  3DBR B;  4AVP A;  2VC1 A;  2LMD A;  2YPR A;  1YS7 A;  4UVC A;  4BHP A;  4Q5S F;  3OIQ A;  1EV7 A;  2LSO A;  1LEB A;  2ZJQ F;  4J19 A;  4RBO A;  4A5M A;  1P9Q C;  2Y69 H;  4HF1 A;  1FZP B;  4OIP F;  1RET A;  2PMZ N;  4LLN A;  2Q2E B;  3G1O A;  3BRO A;  4ZTF A;  3RJP A;  4LJZ F;  4DZJ A;  4BEH A;  4OAZ A;  1LQ1 A;  1YRN B;  2KIF A;  1PDN C;  1RRJ A;  2I5U A;  2EWN A;  3O8G A;  3JRE A;  4BH9 A;  3EUK L;  3CQZ J;  4XOT A;  1N25 A;  2RC4 A;  3U1K A;  1MNM C;  1WJ5 A;  2HNH A;  2K9S A;  3KP2 A;  3DTI A;  2DU9 A;  3HHH A;  3QWL A;  4KMU X;  2PJR B;  2X85 A;  4ENM A;  5FKN A;  5LRS A;  3LSR A;  4IQ4 A;  3RIR A;  4QIW N;  2LKP A;  4QTR A;  3OSG A;  2W85 A;  4MHG A;  4Y4R A;  2BXZ A;  2XVC A;  5BPI A;  3WG9 A;  5JR3 A;  4FE4 A;  3GTJ J;  3K6G A;  1FLI A;  4A3J J;  3PNY A;  1I5Z A;  4U0V A;  1MMG A;  4HX4 A;  1GDT A;  4KNY A;  1Z9C A;  2IGN A;  2XHK A;  2DDB A;  5HDN A;  2IEK A;  2OA4 A;  3E7L A;  3GFJ A;  3J80 K;  4HA8 A;  5CLS A;  2QQA A;  1HA8 A;  5GTI C;  2XF5 A;  4XLC A;  3GFL A;  2WAQ A;  4F52 A;  4XN0 A;  1JE8 A;  3JCU C;  2F5E A;  1T0F A;  3I64 A;  3ML6 A;  4WXD A;  5J8F A;  2L9R A;  4BBR J;  1IGN A;  1ZG1 A;  1IC8 A;  2VKE A;  4KIB A;  2GXB A;  2MYS A;  2Q2E A;  2BXY A;  2QA4 I;  2EB7 A;  2AXT C;  5E8I A;  1YRN A;  3DBL B;  5F27 A;  5FFX A;  4B4C A;  2NRA C;  3QOP A;  1OYW A;  3Q3S A;  4TV7 A;  1R5G A;  2QKL B;  4U0Y A;  1FTT A;  3I4P A;  3GVA A;  3A4C A;  1FP2 A;  2QYO A;  5J47 A;  3CUQ B;  5CQG A;  3OYG A;  1IW7 F;  2NVX J;  2EV6 A;  1SD5 A;  4A69 C;  2EPF A;  3DEW A;  4GDF A;  2QSF X;  1P4W A;  2KJB A;  4XRM A;  2DT5 A;  1J9I A;  4HEA 2;  2COB A;  2ESH A;  3BOQ A;  2VT2 A;  2L54 A;  4CH7 A;  4KYW A;  2R7D A;  3H3V K;  3I5U A;  3BR0 A;  1BI2 A;  4XMY A;  3WHB A;  4HNV A;  1T33 A;  2BZT A;  5KK1 A;  5HLH A;  1AHD P;  1BOB A;  2HOE A;  2HKO A;  5DS9 A;  3K70 C;  2HDC A;  3HOY J;  2E19 A;  4BGD A;  1FYM A;  1TTY A;  3JTH A;  2PMH A;  2EFQ A;  3AG1 H;  1F36 A;  1OCT C;  4L9V A;  5A2Q Z;  2QM3 A;  4EV0 A;  3M8F A;  1HKS A;  5JHF A;  2TCT A;  4BBS J;  5L3F A;  1ZAR A;  1OCC H;  3EET A;  1Y6I A;  3DTK A;  5K7H A;  1PUF A;  4M3G A;  3DKX A;  3LSK A;  1FOW A;  1ZLK A;  3V8L A;  4ZJZ A;  3FMS A;  2L9N A;  3WHC A;  1K4S A;  4OMZ A;  4BQQ A;  1XMA A;  3P7N A;  2A68 F;  2MC3 A;  5FKK A;  3FK6 A;  2IRF G;  2EA2 A;  4M73 A;  3LFU A;  1ON2 A;  1V5E A;  3AG4 H;  2H94 A;  1O3T A;  2CW0 F;  1U8R A;  4WXC A;  4UUT A;  5K5Q A;  5BNG A;  5D8K B;  3ZOB A;  1R5H A;  3B02 A;  5BS6 A;  1IRZ A;  2R5Z B;  1FIP A;  2DXI A;  4XKV A;  2JJ7 A;  4UUV A;  4ABZ A;  5E1X A;  2FQ4 A;  4KA4 A;  2O6G E;  4DIQ A;  4RGU A;  3M3Y J;  3OS0 A;  2DW4 A;  2ZFU A;  4MIM A;  3U1D A;  3OYF A;  1W0T A;  2L7Z A;  3BTL A;  3FM3 A;  1MBF A;  3M8J A;  1YHQ I;  1HW5 A;  3LSJ A;  4ENK A;  1SD7 A;  3AKZ A;  1AA7 A;  1QZE A;  3MKW B;  1HC8 A;  4J00 A;  2R92 J;  4XRS A;  2DO7 A;  1JKP C;  1R5I D;  2DTZ A;  1YW9 A;  1YOV B;  1IXC A;  2OQG A;  3V8J A;  3CJQ B;  5LHH A;  1BI0 A;  1T6S A;  1QRY A;  1BOA A;  2A5Y B;  2F6C A;  3OYN A;  2HWV A;  5H6Q A;  2GOM A;  1PJR A;  3PIP F;  1WJB A;  2A69 F;  1G3S A;  1U9N A;  2G0E A;  3DPL C;  2JWT A;  1E0E A;  4CUG A;  4A2U A;  5D8L B;  4E7K A;  1ZHF A;  3H36 A;  1HBX G;  2H8R A;  2P6S A;  3ZP5 A;  3DKY A;  4ZZL A;  2VQL A;  2WTE A;  1B4A A;  2X48 A;  2DOA A;  2JRT A;  3CUQ C;  2ZFW A;  1F1Z A;  4L9N A;  2X0L A;  3LOC A;  4JX4 A;  3S3O A;  3ZQG A;  2CW8 A;  1D1A A;  1XCB A;  1TWF J;  3DLA A;  1WGX A;  3G1L A;  2ELK A;  3H3U A;  4F92 B;  1ZRC A;  3VFZ A;  5J3L A;  1MZB A;  2MGQ A;  4DYR A;  3BZK A;  5EJC A;  2COM A;  1LE8 B;  4D7N A;  1JGS A;  4G6D A;  5DM6 F;  3JRG A;  4MTD A;  2EIJ H;  2UV1 A;  2KKO A;  2OD5 A;  2PMZ A;  4YIF A;  2OZU A;  3KP7 A;  5M5W J;  2HTJ A;  4BXF A;  3LA2 A;  1OIS A;  1QZZ A;  3S16 J;  4ZDP A;  1Q1V A;  3LFK A;  4EJO A;  2O0Q A;  3CCL I;  2NVQ J;  2W57 A;  3F23 A;  2RGV A;  3ZQ7 A;  4EM2 A;  1MD0 A;  4F93 B;  2LH9 A;  3FXK A;  3IKV A;  3EYI A;  4PCQ A;  3MEX A;  1MMS A;  2H27 A;  1JUP A;  2M3A A;  3TQN A;  3B73 A;  3F6V A;  2L7M P;  2WC2 A;  4HX8 A;  1GV5 A;  5F0C A;  1S5L C;  1ZAO A;  2E5Z A;  4ITV A;  3H9G A;  1PVE A;  2MG4 A;  2O8X A;  2VN2 A;  2XAJ A;  4IHV A;  3RKX A;  1FNN A;  1ERD A;  2IP2 A;  3DPT A;  2VBY A;  3C18 A;  3FM5 A;  4PZJ A;  2H1L A;  4X6A J;  5DD8 A;  1I50 J;  1ZN2 A;  5CPR B;  4A0X A;  3IHU A;  1ZK8 A;  2EZL A;  4M6V A;  1UG2 A;  2EIN H;  2KIU A;  3FMR A;  4G6Q A;  3S2W A;  3CC2 I;  2X1D A;  1JJ8 C;  2XGX A;  3I58 A;  3IKT A;  2R5Y B;  1Z6T A;  1U0J A;  3BG7 A;  3BZC A;  1UZC A;  2LY2 A;  4HW0 A;  2JA8 J;  4A6E A;  1LDK B;  2GZW A;  3CMM A;  4ZC3 A;  1MDM A;  5AIQ A;  4A3M J;  2BW3 B;  2HQ5 A;  1SAN A;  1YW8 A;  2HR3 A;  2LDU A;  1FYL A;  1SVL A;  3QPH A;  3RYR A;  5F64 A;  3QYE A;  3DU5 A;  2Y48 A;  3J80 Z;  1TW3 A;  1BW5 A;  2IGM A;  5BMZ A;  1G59 A;  4E7Z A;  3MQ0 A;  4UB6 C;  1FBQ A;  2YX7 A;  5F0H A;  3G71 I;  3S2H J;  1BC7 C;  1Y8Q B;  1JI8 A;  2R7Z J;  4IRH A;  1K61 A;  3ESW B;  1RES A;  4HF0 A;  1IF1 A;  4OIR F;  3OS1 A;  3ASO H;  3LAJ A;  5DUK A;  3S8P A;  5HNH A;  5JVT A;  2DFF A;  3NEU A;  4BXX J;  2P7C B;  4H0E A;  4OAY A;  1ETK A;  2AQE A;  2CJJ A;  2HXI A;  4P9U A;  2LKX A;  1YFH A;  1QA6 A;  4PK4 A;  4XKC A;  3IAS 2;  3WTY C;  5E3M A;  1R4N B;  3L2C A;  3TP0 A;  4I99 C;  5GPC A;  2R93 J;  2QF7 A;  5F1J A;  2E1C A;  2KRH A;  2EA4 A;  2EZH A;  2LNB A;  2OPT A;  3KP3 A;  1YG2 A;  3W6V A;  4EJT A;  1VQ6 I;  4Q48 A;  1EA3 A;  3O3K A;  4UNO A;  4G9Y A;  1ZH5 A;  3FXJ A;  5IT9 K;  3ECH A;  4IJA A;  4B43 A;  4ZYG A;  1VTN C;  1IN6 A;  1D0Z A;  1FT9 A;  5FRN A;  1HSJ A;  2E1M B;  2F4I A;  3OYA A;  3TOB A;  1ZR2 A;  3TP3 A;  4CHU A;  4B8X A;  1R1T A;  1F43 A;  2CQN A;  3RKQ A;  5E1W A;  2DBB A;  2DAO A;  3E6C C;  5K7Z A;  3GFI A;  3BPX A;  1S7A A;  2FBK A;  3V42 A;  3O8H A;  3F8M A;  4JQF A;  1HDP A;  2JSP A;  4GYI A;  3TO6 A;  3IC7 A;  2HDD A;  1DPU A;  1OCR H;  5ILS A;  1X3U A;  3A01 A;  2Z2S B;  2EBI A;  4FTH A;  4F91 B;  5GAD J;  1BIA A;  1N78 A;  4I0B A;  2QBY B;  3V8K A;  1YX3 A;  1O57 A;  2R7V A;  3C2G A;  2EIK H;  5EZH A;  3FKJ A;  4RDU A;  5GAG J;  4D9J A;  4IQJ A;  4M3D A;  1SFO J;  2X1E A;  3P9C A;  4P55 A;  1W1W E;  3NAU A;  5C4X J;  3GLL A;  3T0Y A;  3TO9 A;  1MSF C;  1ZRE A;  2JN6 A;  1O3Q A;  2CQ7 A;  3S2D J;  4PGG A;  5LRR A;  5HLT A;  1KYW A;  2HU9 A;  3H9J A;  1IUF A;  1X19 A;  2MD5 A;  3KEY A;  2KRF A;  3WGG A;  3HEF A;  1KQ9 A;  2EV0 A;  3FK7 A;  4UB8 C;  3UR3 C;  3W6K B;  1WKM A;  3G73 A;  4KN4 X;  1WH7 A;  5IOY A;  2M7B A;  4M6Y A;  4UVA A;  5JVG F;  2M4G A;  1H89 C;  1R00 A;  4WCG A;  1I27 A;  2YR2 A;  3K2Z A;  5J8C A;  3L2U A;  3CMY A;  3HSF A;  3MN2 A;  4KJZ A;  5FKO A;  1ZRD A;  2F4M B;  3DKW A;  3PUB A;  5LGN A;  4BJ5 C;  2D1V A;  3ZMZ A;  4IL6 C;  3FIS A;  1YJN I;  1YTY A;  4EGY A;  2QZ8 A;  1U2W A;  3C2B A;  1WZ2 A;  2FX0 A;  2KHM A;  2XGD A;  4AD9 A;  1XC5 A;  2STW A;  2V6E A;  5M5Y J;  3OYI A;  2FQ3 A;  2OC6 A;  4D1Q A;  3PL8 A;  1MBH A;  3W2W A;  1YO5 C;  3QQA A;  5CVJ A;  1X1C A;  4NUB A;  3OIO A;  5DCM A;  3BWG A;  3JRC A;  4F7Z A;  1Z0X A;  3A0B C;  3GF2 A;  1K78 B;  1PUE E;  1X4P A;  3JRD A;  2OV7 A;  1QPI A;  3QRF F;  4RA2 A;  3TL4 X;  3AL0 B;  4O3M A;  2OCC H;  2QSH X;  2DI3 A;  2KIS A;  3AG2 H;  2VQG A;  2NVU B;  4BJT A;  2O61 A;  3SEQ A;  1ETX A;  1IV8 A;  2JMW A;  1NHA A;  3MMY B;  5F08 A;  1LVK A;  5C4J J;  1R23 A;  1XMK A;  2CRG A;  2LF8 A;  3BR6 A;  4HLY A;  1B72 A;  1SMY F;  3VOD A;  4A3I J;  2E1M C;  2IS2 A;  1FBU A;  4CCN A;  3JRB A;  1WH5 A;  3CTA A;  5FRM A;  1FMV A;  1VQL I;  1TWH J;  2Z99 A;  4EVI A;  2DA6 A;  1NTC A;  4OWR B;  2V1D A;  3BT9 A;  1POG A;  2TRT A;  3GME A;  4XLE A;  2MLK A;  1YQA A;  1JGG A;  3HXL A;  2NXN B;  3BCA A;  4XLH A;  5B3S H;  3NRV A;  1P4A A;  1GVJ A;  3LMM A;  2M1B A;  1FP1 D;  4XL9 A;  4XLN F;  3IV5 A;  1ZG3 A;  1QNT A;  2BGC A;  2GIV A;  4ZYH A;  1HKT A;  1EKE A;  4CCK A;  2JPC A;  3BZ6 A;  4V2G A;  3V4G A;  3OSF A;  1FWZ A;  2P5K A;  1UHM A;  2F5C A;  2J5P A;  2R7F A;  1YLF A;  3N97 A;  4BDY A;  2PLY A;  4RB1 A;  1OYY A;  3L2V A;  1OFC X;  2F48 A;  2KZG A;  1ETO A;  1JUM A;  1R36 A;  1KU7 A;  3QAH A;  4HG2 A;  1T2K A;  3CP2 A;  2DMQ A;  1K78 A;  2HTS A;  2H09 A;  3HM5 A;  1XX5 A;  1SAX A;  3ZN0 A;  1MSE C;  4G7Z F;  4U87 A;  4IHS A;  2HVQ A;  2GA2 A;  4Y17 A;  1D8K A;  1W7P D;  3IWF A;  4DJA A;  1V5G A;  3HG9 A;  4FX4 A;  2QUF A;  1U5T A;  3CLO A;  3KEO A;  2KZV A;  1DGR M;  1IN8 A;  1WRJ A;  2HS5 A;  3H1C A;  5GAH J;  5B5E C;  5FJ8 J;  3E6D A;  2HZD A;  3T1B A;  1S29 A;  3ISP A;  1S8N A;  3S1Q J;  2CG4 A;  1MIJ A;  5KAF C;  3ZR8 X;  3A2K A;  1SD6 A;  2ZKZ A;  1UB9 A;  3J7Z I;  3ELK A;  1J75 A;  1ON1 A;  3TBI A;  3MVP A;  2WWY A;  5E18 F;  1ZLJ A;  4DNC A;  2LFB A;  4M74 A;  2FOK A;  2RNG A;  3H0G J;  1W0U A;  3GTG J;  1QZY A;  2FJ1 A;  2R4G A;  5FLV A;  1C0W A;  3TOA A;  4NNJ A;  3ABT A;  4HYE A;  5FD6 A;  3HDD A;  1IRX A;  1QU3 A;  3OYB A;  3REO A;  2YSR A;  5CVU A;  2KP6 A;  3N4M A;  2WAF A;  5J1R A;  3E6B A;  4XSZ F;  1QVU A;  2VL8 A;  3JRA A;  2CYY A;  3MFK A;  4KMF A;  3R4K A;  4KDP A;  3BP8 A;  3TW6 A;  3ZGK A;  2MLG A;  1V4R A;  3KPH A;  3TMO A;  4G12 A;  4D7M A;  1WJD A;  2ECC A;  1MGT A;  4YII A;  2KT0 A;  5DUI A;  2PBI A;  1XDS A;  2NOG A;  3KFW X;  2M7A A;  3MZ8 A;  4UXN A;  3TDU C;  3K4L A;  1XGS A;  3VDX A;  2V4J C;  2VBW A;  2YU3 A;  3A1Y A;  2A6E F;  2C6Y A;  1VQO I;  1HST A;  5KNL A;  5IT9 Z;  1ONV A;  3HOT A;  3KYC B;  4F3Q A;  1LDJ A;  3DBH B;  3FZV A;  2VJ4 A;  4JYK A;  3WTZ A;  4A0Z A;  4M6X A;  1W4M A;  1T39 A;  2QEN A;  3CP8 A;  1P4X A;  3R60 A;  2VLA A;  1EH8 A;  1Z6R A;  2ELH A;  4RAY A;  3SFZ A;  2VE9 A;  1OCP A;  1QHG A;  3E6M A;  1R1V A;  4MTE A;  4BE1 A;  3KEQ A;  2WAD A;  2I8D A;  1JKO C;  2JQN A;  4S04 A;  5JHU A;  3OIP A;  2P7V B;  4H4K C;  3ZQC A;  3P5J A;  4FHT A;  3IL2 A;  3MZH A;  3VWB A;  3GZ5 A;  3HSE A;  2R3S A;  2K40 A;  2O9L A;  4HOB A;  5F1R A;  1SVM A;  1HKQ A;  1OCO H;  2ZSI B;  1G8X A;  3AAF A;  3SJM A;  2E36 A;  3I4N J;  3FXO A;  3GLX A;  3RKY A;  3U9G A;  3HRS A;  2Z16 A;  4MQ9 F;  3ULQ B;  2DMU A;  3OMY A;  3EUA A;  3WTX C;  2I10 A;  1PUF B;  2HFH A;  4BS9 A;  1YJ9 I;  1BR2 A;  1VFC A;  3KYD B;  2K27 A;  3GWZ A;  2WA0 A;  2L9S A;  4GXO A;  1P7I A;  5E3N A;  4MNU A;  1B9N A;  2Y30 A;  4LD5 A;  2VBZ A;  4MGR A;  5DTD A;  1WJA A;  3OOP A;  1P7J A;  2BYV E;  1ETQ A;  2G9W A;  3SXY A;  4RAG A;  2IA0 A;  3FKI J;  3LAP A;  1J5Y A;  3OR1 C;  1FY7 A;  4BY1 J;  5TRD A;  1QQI A;  4ZTJ A;  5ERI A;  3Q0W A;  1I3A A;  3ZMU A;  5LHI A;  2D5V A;  5AIP A;  4Z2Y A;  1E3P A;  2FBI A;  2NOJ B;  3WGH A;  4ESF A;  3ABL H;  2M0C A;  1W36 C;  3HJE A;  1HLV A;  3FXR A;  4ZDL A;  4LK1 F;  3HRU A;  4M72 A;  4NBQ A;  2A3S A;  2GXG A;  1QVT A;  3FIW A;  1LKX A;  2JVG A;  4E7H A;  1BIB A;  3FBN B;  2HI3 A;  2KJC A;  1P6R A;  2CQX A;  4E7J A;  1GT0 C;  4G7O F;  2IXS A;  3HPG A;  3R0J A;  4LFU A;  2VC0 A;  3DTE A;  4RGR A;  1ITY A;  1BL0 A;  2Q0O A;  2MAB A;  3CCQ I;  2CGP A;  3LSP A;  2CUE A;  2DT6 A;  2DPD A;  3S3M A;  3TGN A;  2K9N A;  5H6R A;  2CS3 A;  1SEU A;  3QP6 A;  3HKZ A;  4PJJ A;  4BQN A;  3WU0 A;  2E71 A;  5DDG A;  1HW1 A;  1U8B A;  1FOX A;  4WXH A;  1T0F C;  2GWR A;  1YI2 I;  4BE0 A;  4HPQ A;  4KT6 A;  2E2J J;  3CCE I;  4I2O A;  2DMP A;  1R49 A;  1I39 A;  3I71 A;  1GHC A;  4YEL A;  1BM9 A;  2UUZ A;  2VE8 A;  1NH3 A;  5D5W B;  2PMU A;  4GRI A;  3R6S A;  3K69 A;  4U88 A;  1FPQ A;  4DQ2 A;  1EH6 A;  4EMS A;  2MD0 A;  2QVO A;  2TDX A;  2CMP A;  2RQP A;  4PGH A;  2JVH A;  1QO0 D;  1EF4 A;  5CVV A;  3SYT A;  1OJL A;  4Q47 A;  5K5O A;  1R9T J;  2K85 A;  4E4H A;  1RI7 A;  2XAS A;  4HQM A;  3DXJ F;  1S6L A;  4FCY A;  2IGO A;  3HOW J;  2NS0 A;  3OR2 C;  5FO5 A;  2K3P A;  4DW6 A;  5EG0 A;  4PFP A;  1B59 A;  1MNE A;  3EDP A;  4EJU A;  2M87 A;  3MKZ A;  1G3W A;  2HKX A;  2F4O B;  4HSR A;  3OYD A;  4RS8 A;  1ZTR A;  4EGZ A;  5LLQ A;  3PFY A;  2E1N A;  2PFB A;  4U0W A;  1XN7 A;  3SDB A;  1Y1V J;  3RCO A;  5IY5 H;  1Y1W J;  4MFE A;  4B3X A;  3L2Q A;  2HVS A;  4XIC A;  1ZEL A;  1BR4 A;  1Y39 A;  3IH3 A;  5IYC J;  1LDD A;  2AHQ A;  4CYC B;  4AIH A;  2VKV A;  4FX0 A;  5FB2 A;  1GVD A;  1WQ2 A;  3DEE A;  3H3Z A;  1XG1 A;  2XAQ A;  2ZME A;  2VXZ A;  3K70 D;  2XF7 A;  3K1N A;  4BKX A;  1IZ1 A;  2ZSH B;  5LEJ A;  4MEX F;  1WHU A;  4HBL A;  2XDV A;  2XSD C;  1Z1D A;  3F8N A;  4BUP A;  3CJT B;  2HEO A;  1X58 A;  5HOO A;  4ASN A;  1WVR A;  3IAM 2;  1APL C;  1YW7 A;  2HPI A;  3GEZ A;  1HF0 A;  2XAU A;  1D8J A;  3FDY A;  3JSP A;  2E34 A;  1EH7 A;  4I76 A;  4WK8 F;  3TO7 A;  2LY9 A;  2FNA A;  4P9F A;  1KU9 A;  2KFD A;  4OIO F;  4S05 A;  4JBA A;  3H5A A;  2VUM J;  2FML A;  2W82 A;  2MSY A;  5EEG A;  2EH3 A;  2R7W A;  1RUO A;  3ZPL A;  3GO5 A;  2W24 A;  2N8G A;  3F0C A;  3I9V 2;  3PJR A;  4GGG A;  4LG0 A;  1MDM B;  5IOZ A;  3SFI A;  1G3T A;  5ED4 A;  1HW2 A;  3ABM H;  2DA4 A;  1MH3 A;  4QSH A;  3HGY A;  5TJJ A;  3JRH A;  4A0Y A;  1WCM J;  1RZ4 A;  5CJ9 A;  3UKG A;  2BVM A;  4RLF A;  3M4O J;  2IT0 A;  5FLX K;  4GFB A;  2UXN A;  3ZMV A;  3ECO A;  2L02 A;  4IHW A;  2CV2 A;  1XSD A;  4CYC A;  2DPU A;  2K02 A;  3I54 A;  5K1Y A;  2R7R A;  4NDL A;  2K86 A;  4I0A A;  5BPD A;  5TIS C;  2E1O A;  3KCC A;  3I4M J;  5FLM J;  5D4S A;  2H6B A;  3HTU A;  4RLQ A;  2XF6 A;  4F55 A;  3CLQ A;  4Y13 A;  1VI0 A;  4FET A;  2RAE A;  3BQY A;  3WTT C;  2EQR A;  4M9S A;  2R0Q C;  4B1R A;  2F5F A;  2W25 A;  2CO5 A;  1MMN A;  4BAC A;  3HL2 A;  2WBM A;  3OV8 A;  2EFP A;  4DGW B;  4N9H A;  2FU4 A;  5E3O A;  2KPM A;  4XSX F;  1JUS A;  1KA8 A;  3RSN A;  2IW5 A;  3S17 J;  2M2E A;  5M3M J;  1LNW A;  4GYG A;  5ICC A;  2AXL A;  3DF8 A;  2DMN A;  3OWT A;  3ZMT A;  1SFX A;  3SZP A;  4YFN F;  5E17 F;  3ZCO A;  1LEA A;  3T5X A;  1UG0 A;  4LIV A;  4O5V A;  1B8I B;  1WJF A;  2FUG 2;  3SQN A;  5H20 A;  4XLF A;  3M7G A;  2M30 A;  5FRO A;  1VQ9 I;  4BY7 J;  1J59 A;  1XGM A;  4HNT A;  5CVR A;  3A01 B;  1ETV A;  2HYF A;  3PSF A;  4I02 A;  4EJV A;  4L0Y B;  4L9J A;  2BVL A;  2DFI A;  2DQR A;  1BA5 A;  4HZF A;  3PSI A;  3JRI A;  2E2I J;  2L7F P;  3COA C;  1HCR A;  2XB0 X;  1TT0 A;  1IAW A;  1IN4 A;  1UHS A;  2M8G X;  4HV6 A;  5HNF A;  3AFH A;  2V26 A;  4OOI A;  5GAE J;  2F5D A;  1DGW Y;  4PJ0 C;  2A61 A;  3EUH A;  3KP4 A;  1K4T A;  4KT5 C;  3DEU A;  2ZCW A;  4BJ6 C;  1P92 A;  2BBY A;  2OAZ A;  1YJW I;  1FEX A;  3EQL F;  3JW4 A;  1TNT A;  3F9K A;  3SZG A;  1TNS A;  3HOZ J;  1A36 A;  2ZXH A;  1WI9 A;  4Y15 A;  3H5N A;  3HB9 A;  4P96 A;  2EFW A;  2D45 A;  2ZXW H;  1SC7 A;  2LC2 A;  1VQ8 I;  2RRE A;  4RGS A;  1VQP I;  1CF7 A;  2XRL A;  1QHH D;  1TW2 A;  5D4R A;  3BY6 A;  3HPH A;  4DZP A;  4CGZ A;  5CKT A;  5DYM A;  4XBF A;  3I56 I;  1NK2 P;  3D5S C;  3HYI A;  2F5V A;  1IUY A;  2XAF A;  1FOK A;  2VJ5 A;  2LVS A;  1E17 A;  1W7P B;  2XKO A;  1X1P A;  3BLY A;  1LFP A;  4M3F A;  2L9V A;  3PQJ A;  3ZQH A;  5D5X B;  5LHG A;  2M9H A;  4BHC A;  5BQT A;  5IPA A;  3FHZ A;  2KMU A;  3KZY A;  5HLI A;  3WTV C;  4AYB A;  1B8I A;  1WI3 A;  3NQO A;  1YIJ I;  1SFE A;  4G8X A;  3ZXS A;  3WTW C;  2DJN A;  2KDO A;  2LBF B;  4IHX A;  4ESB A;  2FXA A;  1REP C;  4A3L J;  5E3L A;  1IXS B;  3FXL A;  4W97 A;  1SVO A;  1Q1H A;  3HOU J;  2KIQ A;  2XSJ C;  3GXO A;  5LGU A;  1ZQ3 P;  3G3Z A;  3OYM A;  2GQQ A;  5DCM B;  2FSW A;  1Z3Y A;  3X2Q H;  4IO9 F;  3LWF A;  4OIQ F;  2M45 A;  1JKR C;  3Q5F A;  3GTO J;  2LKS A;  2WY8 Q;  5EEA A;  2DK8 A;  2EJR A;  1BC8 C;  1TWG J;  3LSM A;  5LGT A;  5DM7 F;  4A3C J;  2HGC A;  2RNJ A;  3M07 A;  1YX5 A;  3ZQI A;  1A6I A;  2JK3 A;  2VKH A;  2IAI A;  2V9P A;  3VSK A;  1MKM A;  4XLA A;  5HS8 A;  2XRN A;  1OYI A;  1B72 B;  4XR6 A;  2O5R A;  3VPR A;  2FF4 A;  3S1R J;  4D5C A;  2XRO A;  2UXX A;  4PJN A;  1B9M A;  3BG3 A;  2BY1 A;  1BJZ A;  1WJE A;  4YIR X;  3HZJ A;  1YE9 A;  5D5V B;  4A3G J;  1W7P A;  2CU7 A;  2QKM B;  2IA2 A;  3F8B A;  3GBG A;  1XCV A;  1IRF A;  3R61 A;  3L2W A;  1BI3 A;  1WJC A;  3HHG A;  3DQV C;  3K4J A;  4PJM A;  2XIG A;  1D1B A;  1HXD A;  2QLZ A;  1U9O A;  1ETW A;  2CQQ A;  2LBF A;  1R1U A;  3GTM J;  1TWC J;  3UNG C;  2B7E A;  2JQ7 A;  4E7I A;  2FRH A;  2X4H A;  4NC7 A;  2P8T A;  4UV8 A;  4AU7 A;  2PN6 A;  2HXO A;  3IRQ A;  3ZQF A;  5ILU A;  4NC6 A;  1S9H A;  2H8W A;  2HZT A;  1XPX A;  1X3W B;  4C9Y A;  5LD2 C;  4BE2 A;  2LRD A;  3O2P E;  1PP8 F;  3E1S A;  4CIC A;  2R7S A;  3FXQ A;  1OKR A;  1WFX A;  3BG5 A;  3DV8 A;  1O4X A;  4AIK A;  3CD6 I;  1NG6 A;  2DTR A;  1DDN A;  2K7L A;  3I0T A;  3LQR A;  1VQK I;  1Y56 A;  1U5T B;  3HKZ N;  1X2N A;  3QU6 A;  2Y75 A;  4EAT A;  3AG3 H;  1L0O C;  5H2F C;  5IP9 J;  5BOX A;  2JA7 J;  2A05 A;  2A5W A;  4KUM A;  3J7A O;  4YFK F;  4KIS A;  4LLL A;  2M34 A;  3W2A A;  1QBJ A;  3CJN A;  3LNQ A;  3CJR B;  2NVT J;  3OOU A;  3HOX J;  2F2E A;  4OU0 A;  4Y3O A;  5FLX Z;  1GV2 A;  2R7O A;  1R22 A;  1G4D A;  3HUG B;  2QEX I;  3LQQ A;  3SDG A;  1D3Y A;  4EYY Q;  1XGO A;  4FQG A;  4EJW A;  5HLG A;  1VQ5 I;  1O3S A;  2VQH A;  2KL4 A;  4S0H B;  2EFN A;  3K4C A;  5B1A H;  1VQ7 I;  5F6F A;  1UFM A;  3EYY A;  2X9D A;  3G4S I;  2DFH A;  1XSV A;  4BU2 A;  4P1W A;  2E35 A;  5CVI A;  4CZZ A;  2L7K A;  2ZJP F;  5DV5 A;  4AIJ A;  1H8A C;  2K3F A;  2CW7 A;  1OR7 A;  2Y0S N;  1AKH A;  4M9Z A;  3PQK A;  1KQ0 A;  1X2M A;  4O6J A;  1T56 A;  1ORK A;  2V7F A;  4XOR A;  1TT5 B;  2ZXJ A;  4NQW B;  4XK4 A;  3U2R A;  1YYV A;  1LUJ B;  3ROU A;  4E7L A;  2XAG A;  5IT3 A;  3NAR A;  3TKY A;  4CO8 A;  1ZG5 A;  5D6F A;  4AUX A;  3HBL A;  2DK5 A;  2M5W A;  1W5T A;  3D5L A;  3DFG A;  2A07 F;  3S32 A;  1X1A A;  5FGM A;  1VQN I;  2DJI A;  1TP4 A;  4LK0 F;  2LR8 A;  4KFC A;  4IOC F;  1RKT A;  1OLT A;  1MBK A;  2EZK A;  2Y2Z A;  2OJE D;  4HDU A;  4PSW A;  3C3W A;  4QLC U;  1J2X A;  1TBX A;  2LY1 A;  2G7U A;  4QWQ A;  1XGN A;  5ICG A;  2L2O A;  2X6O A;  4XN3 A;  5IP6 A;  3CDL A;  1SFU A;  4HX7 A;  3KLN A;  2OTJ I;  2K5C A;  3WTS C;  3M1E A;  3IH2 A;  1FYK A;  4CCM A;  3GZN B;  3VYR B;  4M9X A;  3HUG A;  2ICW G;  3I59 B;  4Y7N J;  5J6X A;  1OQY A;  1K6Y A;  4IEJ A;  4YG2 F;  3HOS A;  2O7O A;  3QOD A;  2MBF A;  3B6A A;  1IN5 A;  4U7B A;  3HIF A;  3OY9 A;  3JTG A;  1MMD A;  3BQZ A;  2K4J A;  2UZK A;  1NG7 A;  4MO7 A;  5EGO A;  1G6N A;  1I1S A;  3BR5 A;  3W3C A;  1RR8 C;  2H6C A;  1SAU A;  1T38 A;  1LB2 A;  2E7W A;  2L0K A;  4I09 A;  1Z7U A;  3BPV A;  5E1Z B;  3AL0 C;  2EZI A;  1L3L A;  3KYL A;  2X6W A;  5F04 A;  3J7A Y;  3KZZ A;  4Q4Z F;  3HRM A;  2R7Q A;  2VIX A;  3ONQ A;  4NQW A;  3OYH A;  4V19 K;  1X1B A;  1B1B A;  1LJ9 A;  4IF4 A;  1K79 A;  4I7H A;  2HQN A;  1HDD C;  2LK2 A;  2KQR A;  1DU0 A;  5HS9 A;  2DOE A;  5FD5 A;  3M8E A;  1K83 J;  2ZXI A;  3CF2 A;  5FFZ A;  2CV1 A;  2RV8 A;  4LGW A;  1IDZ A;  4A3E J;  4ENN A;  5JLX A;  4C3J J;  3FMQ A;  1ZR4 A;  2KRC A;  3BTI A;  5ILV A;  2RQQ A;  3BJA A;  1UAA A;  2OTL I;  2DMT A;  2L5Q A;  2XGC A;  1Z05 A;  5EEH A;  2MH9 A;  4XNF A;  4M3E A;  5CYV A;  2L4A A;  4D0P A;  2DT7 B;  1EJ9 A;  3I59 A;  4BNC A;  1Z91 A;  2CUJ A;  1U3E M;  1FTZ A;  2Z3Y A;  2D2W A;  1XS9 A;  1IG7 A;  4UHT A;  2Y9Y A;  3QOE A;  1TQP A;  1SMT A;  4E6K G;  3WOD F;  3LST A;  5JFR A;  2P0W A;  1O7L A;  2HOT A;  2ZNY A;  4XKB A;  3K1P A;  2CV0 A;  1UJ8 A;  2BHZ A;  2FOW A;  2DFE A;  3C7J A;  2ID3 A;  3V7R A;  2LLK A;  2R7U A;  3SZT A;  5D5U B;  4FAS D;  2VT3 A;  2HOS A;  2IVM A;  3QYB A;  2MH2 A;  2VBX A;  4RM2 A;  2W7N A;  1S7E A;  5K5R A;  1RKW A;  1XD7 A;  4GCV A;  4IRI A;  5EDN A;  4CCL A;  3H35 A;  1Y0N A;  2EK5 A;  4HV5 A;  2ME0 A;  5JI6 A;  1TWA J;  1RC9 A;  4HNU A;  2OF7 A;  2Q8K A;  3F72 A;  3BR2 A;  2MC4 A;  3CZ6 A;  4R8H A;  3BTJ A;  3F8F A;  3Q0U A;  3S1M J;  5HDK A;  4C2T A;  1ODD A;  2J5O A;  5EG0 B;  2DYR H;  2VOO A;  1KQ8 A;  2Z5U A;  4XRS G;  3MKL A;  3KET A;  2ZJ2 A;  2VON A;  3A0H C;  2Z1D A;  3J7Y J;  1XSX A;  2VOD A;  5KAI C;  1O7F A;  2P5V A;  4PUS A;  3VEP A;  2OUM A;  5HVQ C;  1K6O A;  2JA6 J;  1KU3 A;  1IN7 A;  1A31 A;  2RDP A;  4UV9 A;  2DOF A;  2ZME B;  1V54 H;  2OBP A;  3DU6 A;  4LG3 A;  1UHW A;  4XKW A;  3GTK J;  3HTS B;  4QPQ A;  4A6D A;  4DOZ A;  2WV0 A;  2PJR A;  2VPL A;  4LIU A;  3OL4 A;  4KIT B;  3RPU A;  2DN0 A;  4I98 B;  3C2H A;  4L18 B;  4Y33 A;  4KIG A;  4AYB N;  5LEK A;  2NNY A;  2HQA A;  1GXP A;  3JR9 A;  2PEX A;  1Z21 A;  2W4S A;  1D1C A;  1IDY A;  1QGP A;  5FKL A;  1H88 C;  2IS6 A;  2XC7 A;  1S3J A;  4KN7 X;  2M8E A;  5DCF A;  5L3G A;  2OZ6 A;  2V6C A;  4B3A A;  1RNL A;  3RPQ A;  1RUN A;  2O8K A;  2UWM A;  1X4O A;  4XRF A;  3KZI C;  2QCO A;  2AS5 F;  4N9I A;  3R0A A;  3OYC A;  3T8T A;  1A5J A;  5FKM A;  4CA0 A;  1ZGW A;  1A04 A;  3OS2 A;  2B0L A;  3ERM A;  1F9N A;  2HYG D;  2IBD A;  5D6E A;  1Z67 A;  4GO1 A;  1TC3 C;  4LG0 B;  4DYC A;  2JSC A;  1Z7L A;  2Y0S A;  4JOM A;  1Z3X A;  1E3O C;  4L9T A;  3JAM K;  1VND A;  1E2X A;  2JRM A;  5EYR A;  2LRE A;  4ZYA A;  4IXA A;  3RI4 A;  2WB1 N;  3BR1 A;  4XON A;  2ACJ A;  2ELJ A;  3JSO A;  2JA5 J;  1J09 A;  4K2E A;  1W36 D;  4WWC A;  2HPM A;  2X6X A;  3RTR A;  1JKQ C;  4A12 A;  3S14 J;  2EIL H;  4YEJ A;  4XOP A;  1HQC A;  4N4N B;  4LB5 A;  2B63 J;  2VQC A;  1KZH A;  2L01 A;  1T95 A;  2OCE A;  3CUQ A;  5E8G A;  2VKD A;  1G2H A;  4ENJ A;  2K9L A;  3QP5 A;  1A6Q A;  2P4W A;  3H0D A;  3DP7 A;  2IA1 A;  2QGU A;  3D5R C;  1JTX A;  2NVY J;  3PFI A;  1MH4 A;  2P81 A;  1MMA A;  2L3D A;  1GXQ A;  1S72 I;  1IRG A;  2K9M A;  3ERE D;  3MAJ A;  1N77 A;  2H1K A;  3Q9V A;  5GPA A;  3VYU B;  4R79 A;  2V1N A;  1VZ0 A;  2IJL A;  4RM3 A;  3K4B A;  1TQI A;  4C2M J;  2GLO A;  1UEL B;  2M4K A;  1R6R A;  4Y52 J;  1AWC A;  3I3L A;  4BQA A;  4IX7 A;  5DD4 A;  3WE2 A;  4RB3 C;  2DDA A;  5GP9 A;  3Q9S A;  1MJA A;  1M1E B;  1ENH A;  1T8I A;  2PG4 A;  5KVR A;  1NK3 P;  1TQM A;  2HDW A;  4N4O B;  2YS9 A;  3GW2 A;  2DA3 A;  3BJO A;  2GAU A;  3SHF A;  1MND A;  3KE2 A;  4YFX F;  1Y8R B;  1RPW A;  4II3 A; 
#chains in the Genus database with same CATH homology
 4AYB A;  2XF5 A;  1D0Y A;  4XLC A;  1DQU A;  2WAQ A;  4F52 A;  4XN0 A;  3ZXS A;  2KDO A;  2LBF B;  4BDY A;  3L2V A;  3ZRG A;  2XSJ C;  3ZQQ A;  1BR1 A;  3RPU D;  2MYS A;  4HG2 A;  4E7S A;  3OYM A;  3CP2 A;  1Z3Y A;  1V5F A;  4ANJ A;  2WY8 Q;  4U87 A;  2QKL B;  2HVQ A;  3A4C A;  4DJA A;  3LSM A;  1V5G A;  5CQG A;  3OYG A;  3HG9 A;  3FBI B;  1YX5 A;  3PNT A;  2KZV A;  1SFK A;  1DGR M;  2VKH A;  4HEA 2;  3S3N A;  2HZD A;  3VSK A;  4XLA A;  4CH7 A;  2LG4 A;  4XR6 A;  2O5R A;  3QYF A;  4XMY A;  3A2K A;  3ZR8 X;  2JA2 A;  3L2R A;  1BOB A;  4MLO A;  3TBI A;  3K70 C;  4PJN A;  4BGD A;  2DCE A;  2AQF A;  2RNG A;  1WJE A;  2R4G A;  1YE9 A;  4PSX A;  3U21 A;  4NNJ A;  5JHF A;  2QKM B;  3NWT A;  1IRX A;  1QU3 A;  3OYB A;  3GBG A;  2KP6 A;  3G2B A;  1Y6I A;  4B48 A;  3L2W A;  2WAF A;  3DTK A;  4J01 A;  1WJC A;  2VAS A;  2VL8 A;  3DQV C;  3DKX A;  3VSL A;  3K4J A;  3LSK A;  4PJM A;  1TZL A;  1D1B A;  4ZJZ A;  1X1D A;  2L9N A;  3ZGK A;  2LBF A;  3TMO A;  4BQQ A;  3UNG C;  2CFO A;  1WJD A;  2IS1 A;  3N05 A;  2M7A A;  4E7I A;  3K4L A;  3LFU A;  1V5E A;  4NC7 A;  3VDX A;  2V4J C;  4AU7 A;  3A1Y A;  4X0G A;  5KNL A;  1S9H A;  3OYK A;  2WY7 Q;  3HOT A;  3H5R A;  4C9Y A;  5LD2 C;  4F3Q A;  4BE2 A;  2LRD A;  2VJ4 A;  3SEZ A;  3E1S A;  2R7S A;  3LL7 A;  1WFX A;  4HRI A;  2DXI A;  4XKV A;  3FHN A;  4PJL A;  3CP8 A;  4XQF A;  2VLA A;  4DIQ A;  1NG6 A;  3OS0 A;  2ZFU A;  1Y56 A;  3OYF A;  4EAT A;  4PFO A;  1QHG A;  2A5W A;  4BE1 A;  2LOO A;  1GLN A;  2WAD A;  2I8D A;  4KIS A;  3M8J A;  2JQN A;  3W2A A;  3OIP A;  5LFA A;  4H4K C;  3CJR B;  3AKZ A;  3OOU A;  3S93 A;  1AA7 A;  2BOL A;  3MKW B;  3VWB A;  4Y3O A;  4J00 A;  3MD2 A;  4AVZ A;  2R7O A;  3HUG B;  2W00 A;  2ZSI B;  4EYY Q;  1G8X A;  3CJQ B;  3DPU A;  2VXD A;  2VQH A;  2F6C A;  3H9Q A;  3OYN A;  2R7X A;  2KL4 A;  2GOM A;  1PJR A;  2Z16 A;  1WJB A;  3K4C A;  3M1C A;  3OMY A;  3EUA A;  2IGK A;  3DPL C;  4BS9 A;  1BR2 A;  4BU2 A;  4P1W A;  1E0E A;  2L7K A;  2WA0 A;  2L9S A;  4CUG A;  4E7K A;  4P5O A;  2CW7 A;  3DKY A;  2VQL A;  1WJA A;  3K10 A;  4NC8 A;  2DOA A;  3EUH C;  2V7F A;  4XOR A;  2VB6 A;  4NQW B;  3S3O A;  2KLO A;  3OR1 C;  2CW8 A;  4ZTJ A;  1D1A A;  2IS4 A;  1D0X A;  4E7L A;  3DLA A;  2E5N A;  4F92 B;  2BW3 A;  2NOJ B;  1W36 C;  3D5L A;  4ZDL A;  3S32 A;  1X1A A;  2WB1 A;  1N75 A;  2UV1 A;  2DJI A;  4E7H A;  1LKX A;  2JVG A;  3FBN B;  3IP4 B;  1OLT A;  2PMZ A;  4HST A;  4E7J A;  4PSW A;  3RQ4 A;  2IXS A;  3HPG A;  2LY1 A;  4B44 A;  4BXF A;  2L2O A;  3DTE A;  4XN3 A;  4CCJ A;  4DBQ A;  2MAB A;  4CSW A;  4BDZ A;  4ZDP A;  2O0Q A;  2K5C A;  2DT6 A;  3S3M A;  4QPO A;  4CCM A;  2CS3 A;  3VYR B;  3BCB A;  3HKZ A;  4F93 B;  4PJJ A;  2LH9 A;  4BQO A;  4BQN A;  1K6Y A;  3HOS A;  1MW7 A;  2O0P A;  2HVR A;  3QOD A;  2M3A A;  3LSH A;  4U7B A;  1T0F C;  3OY9 A;  4CZC A;  1MMD A;  2VJI A;  1NG7 A;  4BE0 A;  2E5Z A;  4ITV A;  4HPQ A;  4KT6 A;  3H9G A;  3W3C A;  1SAU A;  4RMN A;  2GOX B;  2HW2 A;  1ERD A;  4YEL A;  3DPT A;  2UUZ A;  4C30 A;  4XM3 A;  3CES A;  3AL0 C;  2V9K A;  2M0M A;  4GRI A;  3KYL A;  2X6W A;  3J7A Y;  5CPR B;  2R7Q A;  5FRM A;  2VIX A;  3ONQ A;  3OYH A;  1X1B A;  2X1D A;  2MD0 A;  2CMP A;  3MKY B;  2KQR A;  1U0J A;  3BG7 A;  2JVH A;  2LY2 A;  3SYT A;  3OYE A;  3K4N A;  1LDK B;  3CMM A;  4ZC3 A;  4E4H A;  2BW3 B;  2IGO A;  3HC7 A;  5TGT A;  3K4M A;  3IUO A;  3OR2 C;  2E60 A;  2K3P A;  2ZXI A;  3CF2 A;  2CV1 A;  4PFP A;  3QYE A;  3DU5 A;  1MNE A;  3MKZ A;  2IGM A;  3BG6 A;  4HSR A;  2CH0 A;  3OL3 A;  4E7Z A;  3OYD A;  1G59 A;  2X1C A;  4C2U A;  2KRC A;  2RQQ A;  3PFY A;  1UAA A;  1JI8 A;  3SDB A;  3RCO A;  2L5Q A;  4B3X A;  2Q1Z B;  3OS1 A;  3L2Q A;  2HVS A;  1ZEL A;  4XNF A;  1BR4 A;  3S8P A;  5HNH A;  3OYL A;  2DT7 B;  2CUZ A;  4OAY A;  2AQE A;  3DEE A;  2CUJ A;  3VYT B;  2VXZ A;  3K70 D;  5CQE A;  2XF7 A;  3VYS B;  4BL0 B;  2R7T A;  4PK4 A;  3QOE A;  4XKC A;  2ZSH B;  3DWL E;  2X51 A;  3IAS 2;  4E6K G;  2XDV A;  2P0W A;  3E0J B;  4XKB A;  4LIT A;  2CV0 A;  4BUP A;  2KRH A;  5KCM A;  1EA3 A;  5HOO A;  2R7U A;  2WAE A;  3IAM 2;  4FAS D;  4B43 A;  2HPI A;  1D0Z A;  2XAU A;  3NWS A;  3FDY A;  5FRN A;  3QYB A;  2E1M B;  2F4I A;  3OYA A;  4RM2 A;  2W7N A;  4G6T B;  2A6T A;  4CCL A;  2VJJ A;  3H35 A;  3H5A A;  5KHD A;  3K4K A;  2W82 A;  3V42 A;  4HNU A;  2R7W A;  4JQF A;  2JSP A;  3I9V 2;  3PJR A;  3LSG A;  3CZ6 A;  2MC4 A;  1PYV A;  4C2T A;  3W2V A;  2Z2S B;  2W1O A;  4F91 B;  3EPZ A;  1N78 A;  2BVM A;  2X6Y A;  4RLF A;  2Z1D A;  1YX3 A;  2R7V A;  4PUS A;  3C2G A;  4B47 A;  2OUM A;  3FKJ A;  2CV2 A;  4D9J A;  4IQJ A;  4BEH B;  5HVQ C;  2X1E A;  2R7R A;  1DP3 A;  4CCO A;  3DU6 A;  4LG3 A;  2LYC A;  2JUG A;  5HLT A;  2HU9 A;  4XKW A;  3H9J A;  1OR7 C;  4QPQ A;  1X19 A;  4RLQ A;  4DOZ A;  3KEY A;  4II2 A;  2XF6 A;  2PJR A;  4F55 A;  2VPL A;  4LIU A;  3OL4 A;  4KIT B;  3UR3 C;  3OYJ A;  4FET A;  3C2H A;  4Y33 A;  4YRV A;  4DBR A;  2M7B A;  2HQA A;  4IZZ A;  4IKF A;  2W4S A;  1MMN A;  1Z21 A;  4BAC A;  1KON A;  3HL2 A;  2WBM A;  3PNV A;  1D1C A;  2M4G A;  4DGW B;  1FMW A;  2IS6 A;  2KPM A;  2XC7 A;  3L2U A;  3RSN A;  4KJZ A;  2UWM A;  1X4O A;  3BC8 A;  3KX2 A;  4ZDO A;  3OWT A;  3PUB A;  3OYC A;  4BJ5 C;  4CA0 A;  3ZCO A;  2MFZ A;  3OS2 A;  1UG0 A;  3LSI A;  4LIV A;  1WJF A;  2FUG 2;  1Z7L A;  2Y0S A;  2KHM A;  1Z3X A;  4JOM A;  4XLF A;  5FRO A;  3OIQ A;  2LRE A;  4ZYA A;  4HNT A;  2V6E A;  3PSF A;  3OYI A;  4XON A;  2OC6 A;  2ELJ A;  4D1Q A;  3PL8 A;  2BVL A;  3W2W A;  1J09 A;  1P9Q C;  1W36 D;  1X1C A;  4NUB A;  2HPM A;  2X6X A;  3RTR A;  3PSI A;  2Q2E B;  1X4P A;  4YEJ A;  4XOP A;  2OV7 A;  1TT0 A;  4ZTF A;  4N4N B;  4BEH A;  5HNF A;  3AFH A;  4OAZ A;  2V26 A;  3TL4 X;  3AL0 B;  2VQC A;  1DGW Y;  1T95 A;  2VQG A;  2VKD A;  4BJT A;  4BJ6 C;  2K9L A;  3SEQ A;  3MMY B;  3H0D A;  1LVK A;  3F9K A;  3EUK L;  3SZG A;  3D5R C;  4XOT A;  2ZXH A;  1MMA A;  2IS2 A;  2E1M C;  1WJ5 A;  3H5N A;  2HNH A;  4CCN A;  2K9M A;  2LC2 A;  3DTI A;  2RRE A;  2PJR B;  2X85 A;  1N77 A;  1FMV A;  3VYU B;  4R79 A;  2V1N A;  4IQ4 A;  1QHH D;  1VZ0 A;  4RM3 A;  3K4B A;  4OWR B;  1UEL B;  4Y4R A;  3HPH A;  2M4K A;  1R6R A;  5CKT A;  4XLE A;  3I3L A;  3K6G A;  4IX7 A;  3HXL A;  3D5S C;  2F5V A;  3PNY A;  1MMG A;  3BCA A;  2VJ5 A;  4XLH A;  2IGN A;  3LMM A;  4XL9 A;  3BLY A;  2HDW A;  4N4O B;  1LFP A;  1MND A;  4CCK A;  1HA8 A;  4II3 A;  2KMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...