1WFXA

Crystal structure of ape0204 from aeropyrum pernix
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
180
structure length
180
Chain Sequence
VRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RNA 2'-Phosphotransferase from Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Probable RNA 2'-phosphotransferase
total genus 46
structure length 180
sequence length 180
ec nomenclature ec 2.7.-.-:
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01885 PTS_2-RNA RNA 2'-phosphotransferase, Tpt1 / KptA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.970 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wfxA01
3.20.170.30 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 1wfxA02
1WFXA
chains in the Genus database with same CATH superfamily
5LEJA 2CUFA 3M1EA 3IRQA 1QO0D 2JJ7A 2P7CB 2HDWA 4X1EA 5J8CA 2ZXWH 2X9DA 2E19A 2Y2ZA 1RRJA 2TCTA 1FEXA 3I4NJ 3FX3A 3IRRA 3BG9A 3S3MA 1BBYA 3ZMSA 3GTLJ 1IXCA 2YR2A 2LTPA 2DODA 5H20A 4RB0A 2OPTA 2E34A 4D9JA 4ENJA 5HDKA 4M9SA 3PUBA 4ZYEA 1LDJA 4B1RA 2LY9A 3CCVI 3GTGJ 1I1GA 1A6QA 2A6EF 4G7HF 1O3RA 3Q0UA 2HOTA 4EYYQ 1ZLJA 1AA7A 1KZHA 1AKHB 4NQWA 4L9JA 1DUXC 1LFBA 3TP3A 2DU9A 3LA7A 1KYZA 1R1VA 3IH3A 5IOZA 1BM9A 4MO7A 2LY1A 1LNWA 3U1DA 2V26A 5EEGA 4UB6C 3O3KA 2O9LA 1P7IA 1KU9A 2CGPA 1OYYA 5DCMB 1Z1DA 5FGMA 5E3LA 2X51A 2FF4A 4HLXA 2CV0A 3CZ6A 1Y56A 1SFEA 2VKEA 2BBYA 1WH5A 3SDGA 2VONA 2LC2A 2QVOA 3QP5A 2DO7A 3I0TA 2EBIA 5E8IA 1ZRDA 5GADJ 3S14J 2Z1DA 4L0YB 3X2QH 3L2WA 3Q5FA 4HNTA 1LQ1A 2VT3A 2X48A 4D7NA 2R7RA 1ZN2A 1RESA 5EYRA 3W6KB 4RM2A 3MEXA 3ZOBA 4E7LA 2RGVA 1AU7A 5FLVA 5H6RA 4PJNA 3TW6A 1BR4A 3OR2C 4JBAA 3LA2A 2WY7Q 4R79A 3Q3SA 4DYQA 4D5FA 1VQPI 1HA8A 2PMZA 5FROA 2DA1A 5JR3A 4BE2A 2JVGA 1I1SA 3FHNA 1APLC 4HV6A 1MMSA 4HYEA 4A3JJ 1XD7A 1Z21A 2L7FP 5FRMA 2JVHA 2QQ9A 3HC7A 2DJNA 3I64A 3WTWC 4PCQA 2XRNA 3BP8A 4JYKA 5HNFA 1U5TB 4XBFA 1TNTA 2IJLA 4LITA 2QYOA 2AQEA 4LG0A 1VQ5I 3J7AO 1BI0A 4KICA 1OCCH 3KP2A 1E3OC 3DEEA 1S7AA 1IJWC 4P9FA 4GDFA 3SQNA 2K9SA 2HTSA 3U1KA 1YRNB 1ZGAA 1RC9A 1W36C 2X85A 3ZMZA 3M8JA 2G7HA 4ZZLA 2RAEA 1E17A 4XKBA 3ECHA 4N4NB 3DPUA 2M8EA 3MKLA 4IEJA 1PDNC 2XPVA 3T0YA 3J81K 1T38A 2VN2A 4PDKA 4YIFA 1ZARA 3LFUA 3Q0WA 1ERDA 2EH3A 3OIQA 5FKKA 2EPFA 3WTTC 5TRDA 5M5XJ 1IRXA 2KL4A 3SHFA 1I6XA 1HOMA 5KK1A 1Z0XA 1HDDC 2A5YB 1K7AA 4A3IJ 1PP7U 1IG7A 2XUBA 4QPQA 2DA7A 5JHUA 2WV1A 5E1WA 2BXYA 3CCLI 1FX7A 2R7DA 4A0XA 1BOAA 1XGSA 2M0MA 2I8DA 2PFBA 3V7RA 4JX6A 5FKOA 1UG0A 3NWTA 3A01B 3HXLA 1N77A 4BE1A 4ON0A 4CCMA 3ELKA 1VQ4I 4AUXA 4BJTA 1JUPA 2VXZA 1IDZA 4IRIA 2HVRA 4A6DA 2E7WA 2W82A 2PI0A 2O7OA 2ZSHB 2E2HJ 2Q2EA 2HQNA 3I4PA 1GV5A 3HUGA 4WCGA 3BR1A 3ZP5A 1RIOH 1Z91A 2X1EA 3JW4A 5LGNA 5IT3A 1MJAA 2RREA 3J7AY 4HX4A 4XIDA 2VKVA 3H9GA 2WV0A 3JAMZ 4FETA 3S17J 2V9PA 1R4NB 2V1UA 3EUAA 1RR7A 2H8WA 3TW7A 4CYCA 1ACIA 2KLOA 4NNJA 2OQRA 3O8GA 2R7OA 1G3YA 5CYVA 1ZELA 3OOUA 3L00A 5K7HA 2HQAA 5K7ZA 3FK7A 3CDHA 2XSDC 1XDSA 2VXDA 3LNQA 4Y52J 4I6ZA 5TGTA 1GVJA 1FYKA 1G3WA 1J9IA 1YI2I 2WB1N 3LAPA 2JA2A 4V2GA 2JUGA 2NS0A 2EFQA 3BG6A 1IN6A 3ZQIA 1B9NA 4H4KC 1ZREA 2AUAA 4XLNF 4G12A 4EJWA 2XV4S 4U0YA 2LR8A 4J00A 1I5ZA 3IKTA 3VWBA 5CLSA 4YFNF 2NAZA 1FOKA 4YRVA 2FUG2 5FFXA 3BROA 3W6VA 1ETVA 3WGIA 2IVMA 1JKRC 2A6TA 2NS8A 3ZRGA 4KYWA 2PMHA 4M3DA 3R4KA 3JRIA 1MZBA 2FQ3A 4HDVA 1YHQI 2L4MA 2L01A 5DEQA 2LYCA 2DMPA 2GAUA 4M73A 2HVQA 1XMAA 2CMPA 4ZYGA 5LLQA 2A61A 2DT7B 2XB5A 1T56A 2H8RA 5LGUA 3MKWB 4V19K 5IP9J 1MMDA 2RV8A 2D1HA 2L9NA 3D5LA 3HKZA 4RB1A 1VQ8I 3KP4A 3PNTA 3LAJA 5F27A 1HKTA 4PK4A 3S3OA 5H2FC 1HKQA 3BJ6A 2YU9J 2PQ8A 3MZYA 3RPUA 4M3GA 3DQVC 2O8XA 3PSIA 3S1RJ 1QBJA 4IQ4A 3CLQA 2UXXA 3RZOJ 1QRYA 3ZN1A 1YFHA 1G59A 3GTQJ 4XQFA 2EIJH 2E35A 4BH9A 3V4GA 3K4MA 2IPQX 1DGRM 2Z2SB 4CZCA 3FF5A 3H3VK 2XGDA 4HV5A 1IV8A 4KT5C 2F4OB 3G1OA 1LEAA 3S1MJ 3EUHC 1JTXA 2FNAA 5HLTA 3CDIA 1QPMA 1ZKGA 2JK3A 3F6VA 4UUSA 1TNSA 1OR7C 2DJIA 3B73A 2M5WA 2UZKA 1VNDA 1L0OC 5FLXZ 2Y0MA 3IWZA 4AIKA 4BHCA 1MH3A 2BV6A 3U2RA 3EYIA 4M3BA 1TC3C 2BHYA 5C44J 1P4XA 5BPDA 4L9VA 2O0PA 5E1ZB 1FOWA 3MAJA 2OTJI 1ETXA 2CJJA 3A2KA 1WI9A 4EGZA 2O3FA 4Q47A 2VBXA 2VC1A 1VQMI 4M9XA 1YIJI 3BTJA 2P0WA 4ENMA 1E0EA 3QP6A 1X1AA 4A93J 1OISA 1W7PD 2VJJA 3GTJJ 3BTLA 2KPMA 2BOLA 1KU7A 3C2HA 2G9WA 4M74A 2LOOA 4E7JA 3WG9A 1KYWA 4DBQA 4JX4A 1MMGA 1Z05A 2KJCA 5LHGA 4I76A 4AYBA 1P92A 1EJ9A 2GIZA 5ILVA 2QSGX 3UKGA 5FRNA 3HTUA 2QENA 3VYUB 1O4XA 4UV9A 1YRNA 2PLYA 4BHPA 1T08B 3NAUA 3TMOA 5D4SA 2MFZA 5L3BA 1MD0A 4PJLA 2Y9YA 1U8RA 3Q9VA 2BGCA 2QQ8A 1ETOA 4C3HJ 1SAXA 4RGXA 2XGCA 2EIKH 4I98B 4CGZA 5HDNA 2A6HF 2FSWA 2JSCA 2DFEA 4AM3A 1FNNA 3BR6A 5CVIA 2DT6A 4AWXB 1L3LA 1JKOC 4RGUA 4IL6C 1JTYA 3GZ6A 4AC0A 3ZQ7A 2WA0A 2UWMA 5ILSA 2WAQN 2HDDA 1SFUA 3RKYA 5F1JA 2P6SA 5B3SH 1H0MA 1LKXA 2LY2A 3OYJA 3R61A 2BY1A 2ZO4A 2MABA 4IRHA 1SC7A 2CH0A 3O2PE 5DD8A 4AIJA 4CO8A 2QUFA 4C9YA 1VQ9I 2DA2A 1W7PA 5DYMA 5J6XA 5K5RA 1H8AC 1BC7C 4CH7A 5KVRA 3LMMA 5BPIA 4GRIA 4OWRB 2OA4A 4BQAA 2CSOA 1V4RA 1KQ9A 1R4MB 1OMIA 3M8EA 4D0PA 1EKEA 2P81A 4FQGA 3CD6I 3SYTA 1QZZA 2X6XA 2HU9A 4HX8A 3L09A 1IRFA 3LSTA 3CCSI 1FYMA 4GFBA 2RC4A 4PGGA 2JT1A 5IP7J 4D1QA 3DTIA 5CPRB 2KP6A 2V6CA 1T0FC 2QKMB 1X1BA 3FIWA 5FLXK 3F9KA 3H0DA 2VJ5A 2HOSA 4DIQA 1X3WB 3ZQQA 3RJPA 4RB3C 4GYGA 1U6GA 3W2WA 4ZTJA 3J80K 2PG4A 3JAMK 3OL3A 4Z2YA 2XSJC 2HKOA 2OBPA 4BXXJ 3CO7C 3TBIA 4XRFA 4UUVA 3DLAA 5F64A 5J47A 3ZMDA 5AIPA 4DJAA 4L9NA 5F04A 4ESFA 1MNEA 4CCNA 3IV5A 2HZTA 4I0AA 1VQLI 2ZC2A 1YIOA 4AIDA 4G7OF 2MG4A 2FEZA 1CF7B 2DMQA 3KEOA 4LIVA 2GLOA 2O6GE 2NVYJ 3GZNB 3KIOA 3RQIA 2GA1A 3QPTA 4GCVA 4ESJA 5CVRA 2VASA 1R00A 5L3GA 3RPUD 1KA8A 2R93J 2K86A 2XAFA 1PYVA 3C2GA 3MVPA 4RM3A 2HEOA 4HF1A 3DBRB 3GFIA 4M9ZA 4IHYA 5C4XJ 1B72B 1XDUA 2ZJ2A 4B09A 5DUIA 2EFNA 3QYFA 3DTKA 1Y39A 3FM5A 1EA3A 2PJRB 1DPUA 4XLAA 4ZH4F 4UVAA 1Z7UA 3B6AA 3K9TA 4XLCA 1FJLA 1QHHD 3GTKJ 1HBXG 1LEBA 5DM7F 2QEXI 1GVDA 1LJ9A 1MMNA 3JRGA 1V5FA 1R1TA 2K40A 4WX9A 3WGHA 1A5JA 5KAIC 3FKIJ 1HW5A 5K5QA 4XRMA 4S04A 5HLIA 5HS8A 3G73A 3JCUC 4LMYA 1B8IA 3PFYA 2LSOA 1RNLA 3GTPJ 4BDZA 4UXNA 2OZ6A 3GWZA 1FBUA 2IP2A 4C2MJ 3Q9SA 4C3JJ 6PAXA 4LLNA 5JLXA 3H0GJ 3K1MA 2QSFX 4BDYA 1R7JA 3WU0A 2DYRH 4PGHA 5HVQC 5GPCA 4II3A 3BTIA 3MKYB 3BR0A 2LD5A 3MWMA 2VBYA 4MLOA 4JP0A 4BGDA 4NC6A 4BUPA 2JQNA 1I3QJ 1I50J 2R7QA 5IT9K 1G2HA 1HQCA 3RDIA 2JA7J 4MQVA 3QPLA 3GX4X 4J19A 3GFLA 1O3TA 1UHWA 1W5CC 2RQPA 3OS1A 3VDXA 1OCOH 3LWFA 3MFKA 3JRDA 2R5YB 4D7MA 1TWHJ 1FP1D 2ZFUA 3M07A 4ZJZA 4IQJA 4L5IA 2O03A 3HRMA 5LHHA 1ZG3A 3K1PA 3JTGA 3A4CA 3CESA 5F0FA 2RQQA 3PNVA 2W00A 5L3DA 2IS2A 3OMYA 4U87A 4I99C 1H9GA 1LFUP 3HPGA 2GOMA 3LSGA 2HYJA 5CJ9A 3RPQA 3KLOA 4OIQF 1YW7A 4MFDA 3QOPA 2G0EA 2KJBA 1FSEA 4L5EA 3ZR8X 2WBMA 2GXGA 2WADA 3L2VA 2IXSA 1BR2A 3HIFA 2GQQA 3QWLA 1OCTC 2GOXB 3K2ZA 1HXDA 1Y8QB 2Y9ZA 2GXAA 4FE4A 5FB2A 2KHMA 5D5WB 3TEDA 5LEKA 2DTZA 3ASOH 1B4AA 3MKZA 2QQBA 3GLXA 2DA3A 1T6SA 2R7TA 2OZUA 4EQQA 1AHDP 1OJLA 4LG0B 4PSXA 3GZ5A 1TL8A 1WWXA 2UUZA 4PJJA 3ECOA 4CICA 5JHFA 4KMFA 1JUSA 3WTSC 3DEUA 3PL8A 4MQ9F 1STZA 2M9HA 1SVLA 2HW2A 2Q0OA 4IPAA 2JUCA 3RYPA 3E5XA 3PJRA 1DDNA 5EGOA 3VOEA 3OIOA 1V5EA 1QVUA 4P1WA 1F36A 1IGNA 3S1QJ 1WFXA 3OOPA 3RZDJ 4IHTA 4IHVA 2XPWA 5D8KB 1JE8A 1DP7P 1IDYA 2YPRA 2CW8A 3LFKA 2ID3A 5EGOB 2J5OA 3CCQI 5M3MJ 4GXOA 5M3FJ 2I5UA 2ZNYA 1IAWA 4F7ZA 1TLHB 1R6RA 4HOBA 3M7GA 3CLOA 3G71I 1P2FA 2JRTA 2ZMEC 4BNCA 1SMTA 2H27A 3HJEA 3CC7I 2M3AA 3SEQA 2A05A 3CP2A 1ZK8A 2BVLA 3N05A 2IGNA 2R7ZJ 4CYDA 3M1CA 4Y33A 4C2UA 3GBGA 2ME6A 3AG4H 2A07F 4BAYA 4XLPF 1SVOA 3R60A 3RI4A 2TRTA 2X0LA 1FWZA 2NOJB 3K1NA 2ELHA 3QAHA 3EPZA 2RN7A 1LVKA 2IA0A 1JJ8C 2V4JC 2F5VA 2HGCA 2BYVE 3CJTB 5FKMA 3HRSA 2DMTA 3HPHA 4MFEA 1NK2P 2ZB9A 3KEYA 4YG2F 2DYSH 5F1RA 4A2UA 4A3BJ 1QHGA 2QA4I 5BS6A 3LQRA 1MKMA 2XAUA 2ESNA 2H6BA 2DFFA 4PFPA 3MMYB 1T39A 3GYHX 1MW7A 2L9SA 3I3LA 2EZKA 3OV8A 3DP7A 2W4SA 4Q48A 4CYCB 2B63J 4BBRJ 3G1MA 1POGA 3HOXJ 4Q5SF 4LIUA 2OCEA 5J4YA 1X3ZB 3KYCB 5A2QZ 1NG6A 1USSA 5BQTA 2MD0A 2Y75A 4EJTA 4OAYA 1JGGA 1MSEC 4XICA 2ACJA 1JT0A 2KIQA 4BXUA 5KAFC 1TT5B 3FHZA 2VJIA 4G9YA 3I56I 1ENHA 2ZXJA 2IGOA 2DK8A 2F6CA 1ZR2A 3VSKA 1E3PA 5E3OA 2TDXA 3NWSA 1SD5A 1FYLA 4AYBN 1BL0A 2KIMA 3KEQA 1YW9A 2H1KA 4PJMA 5GPAA 2W85A 1D5YA 2NS7A 2MBFA 2R7VA 3I71A 1MJ9A 2XIGA 4BKXA 4O5VA 2VPLA 1VFCA 1GV2A 2LKPA 3ASNH 2XDVA 3FXRA 4G8XA 4B3AA 1K61A 2XKOA 1TTYA 4QSHA 1P4WA 1LPQA 3CQZJ 1K78A 1S7EA 3W2VA 1WJCA 3H3UA 3HTSB 3S16J 5ED4A 1XS9A 2XB0X 2OCCH 4CCKA 2ZKZA 2W84A 2Q1ZB 2BHZA 4CA0A 2XROA 1K78B 1MBEA 2E36A 1GHCA 2V6EA 1D8JA 3BT9A 3CCJI 5J1RA 2E7XA 2BY0A 2DAOA 2GIVA 4IOAF 3FXKA 5JI6A 1VZ0A 1V5GA 5B1BH 2Y30A 4UUTA 1J75A 2EINH 3R6SA 3BZCA 3K70D 4XN0A 3BPVA 2R7SA 3GEZA 2X4HA 3ZMVA 2K9MA 1G3TA 1QZEA 2JWTA 2EK5A 3CJRB 1V55H 1PVEA 4R8HA 1A31A 1PUFA 2XKPA 4LK1F 3SFZA 5CKTA 4M3FA 5D6EA 4B8XA 3L2QA 4IXAA 4EJVA 4NBQA 2K7LA 2NRAC 4DYCA 2L9RA 3U21A 3WGGA 2NVXJ 1UHMA 3HOZJ 3FZVA 2LG4A 2HOEA 3MN2A 1J59A 3ZQLA 1VQNI 2AO9A 2K9NA 4IO9F 1A35A 2L0KA 4L18B 4A3KJ 5ICCA 5H6QA 1FIPA 1XMXA 3D0SA 3E3VA 3K10A 4NC8A 2JSPA 3L2CA 3KYLA 3IL2A 2DW4A 1UCRA 4XK4A 2Q8KA 4YIIA 4M3EA 2CUZA 4EMSA 2MYSA 1O57A 3U9GA 3TO9A 3HSRA 1B8IB 4YFKF 3QPHA 5L3FA 3HZJA 1NK3P 4XSXF 3CMMA 2JA8J 3GTMJ 4FCYA 3E1SA 3HGYA 1ZLKA 2HS5A 3DLLF 3IWFA 3HOUJ 3RKQA 4EGYA 1YJ9I 1IC8A 4UY8I 5DCMA 4WXCA 1Y0UA 4R1HA 2FRHA 1Z67A 3W6JB 2AHQA 2VE9A 1PP8F 3SZGA 4A3FJ 3L7WA 4N9HA 1QQIA 1BN5A 4L5JA 4DQ2A 4C2TA 1K79A 2E1MC 1W5TA 1UG2A 3KP5A 1AWCA 4IHWA 2W1OA 2KRHA 3HGGA 4M6XA 1U2WA 1OPCA 1FBSA 1XMKA 2ESHA 3D5SC 4XNFA 1VTNC 1TQPA 1GUUA 3TQNA 4WF2A 4HX7A 2H1LA 2ISYA 4DGWB 1XCVA 2M1BA 3GO5A 4HF0A 4F3QA 4HW0A 2D1VA 4E6KG 3K69A 5LBQA 1B59A 3OYDA 1WHUA 4RB2C 1X58A 2OJED 3ABLH 5CVJA 1HW1A 3FWEA 2M4GA 4XOTA 3ESWB 2EIMH 1ON2A 3ZCOA 4I7HA 3E7LA 3DF8A 3RYRA 3KETA 4OAZA 1NG7A 5FD5A 3T8TA 1ODDA 3VFZA 4ZDLA 5IYDJ 4HEA2 2CFOA 4UHTA 3SXYA 3F22A 2LDUA 3AAFA 4RAGA 5CVVA 2AXLA 2H09A 3ZPLA 4DZJA 2HVSA 2F5DA 2IS4A 1XGNA 1BI3A 4EV0A 5K1YA 5IT9Z 2VOOA 3BZKA 3S2HJ 2EV0A 3GW2A 2L3DA 1UMQA 4PUSA 1F1ZA 2VQCA 2DQLA 2JN6A 2LBFA 2OF7A 4AVPA 3FXJA 2QLZA 4LB6B 4F92B 3OYEA 2FA5A 1BI1A 3SDBA 2DA4A 1P4AA 1DGWY 2X6WA 3GLLA 3ROUA 3LOCA 4LGWA 3QYBA 5FKNA 5HS9A 1DP3A 3WG7H 1WJ5A 4EM2A 2XGXA 1JHFA 4A6EA 1ZR4A 1EV7A 3SJMA 3I53A 4KUMA 4CCJA 4HSRA 3P5JA 2LNBA 3IAS2 3TOBA 4CHUA 1R5HA 5AIQA 2M8GX 2PN6A 2K27A 3CCUI 5DCFA 3KZZA 4XLHA 2K3PA 4A3EJ 1Z6RA 3QU3A 5HLHA 3JRAA 3BR2A 3E5QA 3OYFA 1JT6A 3G6EI 1SFKA 2WAFA 2CQKA 1YJNI 2FBKA 1FSHA 2P7VB 1T98A 3VYRB 1WI3A 1UZCA 5E18F 4XKCA 5DDGA 1S7OA 9ANTA 2EFWA 3PO2J 2KIUA 2LVSA 1RKWA 2OAZA 2JPCA 4P9UA 3VB2A 2MC3A 4Y4RA 1WGXA 4KN4X 1SAUA 3K4LA 1YTYA 2YX7A 3KLNA 3A0BC 5GTHC 3DKYA 1LVAA 5IYBJ 3WTVC 3WE3A 5EG0B 3IH2A 2ZSIB 3E6CC 1ITYA 3LA3A 4HSTA 1S6LA 5TISC 1XN7A 1JI8A 2L7ZA 3MD2A 4ZTFA 1FLIA 1N25A 1R5GA 4WK8F 3PUFA 2KT0A 2PMUA 4F93B 2DOEA 5JLWA 1T0FA 3H36A 3CUQC 1XPXA 4DOZA 4U7DA 2P6TA 2HPMA 1WCMJ 2Y69H 3L2UA 2Z33A 2FBHA 4PFOA 1OQYA 1D0YA 1K4TA 1IV6A 1XX5A 2DQRA 1D1AA 3A01A 3OYHA 3GFMA 3DTEA 5E20A 1R22A 2DMUA 2VKHA 2L7MP 2ZXIA 3BPXA 3TO6A 3H1CA 2HXIA 4G94A 3ZGKA 4B47A 1IF1A 1F5TA 2IA1A 3F8CA 4ZDOA 1ULYA 4XLFA 2PEXA 1WZ2A 1MBHA 1Y8RB 5AONA 3TDUC 1WJFA 1R1UA 2FOKA 3OYMA 4QLCU 3H5RA 2EZLA 3JRFA 3H9QA 2F5CA 5HS7A 3SZTA 3IKVA 3K0LA 3HRUA 4CUGA 1BOBA 4P55A 1A36A 1O7FA 2D45A 3K2AA 2CUJA 2IRFG 1B6AA 3K6GA 3M9AA 4GYIA 4BU2A 2QSHX 1Y6IA 4B4CA 3FMQA 3K7AJ 2E71A 1MGTA 1HDPA 4I01A 3RIRA 3OYBA 1SD7A 2NVQJ 3G3ZA 5CQEA 3C2BA 3ZMTA 1D5VA 5A2QK 2VI6A 3M4OJ 3FBNB 4QWQA 4C3IJ 3OSFA 2UV1A 3S1NJ 4DW6A 3CDLA 2V1DA 3LSJA 2DXIA 2H6CA 2QCOA 2OC6A 1XGOA 3C3WA 2EILH 3BJOA 2QBYA 1ON1A 2QWWA 1MSFC 1KGSA 1GXPA 3OSGA 1FZPB 1B9MA 4XKWA 3P9CA 1D0XA 2EA4A 3RCOA 1KU3A 3REOA 4MTDA 3ZQGA 2DLLA 1HKSA 3KP7A 5LRRA 2DBBA 4BQQA 1MBJA 1R23A 3JREA 3O6BB 3KX2A 2E2IJ 3OYLA 3GCMA 3LSMA 2KISA 5GP9A 1K4SA 2R7UA 1W36D 2Z16A 3GMEA 5FFZA 2M7BA 4BY7J 3EYYA 4EJOA 2GBYA 2DMNA 5JFRA 4MTEA 4EATA 4OOIA 2OQGA 4WXDA 1P7JA 4AIHA 4BBSJ 3S2DJ 1IRZA 1R36A 4X0GA 2Y0SN 4FX0A 3K4BA 2AQFA 4BXFA 2VODA 5HNHA 2KDZA 1W5SA 1OLTA 1Z6TA 4HNVA 2NVTJ 2P5VA 4W97A 3DPLC 2RKHA 1E3HA 4Y15A 3JRHA 3ZXSA 1T8IA 3M8FA 2COBA 2O0QA 1QVTA 2BY2A 3E6MA 4MNUA 2ZMEB 3HOSA 3P7NA 5GAEJ 3H5AA 1CGPA 3TL4X 3KZIC 5KNLA 4P5OA 4XONA 2YS9A 5J8FA 3UNGC 3DV8A 4EM0B 1TWFJ 2VUMJ 3VYSB 4J01A 1W0UA 1EH6A 1TT0A 2W48A 3HB9A 3ONQA 5E17F 5BOXA 2CWEA 1WKMA 2DK5A 5J1UA 4ZYHA 2CUEA 4A0YA 3WU2C 2M0CA 5L3EA 3CF5F 2NXNB 2CO5A 2JQ7A 5LRSA 1RZ4A 4EJUA 2MA3A 2EZIA 1GXQA 2D2WA 3AKZA 3OYGA 5LFAA 4CDGA 3S2WA 2LKXA 3J7YJ 4BEHA 2EFPA 1KQ8A 2HI3A 5ICFA 1ZHFA 2K9QA 4EM1A 3VPRA 2M45A 1LUJB 4MHGA 4HF2A 2IS6A 3I55I 3D5RC 4U0WA 1TBXA 2FE3A 2W25A 4XL9A 3R0JA 1VQKI 5E3MA 1SD4A 2M87A 3HKZN 2CW0F 3KZYA 2VJ4A 2ZJRF 2GA2A 2V79A 2V9KA 3K4KA 1C0WA 4TV7A 3T1BA 2CQQA 5F0HA 3K70C 2EA2A 1IZ1A 3JR9A 2HOAA 1Z9CA 3HOYJ 4IHXA 4OIOF 4N9IA 3DBHB 1R49A 2Z99A 1FPQA 1YLFA 3OYCA 4Y17A 4IJAA 2ICWG 4NUBA 2O61A 1OFCX 2HZDA 2X6YA 3BC8A 2L54A 2JPBA 4FT8A 2MH9A 5C3EJ 4Q4ZF 2RDPA 1SANA 3BQZA 3ZMUA 2DT5A 2JTVA 3FMRA 4NC7A 4KFCA 1T2KA 2HYFA 3I59A 1X4OA 1TWGJ 4W1UA 3ABMH 1ORKA 3ULQB 4YFXF 4RGRA 4FE7A 3JRCA 2ZBKA 3FXMA 3I59B 4GO1A 3WU1B 3HDDA 2A5WA 2M4KA 3DEWA 5EF6A 4XRSA 4X6AJ 3AFHA 4G6QA 5ILUA 1IUFA 2F4IA 3BR3A 4F91B 2YUSA 1AOYA 3H92A 2ZFWA 2E60A 1MNDA 1TWCJ 4U0VA 5DUKA 2LP0A 2VPRA 5F08A 3QODA 1HCRA 2JA6J 4BQOA 3BCBA 4N4OB 2QQAA 1ZTRA 1ZYRF 1OCRH 1YS6A 5GAHJ 3BOQA 1G3SA 3GTOJ 1LE8A 1XSDA 3AL0C 4JQFA 2FMLA 1FOXA 3BQYA 3BJAA 1B1BA 3ABTA 3HOWJ 5DTDA 2HPIA 3OY9A 1W1WE 4RDUA 2W24A 2XF5A 2R5ZA 4BE0A 3V8LA 2LFBA 1DU6A 5DM6F 2QGUA 3OR1C 4LG3A 4NHJA 3C7JA 1UB9A 4ZYDA 1BI2A 2OU2A 3CC2I 3PIOF 3K4CA 3A0HC 1G8XA 3BCAA 4IKFA 4BJ5C 4EEFG 1J5YA 3CP8A 4IF4A 4B3XA 1WSUA 1U5TC 1XB4A 2XHKA 1RPWA 2L4AA 1FP2A 1TQMA 3ZQFA 3WTUC 1U9NA 1S3JA 3VSLA 4XMYA 4CZZA 4YIRX 3G1LA 4L0ZB 2L2OA 3E5UA 2V1XA 2DPUA 3AG1H 1GLNA 3E6DA 2CV2A 2LRDA 1HSJA 2RNJA 2VQGA 3KCCA 4KDPA 3KFWX 3IAM2 3EDPA 3OS0A 2BXZA 4KJZA 3BG3A 1YO5C 1D3YA 2HFHA 2IT0A 2ETHA 2OD5A 4A5MA 4F55A 4BHBA 4LFUA 1BC8C 1WJBA 1SFOJ 3I54A 1GDTA 3F8FA 4CCLA 5J40A 3FM3A 2R7WA 3ZQCA 4LD5A 2B7EA 2CQXA 5F0CA 2K5CA 1EH8A 1CF7A 1T95A 1WRJA 2FMYA 3H9JA 1J2XA 1PUEE 3CC4I 1DPRA 2A3SA 2FU4A 3K4JA 3G2BA 1J0RA 4S05A 4IRGA 1WPKA 3ABUA 3BLYA 2XF6A 3AG3H 1YW8A 3ISPA 1I6HJ 2PBIA 4BL0B 1UELB 3S8PA 4MIMA 1XC5A 2IBDA 2XGEA 4KIBA 2E1CA 2IA2A 2DN0A 2FQ4A 1LDDA 4BYYA 3CCYA 4M6VA 1BW6A 1NTCA 3UR3C 3JRBA 2IEKA 2VL8A 1FTTA 5TJJA 2VKDA 4UUSB 2EB7A 1VF9A 3EUKL 1FIAA 1XCBA 1ZRCA 1E2XA 4BACA 1P9QC 1YX3A 1JJ6C 3COAC 1G4DA 2JA5J 3CMAI 3F8MA 3BTCA 1S72I 3QQAA 2B9SA 2A68F 2KKOA 3V7SA 4CXFA 2K4JA 3DBLB 1K6YA 2ZMEA 4KN7X 1MMAA 1WJAA 1VQ6I 5C4JJ 1ONVA 4HDUA 3MZHA 3DCFA 2BW3A 3FXOA 3BY6A 3HRTA 2KIFA 5ERIA 2DA5A 4LOCA 4RA2A 4KMUX 1OYWA 1U9OA 1FMWA 2HYGD 2R3SA 4DNCA 4MEYF 3NEUA 4E7HA 2BW3B 4M71A 5D5XB 4ETSA 5D5UB 3ML6A 3R0AA 1TP4A 1KONA 1ETKA 4XRSG 4BQNA 1AKHA 3PFIA 1ZAOA 4UVCA 2HXOA 2HTJA 4HBLA 2CYYA 1X1CA 4OU0A 3A1YA 1BJZA 2Y0SA 1X4PA 4BEHB 1R5ID 1R71A 4HA8A 3ERMA 1UAAA 2HWVA 4OINF 3A03A 2E2JJ 2DPDA 3TKYA 5IOYA 1LB2A 3S32A 4E7ZA 4G7ZF 4CCOA 1O3SA 2N8GA 3AG2H 5DD4A 5K7FA 2KZGA 2ELKA 2FX0A 2AS5F 1A6IA 1M1EB 2BE5F 2LKSA 4PSWA 5BNGA 2VB6A 4GGGA 5BMZA 2XVCA 3DPTA 3CTAA 4IOCF 3LSKA 3WODF 2DOFA 2DI3A 2K4BA 5E1XA 1P6RA 1VQOI 4RGSA 2MGQA 1W4MA 4UV8A 3HOVJ 1BR1A 2MLGA 4A69C 1G6NA 3ZN0A 1V54H 4ZC3A 1IUYA 1S29A 3S3NA 2G7UA 1O7LA 2IS1A 3TOAA 3VEPA 2K02A 2LH9A 5LGTA 4A3DJ 4Y13A 4U88A 3HSEA 1JHHA 4M72A 1FT9A 3S93A 1JKPC 5IYCJ 5HODA 1X1DA 1JUMA 3MQ0A 3F21A 3TGNA 4CSWA 2GWRA 4RAZA 3K4NA 1W7PB 3CJNA 1XSVA 2JMWA 5LD2C 1TW2A 2HDCA 2CS3A 4A3LJ 3IUOA 3GVAA 2LBFB 4KIGA 2NVUB 2DFIA 4UB8C 2WAEA 4KITB 5ICGA 1NH3A 1ETQA 2VLAA 4NB5A 2LREA 4RLQA 2H94A 4XLEA 2GM4A 1UHSA 2CW7A 3E97A 2MC4A 3HEFA 4JK1X 4OIRF 1ZGWA 1F4KA 1R58A 5J3LA 2NNNA 5J4VA 2IW5A 4KNYA 4A5NA 2VOPA 4KISA 1FOYA 4HPQA 4E7IA 2DDAA 3E0JB 2L5QA 3WHCA 5FKLA 1QU3A 5EEAA 2VQHA 3FBIB 2XAJA 4DYRA 4I0BA 3C1DA 2VBWA 2STTA 2Y31A 2VT2A 3F6OA 1WJDA 2P4WA 1U5TA 2LLKA 4DZPA 2QZ8A 3H35A 2R5ZB 2ECBA 1D1CA 4LB5A 4O6JA 1H88C 3L1PA 1RKTA 2KDOA 2L9VA 1QA6A 5EG0A 3OYAA 4A3MJ 4XKVA 3SFIA 2NYXA 1A04A 5IP6A 4OIPF 1SVMA 2HQ5A 3P9KA 3J7ZI 2Y48A 1QGPA 4LJZF 1IN4A 1REPC 2R7XA 4AVZA 2QM3A 2BZTA 1OYIA 2OTLI 5E79C 3FK6A 4IVNA 2V7FA 3DU5A 5E3NA 1X2MA 2X6OA 2L02A 2I10A 4K2EA 2VBZA 4HQMA 3JSPA 2HR3A 4KA4A 1LE8B 1VQ7I 2R7FA 3PNYA 1X2NA 2CU7A 2NOGA 4I2OA 4A3GJ 1VI0A 2K9LA 1U8BA 5LHIA 2HKXA 5DS9A 2E5NA 3F0CA 4B48A 3DXJF 3GUDA 1HSTA 3ERED 1U0JA 2V1NA 1FMVA 2FBIA 3GF2A 2WY8Q 3OYIA 1I3AA 3I58A 4G6TB 2CQNA 3CJQB 3G4SI 1BJAA 2XAQA 3BR5A 5D5VB 3FXQA 2R0QC 3HG9A 3OYNA 4O3MA 2XRLA 4ZYAA 4RBOA 3QU6A 4KT6A 4JX5A 4FHTA 1BW5A 3QPSA 3PSFA 4ENKA 2GZWA 3OIPA 1JKQC 1B72A 1MIJA 4OMYA 2IAIA 1IN8A 1YJWI 5HLGA 4DBRA 2PJRA 4XSZF 3RTRA 3IH4A 2HQRA 1O3QA 3KE2A 3BG5A 3WTYC 4A3CJ 1Y0NA 3RSNA 2QBYB 1IW7F 1JXSA 2LF7A 3V8JA 3KPHA 2FJ1A 1KQ0A 3HM5A 1HW2A 2X1CA 3FKJA 1OCZH 4H0EA 1WQ2A 4IZZA 3RQ4A 5IPAA 3DKWA 2HNHA 2YU3A 3W2AA 4E7KA 3ZQHA 1Q1HA 3V8KA 3C18A 4EVIA 2LK2A 3S15J 2X1DA 2F2EA 2DFHA 4QIWN 3WTZA 2QF7A 5L3CA 1FBQA 3E6BA 3QYEA 2MW8A 4BY1J 4HRIA 2F4MB 1PUFB 1SEUA 3QRFF 2ME0A 3HYIA 2DA6A 2E5ZA 1MNMC 3F8BA 1MBKA 5M5WJ 3PIPF 1S5LC 2O8KA 1IN5A 2ADUA 1SD6A 1JGSA 1S9HA 2C6YA 2E1MB 1YQAA 1Z7LA 4M6YA 2O5RA 5GAGJ 5FD6A 3SEZA 1DU0A 3WE2A 2OV7A 4ABZA 4RAYA 1K83J 5EZHA 1NHAA 2FNPA 5D8LB 1W0TA 2PMZN 4FX4A 3B6CA 1F9NA 3I9V2 1Q1VA 1Y1WJ 2STWA 5IY5H 3LQQA 1D0ZA 4UNOA 3DKXA 1GT0C 1Z3XA 4LK0F 5CQGA 3EQLF 3FISA 3VODA 4V2FA 2P8TA 3FDYA 1BIAA 4XR6A 3LSPA 2R5YA 1IXSB 2DOAA 4XORA 5KCMA 1YE9A 3KP3A 5HOOA 4WXHA 2M2EA 1ETWA 3OL4A 2ECCA 2JZYA 3H5NA 2XC7A 1K6OA 5M5YJ 2E1NA 3BWGA 2Z3YA 3QOEA 1LFPA 4HLYA 3OS2A 4B43A 4D5CA 3NARA 1QNTA 3JTHA 1RUNA 4UVBA 2DTRA 4IHSA 3PO3J 2F5FA 4NQWB 3T8RA 1YG2A 4WWCA 3OWTA 3WHBA 1HLVA 4ZDPA 2B0LA 2XAHA 5D6FA 4Z6YA 1R9TJ 2EV6A 3DFGA 4HQEA 3HHHA 4YELA 1I39A 2RNGA 1USTA 3A02A 2EJRA 2F48A 3N97A 2WB1A 2ZNZA 1U78A 4HAMA 1ZG5A 2V9VA 2JRMA 4F52A 1YITI 1TZLA 1J09A 4QPOA 4QTRA 5E8GA 2CQ7A 3IC7A 1QPIA 3LSHA 2ZJQF 1ZG1A 4FASD 1D1BA 1FC3A 1OR7A 1Z77A 3V42A 1BIBA 1YX5A 3EETA 5FLMJ 4Y3OA 1ZRFA 3F72A 5EZGA 2FXAA 4U7BA 4MEXF 2LF8A 4PZJA 4OMZA 3IHUA 2EFOA 3F3XA 3B02A 2EV5A 5EEHA 1U3EM 2BY3A 1V3FA 2Z5UA 3CUQA 4HZFA 4NDLA 5FO5A 3JSOA 2EQRA 3D1NI 1N75A 2F5EA 2MD5A 1X19A 1PJRA 1TWAJ 1Z3YA 2P5LC 3DWLE 5EJCA 3MCZA 3CUQB 4E7SA 1F43A 2W7NA 3EUHA 1SFXA 3MZ8A 2EWNA 1ETYA 4RLFA 3PQKA 2PX9A 2WWYA 3CMEI 2CRGA 3FMSA 2KZVA 2J5PA 5JVTA 3CUOA 1MDMB 2IGKA 3M3YJ 1KU2A 4IX7A 2IGMA 2CFXA 1RR8C 4FISA 4MGRA 1UJ8A 3J80Z 3P9IA 2ISZA 2COMA 2YX4A 1MDMA 1N78A 5B1AH 1FY7A 1J7KA 2WC2A 3HL2A 2P5KA 1RETA 3F8NA 1UFMA 2OUMA 5HDGA 3T5XA 3J81Z 5EDNA 1YS7A 4LLLA 2FOWA 2WTEA 4XM3A 3W3CA 2A69F 3GXOA 4FTHA 3HHGA 4ENNA 3HSFA 2NNYA 1I27A 2RVCA 4RMNA 2R92J 1X3UA 2Q2EB 2M30A 2O0YA 4I09A 3HOTA 3TDZC 2ID6A 1H89C 3CMYA 2KRFA 3CO6C 1RI7A 1TQIA 2YSRA 1MBFA 4YEJA 1D8KA 2K85A 1EH7A 4LLGF 1CQTA 3LSIA 3L2RA 3NRVA 2CG4A 1EF4A 4N0BA 2KRCA 5DV5A 2QKLB 4AU7A 3CCMI 3I4MJ 1MJBA 1HF0A 1ZH5A 1TW3A 2KFDA 3BDDA 2W57A 4AD9A 3CCEI 4BJ6C 3ABKH 3H3ZA 2KQRA 4XN3A 2D5VA 2AXTC 2WAQA 3PQJA 3F23A 2M34A 4II2A 2UXNA 3O8HA 1OKRA 4B44A 2R4GA 4JOMA 1OCPA 1IN7A 1DQUA 4A0ZA 3GFJA 2MH2A 3N4MA 4ANJA 4A12A 4HNUA 3HBLA 5F6FA 3IP4B 3DU6A 4HG2A 3L9FA 3LSRA 4PJ0C 2CV1A 1S8NA 1XG1A 4BS9A 3NQOA 4RS8A 2XASA 4ASNA 4L9TA 1LDKB 1ZGJA 2PJPA 4I02A 1ZQ3P 3RKWA 2EZHA 3Q0VA 4RAFA 3WTXC 4P96A 4S0HB 2BVMA 2BEOA 1QZYA 4E70A 3HUGB 5JVGF 3FXUA 3TP0A 1MH4A 1RUOA 1YYVA 3BZ6A 4C30A 4G6DA 3PM1A 2VQLA 5J1YA 2Z9OA 1H9TA 5GTIC 1XGMA 5B5EC 2LMDA 2ZCWA 1T33A 4E4HA 4ESBA 4Y7NJ 1BA5A 1HC8A 1FTZA 3LL7A 3SZPA 5ICEA 2XPUA 3BG7A 3RKXA 3KYDB 1WJEA 2DDBA 3TO7A 2KMUA 3VYTB 1Y1VJ 5D4RA 1XTAA 3AL0B 1WH7A 5KHDA 3I5UA 3OYKA 5B66C 3CF2A 1WVRA 3V7CA 5CVUA 2ELJA 1MBGA 5FJ8J 2L7KA 1YOVB 2ZJPF 2MSYA 2VE8A 2ZXHA 2K3FA 2DCEA 2VC0A 4KIFA 4XOPA 1IXRC 4ZZDA 1X1PA 3FXLA 3KP6A 4ITVA 5K5OA 2GXBA 2FD5A 2MLKA 2XAGA 2VIXA 2E1OA 3CCRI 2M7AA 1IRGA 1IO2A 1SMYF 2XF7A 1XSXA
chains in the Genus database with same CATH topology
4PSWA 4LIVA 2VB6A 3OYFA 1SFKA 2WAFA 3DPTA 3VYRB 3LSKA 2HDWA 4XKCA 2VASA 3RPUD 1BR1A 3C2GA 1PYVA 4RM3A 3S3MA 4ZC3A 4Y4RA 3S3NA 3QYFA 3DTKA 2IS1A 1EA3A 1SAUA 3K4LA 2PJRB 2LH9A 4D9JA 4XLAA 3PUBA 4XLCA 3DKYA 3S93A 1QHHD 2ZSIB 4EYYQ 1X1DA 1AA7A 1MMNA 4HSTA 1V5FA 4CSWA 1JI8A 3MD2A 4ZTFA 3K4NA 5LD2C 4F93B 2CS3A 2LY1A 3IUOA 2LBFB 2V26A 4KITB 2WAEA 3PFYA 2VLAA 4DOZA 2LREA 4RLQA 4BDZA 4XLEA 2X51A 2HPMA 3L2UA 2CW7A 3CZ6A 1Y56A 2MC4A 2CV0A 4PFOA 4BDYA 1D0YA 2LC2A 1D1AA 5HVQC 3MKYB 4II3A 3OYHA 4KISA 3DTEA 4HPQA 4E7IA 2Z1DA 3E0JB 2L5QA 4MLOA 2VKHA 4BGDA 1QU3A 3L2WA 2ZXIA 4B47A 2VQHA 3ZGKA 4BUPA 3FBIB 4HNTA 2JQNA 2R7RA 4ZDOA 2R7QA 4RM2A 4XLFA 4E7LA 1WJDA 4PJNA 1WJFA 3OYMA 1BR4A 3H5RA 3OR2C 3H35A 3OS1A 3VDXA 1D1CA 2WY7Q 4R79A 3H9QA 1HA8A 2PMZA 2ZFUA 4ZJZA 5FROA 4IQJA 2KDOA 4CUGA 1BOBA 3OYAA 4BE2A 4XKVA 2JVGA 3FHNA 3A4CA 3CESA 2CUJA 5FRMA 1Z21A 2JVHA 2RQQA 3K6GA 3HC7A 3PNVA 2W00A 4BU2A 2IS2A 1Y6IA 3OMYA 4U87A 3HPGA 5HNFA 2R7XA 2GOMA 3LSGA 4AVZA 3OYBA 5CQEA 4LITA 2AQEA 3FBNB 3DEEA 2UV1A 3ZR8X 2WADA 2WBMA 2V7FA 3DU5A 3L2VA 2IXSA 1BR2A 2DXIA 2GOXB 2KHMA 1W36C 2OC6A 2X85A 3M8JA 3MKZA 4XKBA 4XKWA 4N4NB 3DPUA 1D0XA 2R7TA 3RCOA 4PSXA 3PNYA 3LFUA 1ERDA 2UUZA 4PJJA 5JHFA 4BQQA 3OIQA 2K9LA 3KX2A 2E5NA 3PL8A 3OYLA 1IRXA 2KL4A 3LSMA 4B48A 2R7UA 1W36D 2HW2A 2Z16A 1U0JA 2M7BA 3PJRA 2V1NA 1FMVA 4QPQA 2WY8Q 3OYIA 4EATA 1V5EA 4G6TB 4P1WA 3CJQB 1WFXA 4X0GA 3K4BA 2AQFA 4BXFA 2CW8A 2M0MA 5HNHA 2I8DA 1UG0A 3NWTA 1OLTA 3HXLA 3HG9A 1N77A 3OYNA 4CCMA 1R6RA 4BE1A 4ZYAA 4KT6A 3DPLC 4BJTA 3ZXSA 3PSFA 2VXZA 3OIPA 2M3AA 2O0QA 3SEQA 3HOSA 3CP2A 3H5AA 2BVLA 4DBRA 2HVRA 2PJRA 3TL4X 2W82A 2IGNA 3N05A 2ZSHB 3RTRA 5KNLA 4P5OA 3M1CA 4XONA 4Y33A 2X1EA 4C2UA 3GBGA 3UNGC 2RREA 3RSNA 3J7AY 3VYSB 4J01A 3H9GA 1TT0A 2X1CA 4FETA 3FKJA 3ONQA 3EUAA 2NOJB 4IZZA 3RQ4A 2KLOA 4NNJA 2HNHA 3W2AA 4E7KA 3EPZA 1LVKA 2R7OA 2V4JC 1ZELA 3OOUA 2F5VA 2HQAA 2X1DA 2VXDA 3HPHA 4HRIA 5TGTA 3QYEA 3AKZA 3KEYA 3OYGA 5LFAA 1QHGA 2E5ZA 4BEHA 2JA2A 2XAUA 2JUGA 3BG6A 4H4KC 4PFPA 3MMYB 1MW7A 1S9HA 2L9SA 3I3LA 2IS6A 3D5RC 2E1MB 2W4SA 1Z7LA 4J00A 2O5RA 4XL9A 3SEZA 2OV7A 4LIUA 3VWBA 2VJ4A 3I9V2 1NG6A 3K4KA 2V9KA 2MD0A 1D0ZA 2FUG2 4YRVA 3DKXA 3K70C 4OAYA 1Z3XA 5CQGA 3FDYA 2A6TA 4XR6A 3ZRGA 2DOAA 4XORA 5KCMA 1YE9A 5HOOA 3OYCA 2VJIA 3OL4A 4NUBA 2HZDA 2IGOA 2LYCA 2X6YA 3BC8A 2F6CA 3H5NA 2HVQA 3VSKA 2XC7A 2CMPA 3NWSA 2DT7B 3QOEA 3MKWB 1LFPA 4PJMA 3OS2A 4NC7A 2R7VA 1MMDA 4B43A 3HKZA 2L9NA 3D5LA 2VPLA 1X4OA 4NQWB 3PNTA 2XDVA 3OWTA 4PK4A 3S3OA 4ZDPA 3DQVC 3W2VA 1WJCA 4YELA 2RNGA 3PSIA 4IQ4A 2WB1A 4CCKA 4F52A 2A5WA 2M4KA 1TZLA 1G59A 1J09A 2Q1ZB 4XQFA 4QPOA 4CA0A 3AFHA 2F4IA 3LSHA 4F91B 2V6EA 4FASD 3K4MA 1D1BA 2E60A 1MNDA 1DGRM 2Z2SB 4CZCA 3QODA 3V42A 1YX5A 4Y3OA 4BQOA 1VZ0A 3BCBA 4N4OB 1V5GA 4U7BA 3EUHC 3K70D 4XN0A 2R7SA 5HLTA 3AL0C 4JQFA 1OR7C 1N75A 2DJIA 2K9MA 3CJRB 1X19A 1PJRA 1Z3YA 2HPIA 3DWLE 3OY9A 2XF5A 5CKTA 4E7SA 2W7NA 4BE0A 3L2QA 4RLFA 3OR1C 4LG3A 3U21A 2KZVA 2O0PA 3K4CA 2LG4A 2IGKA 1G8XA 3BCAA 4IKFA 4BJ5C 4IX7A 3A2KA 2IGMA 3CP8A 4B3XA 4NC8A 3K10A 1N78A 3VSLA 2JSPA 4XMYA 3HL2A 2P0WA 3KYLA 1E0EA 1X1AA 2VJJA 2OUMA 2L2OA 2KPMA 2BOLA 2CUZA 4XM3A 1GLNA 3W3CA 2MYSA 2CV2A 2LRDA 2XF7A 2VQGA 3C2HA 2LOOA 4RMNA 4E7JA 3IAM2 3OS0A 4DBQA 4KJZA 2Q2EB 1MMGA 3CMMA 3HOTA 4AYBA 3E1SA 4F55A 1WJBA 5FRNA 4YEJA 3VYUB 3TMOA 4CCLA 2R7WA 2MFZA 3LSIA 3L2RA 2K5CA 4PJLA 1T95A 3H9JA 2KRCA 3SZGA 2QKLB 4AU7A 3K4JA 4C2TA 3G2BA 2E1MC 4BJ6C 4XN3A 2KQRA 3BLYA 2WAQA 2XF6A 2W1OA 2KRHA 4II2A 4B44A 3D5SC 2DT6A 4XNFA 2R4GA 4JOMA 1UELB 4BL0B 3S8PA 1DQUA 4DGWB 4ANJA 4HNUA 4F3QA 3IP4B 3UR3C 2UWMA 2WA0A 3DU6A 4HG2A 2VL8A 2CV1A 2VKDA 4BS9A 4E6KG 3OYDA 3EUKL 1LDKB 1LKXA 3OYJA 2M4GA 4BACA 2MABA 4XOTA 3ZCOA 2BVMA 2CH0A 1YX3A 1P9QC 3HUGB 4OAZA 1NG7A 4C9YA 4CH7A 4ZDLA 3LMMA 2CFOA 4HEA2 4GRIA 4OWRB 4C30A 1K6YA 2VQLA 2HVSA 1MMAA 1WJAA 2IS4A 4E4HA 2BW3A 3LL7A 3SYTA 2X6XA 2HU9A 3BG7A 4PUSA 2VQCA 2LBFA 1WJEA 1FMWA 3VYTB 2KMUA 4F92B 3OYEA 3AL0B 4E7HA 2BW3B 5KHDA 3OYKA 3CF2A 3SDBA 4D1QA 1DGWY 1KONA 2X6WA 3DTIA 5CPRB 4BQNA 2KP6A 3QYBA 2ELJA 1T0FC 2QKMB 1X1BA 2L7KA 3F9KA 2VJ5A 3H0DA 4DIQA 3ZQQA 2ZXHA 3W2WA 4ZTJA 1X1CA 2DCEA 4XOPA 3A1YA 1DP3A 1WJ5A 2Y0SA 1X4PA 3OL3A 2XSJC 4BEHB 3TBIA 1UAAA 3DLAA 4ITVA 4CCJA 4DJAA 4HSRA 3IAS2 2VIXA 1MNEA 4CCNA 3S32A 4E7ZA 4CCOA 2M7AA 4XLHA 2K3PA 2LY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFX A; 
#chains in the Genus database with same CATH topology
 5LEJ A;  2CUF A;  3M1E A;  3IRQ A;  1QO0 D;  2JJ7 A;  2P7C B;  2HDW A;  4X1E A;  5J8C A;  2ZXW H;  2X9D A;  2E19 A;  2Y2Z A;  1RRJ A;  2TCT A;  1FEX A;  3I4N J;  3FX3 A;  3IRR A;  3BG9 A;  3S3M A;  1BBY A;  3ZMS A;  3GTL J;  1IXC A;  2YR2 A;  2LTP A;  2DOD A;  5H20 A;  4RB0 A;  2OPT A;  2E34 A;  4D9J A;  4ENJ A;  5HDK A;  4M9S A;  3PUB A;  4ZYE A;  1LDJ A;  4B1R A;  2LY9 A;  3CCV I;  3GTG J;  1I1G A;  1A6Q A;  2A6E F;  4G7H F;  1O3R A;  3Q0U A;  2HOT A;  4EYY Q;  1ZLJ A;  1AA7 A;  1KZH A;  1AKH B;  4NQW A;  4L9J A;  1DUX C;  1LFB A;  3TP3 A;  2DU9 A;  3LA7 A;  1KYZ A;  1R1V A;  3IH3 A;  5IOZ A;  1BM9 A;  4MO7 A;  2LY1 A;  1LNW A;  3U1D A;  2V26 A;  5EEG A;  4UB6 C;  3O3K A;  2O9L A;  1P7I A;  1KU9 A;  2CGP A;  1OYY A;  5DCM B;  1Z1D A;  5FGM A;  5E3L A;  2X51 A;  2FF4 A;  4HLX A;  2CV0 A;  3CZ6 A;  1Y56 A;  1SFE A;  2VKE A;  2BBY A;  1WH5 A;  3SDG A;  2VON A;  2LC2 A;  2QVO A;  3QP5 A;  2DO7 A;  3I0T A;  2EBI A;  5E8I A;  1ZRD A;  5GAD J;  3S14 J;  2Z1D A;  4L0Y B;  3X2Q H;  3L2W A;  3Q5F A;  4HNT A;  1LQ1 A;  2VT3 A;  2X48 A;  4D7N A;  2R7R A;  1ZN2 A;  1RES A;  5EYR A;  3W6K B;  4RM2 A;  3MEX A;  3ZOB A;  4E7L A;  2RGV A;  1AU7 A;  5FLV A;  5H6R A;  4PJN A;  3TW6 A;  1BR4 A;  3OR2 C;  4JBA A;  3LA2 A;  2WY7 Q;  4R79 A;  3Q3S A;  4DYQ A;  4D5F A;  1VQP I;  1HA8 A;  2PMZ A;  5FRO A;  2DA1 A;  5JR3 A;  4BE2 A;  2JVG A;  1I1S A;  3FHN A;  1APL C;  4HV6 A;  1MMS A;  4HYE A;  4A3J J;  1XD7 A;  1Z21 A;  2L7F P;  5FRM A;  2JVH A;  2QQ9 A;  3HC7 A;  2DJN A;  3I64 A;  3WTW C;  4PCQ A;  2XRN A;  3BP8 A;  4JYK A;  5HNF A;  1U5T B;  4XBF A;  1TNT A;  2IJL A;  4LIT A;  2QYO A;  2AQE A;  4LG0 A;  1VQ5 I;  3J7A O;  1BI0 A;  4KIC A;  1OCC H;  3KP2 A;  1E3O C;  3DEE A;  1S7A A;  1IJW C;  4P9F A;  4GDF A;  3SQN A;  2K9S A;  2HTS A;  3U1K A;  1YRN B;  1ZGA A;  1RC9 A;  1W36 C;  2X85 A;  3ZMZ A;  3M8J A;  2G7H A;  4ZZL A;  2RAE A;  1E17 A;  4XKB A;  3ECH A;  4N4N B;  3DPU A;  2M8E A;  3MKL A;  4IEJ A;  1PDN C;  2XPV A;  3T0Y A;  3J81 K;  1T38 A;  2VN2 A;  4PDK A;  4YIF A;  1ZAR A;  3LFU A;  3Q0W A;  1ERD A;  2EH3 A;  3OIQ A;  5FKK A;  2EPF A;  3WTT C;  5TRD A;  5M5X J;  1IRX A;  2KL4 A;  3SHF A;  1I6X A;  1HOM A;  5KK1 A;  1Z0X A;  1HDD C;  2A5Y B;  1K7A A;  4A3I J;  1PP7 U;  1IG7 A;  2XUB A;  4QPQ A;  2DA7 A;  5JHU A;  2WV1 A;  5E1W A;  2BXY A;  3CCL I;  1FX7 A;  2R7D A;  4A0X A;  1BOA A;  1XGS A;  2M0M A;  2I8D A;  2PFB A;  3V7R A;  4JX6 A;  5FKO A;  1UG0 A;  3NWT A;  3A01 B;  3HXL A;  1N77 A;  4BE1 A;  4ON0 A;  4CCM A;  3ELK A;  1VQ4 I;  4AUX A;  4BJT A;  1JUP A;  2VXZ A;  1IDZ A;  4IRI A;  2HVR A;  4A6D A;  2E7W A;  2W82 A;  2PI0 A;  2O7O A;  2ZSH B;  2E2H J;  2Q2E A;  2HQN A;  3I4P A;  1GV5 A;  3HUG A;  4WCG A;  3BR1 A;  3ZP5 A;  1RIO H;  1Z91 A;  2X1E A;  3JW4 A;  5LGN A;  5IT3 A;  1MJA A;  2RRE A;  3J7A Y;  4HX4 A;  4XID A;  2VKV A;  3H9G A;  2WV0 A;  3JAM Z;  4FET A;  3S17 J;  2V9P A;  1R4N B;  2V1U A;  3EUA A;  1RR7 A;  2H8W A;  3TW7 A;  4CYC A;  1ACI A;  2KLO A;  4NNJ A;  2OQR A;  3O8G A;  2R7O A;  1G3Y A;  5CYV A;  1ZEL A;  3OOU A;  3L00 A;  5K7H A;  2HQA A;  5K7Z A;  3FK7 A;  3CDH A;  2XSD C;  1XDS A;  2VXD A;  3LNQ A;  4Y52 J;  4I6Z A;  5TGT A;  1GVJ A;  1FYK A;  1G3W A;  1J9I A;  1YI2 I;  2WB1 N;  3LAP A;  2JA2 A;  4V2G A;  2JUG A;  2NS0 A;  2EFQ A;  3BG6 A;  1IN6 A;  3ZQI A;  1B9N A;  4H4K C;  1ZRE A;  2AUA A;  4XLN F;  4G12 A;  4EJW A;  2XV4 S;  4U0Y A;  2LR8 A;  4J00 A;  1I5Z A;  3IKT A;  3VWB A;  5CLS A;  4YFN F;  2NAZ A;  1FOK A;  4YRV A;  2FUG 2;  5FFX A;  3BRO A;  3W6V A;  1ETV A;  3WGI A;  2IVM A;  1JKR C;  2A6T A;  2NS8 A;  3ZRG A;  4KYW A;  2PMH A;  4M3D A;  3R4K A;  3JRI A;  1MZB A;  2FQ3 A;  4HDV A;  1YHQ I;  2L4M A;  2L01 A;  5DEQ A;  2LYC A;  2DMP A;  2GAU A;  4M73 A;  2HVQ A;  1XMA A;  2CMP A;  4ZYG A;  5LLQ A;  2A61 A;  2DT7 B;  2XB5 A;  1T56 A;  2H8R A;  5LGU A;  3MKW B;  4V19 K;  5IP9 J;  1MMD A;  2RV8 A;  2D1H A;  2L9N A;  3D5L A;  3HKZ A;  4RB1 A;  1VQ8 I;  3KP4 A;  3PNT A;  3LAJ A;  5F27 A;  1HKT A;  4PK4 A;  3S3O A;  5H2F C;  1HKQ A;  3BJ6 A;  2YU9 J;  2PQ8 A;  3MZY A;  3RPU A;  4M3G A;  3DQV C;  2O8X A;  3PSI A;  3S1R J;  1QBJ A;  4IQ4 A;  3CLQ A;  2UXX A;  3RZO J;  1QRY A;  3ZN1 A;  1YFH A;  1G59 A;  3GTQ J;  4XQF A;  2EIJ H;  2E35 A;  4BH9 A;  3V4G A;  3K4M A;  2IPQ X;  1DGR M;  2Z2S B;  4CZC A;  3FF5 A;  3H3V K;  2XGD A;  4HV5 A;  1IV8 A;  4KT5 C;  2F4O B;  3G1O A;  1LEA A;  3S1M J;  3EUH C;  1JTX A;  2FNA A;  5HLT A;  3CDI A;  1QPM A;  1ZKG A;  2JK3 A;  3F6V A;  4UUS A;  1TNS A;  1OR7 C;  2DJI A;  3B73 A;  2M5W A;  2UZK A;  1VND A;  1L0O C;  5FLX Z;  2Y0M A;  3IWZ A;  4AIK A;  4BHC A;  1MH3 A;  2BV6 A;  3U2R A;  3EYI A;  4M3B A;  1TC3 C;  2BHY A;  5C44 J;  1P4X A;  5BPD A;  4L9V A;  2O0P A;  5E1Z B;  1FOW A;  3MAJ A;  2OTJ I;  1ETX A;  2CJJ A;  3A2K A;  1WI9 A;  4EGZ A;  2O3F A;  4Q47 A;  2VBX A;  2VC1 A;  1VQM I;  4M9X A;  1YIJ I;  3BTJ A;  2P0W A;  4ENM A;  1E0E A;  3QP6 A;  1X1A A;  4A93 J;  1OIS A;  1W7P D;  2VJJ A;  3GTJ J;  3BTL A;  2KPM A;  2BOL A;  1KU7 A;  3C2H A;  2G9W A;  4M74 A;  2LOO A;  4E7J A;  3WG9 A;  1KYW A;  4DBQ A;  4JX4 A;  1MMG A;  1Z05 A;  2KJC A;  5LHG A;  4I76 A;  4AYB A;  1P92 A;  1EJ9 A;  2GIZ A;  5ILV A;  2QSG X;  3UKG A;  5FRN A;  3HTU A;  2QEN A;  3VYU B;  1O4X A;  4UV9 A;  1YRN A;  2PLY A;  4BHP A;  1T08 B;  3NAU A;  3TMO A;  5D4S A;  2MFZ A;  5L3B A;  1MD0 A;  4PJL A;  2Y9Y A;  1U8R A;  3Q9V A;  2BGC A;  2QQ8 A;  1ETO A;  4C3H J;  1SAX A;  4RGX A;  2XGC A;  2EIK H;  4I98 B;  4CGZ A;  5HDN A;  2A6H F;  2FSW A;  2JSC A;  2DFE A;  4AM3 A;  1FNN A;  3BR6 A;  5CVI A;  2DT6 A;  4AWX B;  1L3L A;  1JKO C;  4RGU A;  4IL6 C;  1JTY A;  3GZ6 A;  4AC0 A;  3ZQ7 A;  2WA0 A;  2UWM A;  5ILS A;  2WAQ N;  2HDD A;  1SFU A;  3RKY A;  5F1J A;  2P6S A;  5B3S H;  1H0M A;  1LKX A;  2LY2 A;  3OYJ A;  3R61 A;  2BY1 A;  2ZO4 A;  2MAB A;  4IRH A;  1SC7 A;  2CH0 A;  3O2P E;  5DD8 A;  4AIJ A;  4CO8 A;  2QUF A;  4C9Y A;  1VQ9 I;  2DA2 A;  1W7P A;  5DYM A;  5J6X A;  5K5R A;  1H8A C;  1BC7 C;  4CH7 A;  5KVR A;  3LMM A;  5BPI A;  4GRI A;  4OWR B;  2OA4 A;  4BQA A;  2CSO A;  1V4R A;  1KQ9 A;  1R4M B;  1OMI A;  3M8E A;  4D0P A;  1EKE A;  2P81 A;  4FQG A;  3CD6 I;  3SYT A;  1QZZ A;  2X6X A;  2HU9 A;  4HX8 A;  3L09 A;  1IRF A;  3LST A;  3CCS I;  1FYM A;  4GFB A;  2RC4 A;  4PGG A;  2JT1 A;  5IP7 J;  4D1Q A;  3DTI A;  5CPR B;  2KP6 A;  2V6C A;  1T0F C;  2QKM B;  1X1B A;  3FIW A;  5FLX K;  3F9K A;  3H0D A;  2VJ5 A;  2HOS A;  4DIQ A;  1X3W B;  3ZQQ A;  3RJP A;  4RB3 C;  4GYG A;  1U6G A;  3W2W A;  4ZTJ A;  3J80 K;  2PG4 A;  3JAM K;  3OL3 A;  4Z2Y A;  2XSJ C;  2HKO A;  2OBP A;  4BXX J;  3CO7 C;  3TBI A;  4XRF A;  4UUV A;  3DLA A;  5F64 A;  5J47 A;  3ZMD A;  5AIP A;  4DJA A;  4L9N A;  5F04 A;  4ESF A;  1MNE A;  4CCN A;  3IV5 A;  2HZT A;  4I0A A;  1VQL I;  2ZC2 A;  1YIO A;  4AID A;  4G7O F;  2MG4 A;  2FEZ A;  1CF7 B;  2DMQ A;  3KEO A;  4LIV A;  2GLO A;  2O6G E;  2NVY J;  3GZN B;  3KIO A;  3RQI A;  2GA1 A;  3QPT A;  4GCV A;  4ESJ A;  5CVR A;  2VAS A;  1R00 A;  5L3G A;  3RPU D;  1KA8 A;  2R93 J;  2K86 A;  2XAF A;  1PYV A;  3C2G A;  3MVP A;  4RM3 A;  2HEO A;  4HF1 A;  3DBR B;  3GFI A;  4M9Z A;  4IHY A;  5C4X J;  1B72 B;  1XDU A;  2ZJ2 A;  4B09 A;  5DUI A;  2EFN A;  3QYF A;  3DTK A;  1Y39 A;  3FM5 A;  1EA3 A;  2PJR B;  1DPU A;  4XLA A;  4ZH4 F;  4UVA A;  1Z7U A;  3B6A A;  3K9T A;  4XLC A;  1FJL A;  1QHH D;  3GTK J;  1HBX G;  1LEB A;  5DM7 F;  2QEX I;  1GVD A;  1LJ9 A;  1MMN A;  3JRG A;  1V5F A;  1R1T A;  2K40 A;  4WX9 A;  3WGH A;  1A5J A;  5KAI C;  3FKI J;  1HW5 A;  5K5Q A;  4XRM A;  4S04 A;  5HLI A;  5HS8 A;  3G73 A;  3JCU C;  4LMY A;  1B8I A;  3PFY A;  2LSO A;  1RNL A;  3GTP J;  4BDZ A;  4UXN A;  2OZ6 A;  3GWZ A;  1FBU A;  2IP2 A;  4C2M J;  3Q9S A;  4C3J J;  6PAX A;  4LLN A;  5JLX A;  3H0G J;  3K1M A;  2QSF X;  4BDY A;  1R7J A;  3WU0 A;  2DYR H;  4PGH A;  5HVQ C;  5GPC A;  4II3 A;  3BTI A;  3MKY B;  3BR0 A;  2LD5 A;  3MWM A;  2VBY A;  4MLO A;  4JP0 A;  4BGD A;  4NC6 A;  4BUP A;  2JQN A;  1I3Q J;  1I50 J;  2R7Q A;  5IT9 K;  1G2H A;  1HQC A;  3RDI A;  2JA7 J;  4MQV A;  3QPL A;  3GX4 X;  4J19 A;  3GFL A;  1O3T A;  1UHW A;  1W5C C;  2RQP A;  3OS1 A;  3VDX A;  1OCO H;  3LWF A;  3MFK A;  3JRD A;  2R5Y B;  4D7M A;  1TWH J;  1FP1 D;  2ZFU A;  3M07 A;  4ZJZ A;  4IQJ A;  4L5I A;  2O03 A;  3HRM A;  5LHH A;  1ZG3 A;  3K1P A;  3JTG A;  3A4C A;  3CES A;  5F0F A;  2RQQ A;  3PNV A;  2W00 A;  5L3D A;  2IS2 A;  3OMY A;  4U87 A;  4I99 C;  1H9G A;  1LFU P;  3HPG A;  2GOM A;  3LSG A;  2HYJ A;  5CJ9 A;  3RPQ A;  3KLO A;  4OIQ F;  1YW7 A;  4MFD A;  3QOP A;  2G0E A;  2KJB A;  1FSE A;  4L5E A;  3ZR8 X;  2WBM A;  2GXG A;  2WAD A;  3L2V A;  2IXS A;  1BR2 A;  3HIF A;  2GQQ A;  3QWL A;  1OCT C;  2GOX B;  3K2Z A;  1HXD A;  1Y8Q B;  2Y9Z A;  2GXA A;  4FE4 A;  5FB2 A;  2KHM A;  5D5W B;  3TED A;  5LEK A;  2DTZ A;  3ASO H;  1B4A A;  3MKZ A;  2QQB A;  3GLX A;  2DA3 A;  1T6S A;  2R7T A;  2OZU A;  4EQQ A;  1AHD P;  1OJL A;  4LG0 B;  4PSX A;  3GZ5 A;  1TL8 A;  1WWX A;  2UUZ A;  4PJJ A;  3ECO A;  4CIC A;  5JHF A;  4KMF A;  1JUS A;  3WTS C;  3DEU A;  3PL8 A;  4MQ9 F;  1STZ A;  2M9H A;  1SVL A;  2HW2 A;  2Q0O A;  4IPA A;  2JUC A;  3RYP A;  3E5X A;  3PJR A;  1DDN A;  5EGO A;  3VOE A;  3OIO A;  1V5E A;  1QVU A;  4P1W A;  1F36 A;  1IGN A;  3S1Q J;  1WFX A;  3OOP A;  3RZD J;  4IHT A;  4IHV A;  2XPW A;  5D8K B;  1JE8 A;  1DP7 P;  1IDY A;  2YPR A;  2CW8 A;  3LFK A;  2ID3 A;  5EGO B;  2J5O A;  3CCQ I;  5M3M J;  4GXO A;  5M3F J;  2I5U A;  2ZNY A;  1IAW A;  4F7Z A;  1TLH B;  1R6R A;  4HOB A;  3M7G A;  3CLO A;  3G71 I;  1P2F A;  2JRT A;  2ZME C;  4BNC A;  1SMT A;  2H27 A;  3HJE A;  3CC7 I;  2M3A A;  3SEQ A;  2A05 A;  3CP2 A;  1ZK8 A;  2BVL A;  3N05 A;  2IGN A;  2R7Z J;  4CYD A;  3M1C A;  4Y33 A;  4C2U A;  3GBG A;  2ME6 A;  3AG4 H;  2A07 F;  4BAY A;  4XLP F;  1SVO A;  3R60 A;  3RI4 A;  2TRT A;  2X0L A;  1FWZ A;  2NOJ B;  3K1N A;  2ELH A;  3QAH A;  3EPZ A;  2RN7 A;  1LVK A;  2IA0 A;  1JJ8 C;  2V4J C;  2F5V A;  2HGC A;  2BYV E;  3CJT B;  5FKM A;  3HRS A;  2DMT A;  3HPH A;  4MFE A;  1NK2 P;  2ZB9 A;  3KEY A;  4YG2 F;  2DYS H;  5F1R A;  4A2U A;  4A3B J;  1QHG A;  2QA4 I;  5BS6 A;  3LQR A;  1MKM A;  2XAU A;  2ESN A;  2H6B A;  2DFF A;  4PFP A;  3MMY B;  1T39 A;  3GYH X;  1MW7 A;  2L9S A;  3I3L A;  2EZK A;  3OV8 A;  3DP7 A;  2W4S A;  4Q48 A;  4CYC B;  2B63 J;  4BBR J;  3G1M A;  1POG A;  3HOX J;  4Q5S F;  4LIU A;  2OCE A;  5J4Y A;  1X3Z B;  3KYC B;  5A2Q Z;  1NG6 A;  1USS A;  5BQT A;  2MD0 A;  2Y75 A;  4EJT A;  4OAY A;  1JGG A;  1MSE C;  4XIC A;  2ACJ A;  1JT0 A;  2KIQ A;  4BXU A;  5KAF C;  1TT5 B;  3FHZ A;  2VJI A;  4G9Y A;  3I56 I;  1ENH A;  2ZXJ A;  2IGO A;  2DK8 A;  2F6C A;  1ZR2 A;  3VSK A;  1E3P A;  5E3O A;  2TDX A;  3NWS A;  1SD5 A;  1FYL A;  4AYB N;  1BL0 A;  2KIM A;  3KEQ A;  1YW9 A;  2H1K A;  4PJM A;  5GPA A;  2W85 A;  1D5Y A;  2NS7 A;  2MBF A;  2R7V A;  3I71 A;  1MJ9 A;  2XIG A;  4BKX A;  4O5V A;  2VPL A;  1VFC A;  1GV2 A;  2LKP A;  3ASN H;  2XDV A;  3FXR A;  4G8X A;  4B3A A;  1K61 A;  2XKO A;  1TTY A;  4QSH A;  1P4W A;  1LPQ A;  3CQZ J;  1K78 A;  1S7E A;  3W2V A;  1WJC A;  3H3U A;  3HTS B;  3S16 J;  5ED4 A;  1XS9 A;  2XB0 X;  2OCC H;  4CCK A;  2ZKZ A;  2W84 A;  2Q1Z B;  2BHZ A;  4CA0 A;  2XRO A;  1K78 B;  1MBE A;  2E36 A;  1GHC A;  2V6E A;  1D8J A;  3BT9 A;  3CCJ I;  5J1R A;  2E7X A;  2BY0 A;  2DAO A;  2GIV A;  4IOA F;  3FXK A;  5JI6 A;  1VZ0 A;  1V5G A;  5B1B H;  2Y30 A;  4UUT A;  1J75 A;  2EIN H;  3R6S A;  3BZC A;  3K70 D;  4XN0 A;  3BPV A;  2R7S A;  3GEZ A;  2X4H A;  3ZMV A;  2K9M A;  1G3T A;  1QZE A;  2JWT A;  2EK5 A;  3CJR B;  1V55 H;  1PVE A;  4R8H A;  1A31 A;  1PUF A;  2XKP A;  4LK1 F;  3SFZ A;  5CKT A;  4M3F A;  5D6E A;  4B8X A;  3L2Q A;  4IXA A;  4EJV A;  4NBQ A;  2K7L A;  2NRA C;  4DYC A;  2L9R A;  3U21 A;  3WGG A;  2NVX J;  1UHM A;  3HOZ J;  3FZV A;  2LG4 A;  2HOE A;  3MN2 A;  1J59 A;  3ZQL A;  1VQN I;  2AO9 A;  2K9N A;  4IO9 F;  1A35 A;  2L0K A;  4L18 B;  4A3K J;  5ICC A;  5H6Q A;  1FIP A;  1XMX A;  3D0S A;  3E3V A;  3K10 A;  4NC8 A;  2JSP A;  3L2C A;  3KYL A;  3IL2 A;  2DW4 A;  1UCR A;  4XK4 A;  2Q8K A;  4YII A;  4M3E A;  2CUZ A;  4EMS A;  2MYS A;  1O57 A;  3U9G A;  3TO9 A;  3HSR A;  1B8I B;  4YFK F;  3QPH A;  5L3F A;  3HZJ A;  1NK3 P;  4XSX F;  3CMM A;  2JA8 J;  3GTM J;  4FCY A;  3E1S A;  3HGY A;  1ZLK A;  2HS5 A;  3DLL F;  3IWF A;  3HOU J;  3RKQ A;  4EGY A;  1YJ9 I;  1IC8 A;  4UY8 I;  5DCM A;  4WXC A;  1Y0U A;  4R1H A;  2FRH A;  1Z67 A;  3W6J B;  2AHQ A;  2VE9 A;  1PP8 F;  3SZG A;  4A3F J;  3L7W A;  4N9H A;  1QQI A;  1BN5 A;  4L5J A;  4DQ2 A;  4C2T A;  1K79 A;  2E1M C;  1W5T A;  1UG2 A;  3KP5 A;  1AWC A;  4IHW A;  2W1O A;  2KRH A;  3HGG A;  4M6X A;  1U2W A;  1OPC A;  1FBS A;  1XMK A;  2ESH A;  3D5S C;  4XNF A;  1VTN C;  1TQP A;  1GUU A;  3TQN A;  4WF2 A;  4HX7 A;  2H1L A;  2ISY A;  4DGW B;  1XCV A;  2M1B A;  3GO5 A;  4HF0 A;  4F3Q A;  4HW0 A;  2D1V A;  4E6K G;  3K69 A;  5LBQ A;  1B59 A;  3OYD A;  1WHU A;  4RB2 C;  1X58 A;  2OJE D;  3ABL H;  5CVJ A;  1HW1 A;  3FWE A;  2M4G A;  4XOT A;  3ESW B;  2EIM H;  1ON2 A;  3ZCO A;  4I7H A;  3E7L A;  3DF8 A;  3RYR A;  3KET A;  4OAZ A;  1NG7 A;  5FD5 A;  3T8T A;  1ODD A;  3VFZ A;  4ZDL A;  5IYD J;  4HEA 2;  2CFO A;  4UHT A;  3SXY A;  3F22 A;  2LDU A;  3AAF A;  4RAG A;  5CVV A;  2AXL A;  2H09 A;  3ZPL A;  4DZJ A;  2HVS A;  2F5D A;  2IS4 A;  1XGN A;  1BI3 A;  4EV0 A;  5K1Y A;  5IT9 Z;  2VOO A;  3BZK A;  3S2H J;  2EV0 A;  3GW2 A;  2L3D A;  1UMQ A;  4PUS A;  1F1Z A;  2VQC A;  2DQL A;  2JN6 A;  2LBF A;  2OF7 A;  4AVP A;  3FXJ A;  2QLZ A;  4LB6 B;  4F92 B;  3OYE A;  2FA5 A;  1BI1 A;  3SDB A;  2DA4 A;  1P4A A;  1DGW Y;  2X6W A;  3GLL A;  3ROU A;  3LOC A;  4LGW A;  3QYB A;  5FKN A;  5HS9 A;  1DP3 A;  3WG7 H;  1WJ5 A;  4EM2 A;  2XGX A;  1JHF A;  4A6E A;  1ZR4 A;  1EV7 A;  3SJM A;  3I53 A;  4KUM A;  4CCJ A;  4HSR A;  3P5J A;  2LNB A;  3IAS 2;  3TOB A;  4CHU A;  1R5H A;  5AIQ A;  2M8G X;  2PN6 A;  2K27 A;  3CCU I;  5DCF A;  3KZZ A;  4XLH A;  2K3P A;  4A3E J;  1Z6R A;  3QU3 A;  5HLH A;  3JRA A;  3BR2 A;  3E5Q A;  3OYF A;  1JT6 A;  3G6E I;  1SFK A;  2WAF A;  2CQK A;  1YJN I;  2FBK A;  1FSH A;  2P7V B;  1T98 A;  3VYR B;  1WI3 A;  1UZC A;  5E18 F;  4XKC A;  5DDG A;  1S7O A;  9ANT A;  2EFW A;  3PO2 J;  2KIU A;  2LVS A;  1RKW A;  2OAZ A;  2JPC A;  4P9U A;  3VB2 A;  2MC3 A;  4Y4R A;  1WGX A;  4KN4 X;  1SAU A;  3K4L A;  1YTY A;  2YX7 A;  3KLN A;  3A0B C;  5GTH C;  3DKY A;  1LVA A;  5IYB J;  3WTV C;  3WE3 A;  5EG0 B;  3IH2 A;  2ZSI B;  3E6C C;  1ITY A;  3LA3 A;  4HST A;  1S6L A;  5TIS C;  1XN7 A;  1JI8 A;  2L7Z A;  3MD2 A;  4ZTF A;  1FLI A;  1N25 A;  1R5G A;  4WK8 F;  3PUF A;  2KT0 A;  2PMU A;  4F93 B;  2DOE A;  5JLW A;  1T0F A;  3H36 A;  3CUQ C;  1XPX A;  4DOZ A;  4U7D A;  2P6T A;  2HPM A;  1WCM J;  2Y69 H;  3L2U A;  2Z33 A;  2FBH A;  4PFO A;  1OQY A;  1D0Y A;  1K4T A;  1IV6 A;  1XX5 A;  2DQR A;  1D1A A;  3A01 A;  3OYH A;  3GFM A;  3DTE A;  5E20 A;  1R22 A;  2DMU A;  2VKH A;  2L7M P;  2ZXI A;  3BPX A;  3TO6 A;  3H1C A;  2HXI A;  4G94 A;  3ZGK A;  4B47 A;  1IF1 A;  1F5T A;  2IA1 A;  3F8C A;  4ZDO A;  1ULY A;  4XLF A;  2PEX A;  1WZ2 A;  1MBH A;  1Y8R B;  5AON A;  3TDU C;  1WJF A;  1R1U A;  2FOK A;  3OYM A;  4QLC U;  3H5R A;  2EZL A;  3JRF A;  3H9Q A;  2F5C A;  5HS7 A;  3SZT A;  3IKV A;  3K0L A;  3HRU A;  4CUG A;  1BOB A;  4P55 A;  1A36 A;  1O7F A;  2D45 A;  3K2A A;  2CUJ A;  2IRF G;  1B6A A;  3K6G A;  3M9A A;  4GYI A;  4BU2 A;  2QSH X;  1Y6I A;  4B4C A;  3FMQ A;  3K7A J;  2E71 A;  1MGT A;  1HDP A;  4I01 A;  3RIR A;  3OYB A;  1SD7 A;  2NVQ J;  3G3Z A;  5CQE A;  3C2B A;  3ZMT A;  1D5V A;  5A2Q K;  2VI6 A;  3M4O J;  3FBN B;  4QWQ A;  4C3I J;  3OSF A;  2UV1 A;  3S1N J;  4DW6 A;  3CDL A;  2V1D A;  3LSJ A;  2DXI A;  2H6C A;  2QCO A;  2OC6 A;  1XGO A;  3C3W A;  2EIL H;  3BJO A;  2QBY A;  1ON1 A;  2QWW A;  1MSF C;  1KGS A;  1GXP A;  3OSG A;  1FZP B;  1B9M A;  4XKW A;  3P9C A;  1D0X A;  2EA4 A;  3RCO A;  1KU3 A;  3REO A;  4MTD A;  3ZQG A;  2DLL A;  1HKS A;  3KP7 A;  5LRR A;  2DBB A;  4BQQ A;  1MBJ A;  1R23 A;  3JRE A;  3O6B B;  3KX2 A;  2E2I J;  3OYL A;  3GCM A;  3LSM A;  2KIS A;  5GP9 A;  1K4S A;  2R7U A;  1W36 D;  2Z16 A;  3GME A;  5FFZ A;  2M7B A;  4BY7 J;  3EYY A;  4EJO A;  2GBY A;  2DMN A;  5JFR A;  4MTE A;  4EAT A;  4OOI A;  2OQG A;  4WXD A;  1P7J A;  4AIH A;  4BBS J;  3S2D J;  1IRZ A;  1R36 A;  4X0G A;  2Y0S N;  4FX0 A;  3K4B A;  2AQF A;  4BXF A;  2VOD A;  5HNH A;  2KDZ A;  1W5S A;  1OLT A;  1Z6T A;  4HNV A;  2NVT J;  2P5V A;  4W97 A;  3DPL C;  2RKH A;  1E3H A;  4Y15 A;  3JRH A;  3ZXS A;  1T8I A;  3M8F A;  2COB A;  2O0Q A;  1QVT A;  2BY2 A;  3E6M A;  4MNU A;  2ZME B;  3HOS A;  3P7N A;  5GAE J;  3H5A A;  1CGP A;  3TL4 X;  3KZI C;  5KNL A;  4P5O A;  4XON A;  2YS9 A;  5J8F A;  3UNG C;  3DV8 A;  4EM0 B;  1TWF J;  2VUM J;  3VYS B;  4J01 A;  1W0U A;  1EH6 A;  1TT0 A;  2W48 A;  3HB9 A;  3ONQ A;  5E17 F;  5BOX A;  2CWE A;  1WKM A;  2DK5 A;  5J1U A;  4ZYH A;  2CUE A;  4A0Y A;  3WU2 C;  2M0C A;  5L3E A;  3CF5 F;  2NXN B;  2CO5 A;  2JQ7 A;  5LRS A;  1RZ4 A;  4EJU A;  2MA3 A;  2EZI A;  1GXQ A;  2D2W A;  3AKZ A;  3OYG A;  5LFA A;  4CDG A;  3S2W A;  2LKX A;  3J7Y J;  4BEH A;  2EFP A;  1KQ8 A;  2HI3 A;  5ICF A;  1ZHF A;  2K9Q A;  4EM1 A;  3VPR A;  2M45 A;  1LUJ B;  4MHG A;  4HF2 A;  2IS6 A;  3I55 I;  3D5R C;  4U0W A;  1TBX A;  2FE3 A;  2W25 A;  4XL9 A;  3R0J A;  1VQK I;  5E3M A;  1SD4 A;  2M87 A;  3HKZ N;  2CW0 F;  3KZY A;  2VJ4 A;  2ZJR F;  2GA2 A;  2V79 A;  2V9K A;  3K4K A;  1C0W A;  4TV7 A;  3T1B A;  2CQQ A;  5F0H A;  3K70 C;  2EA2 A;  1IZ1 A;  3JR9 A;  2HOA A;  1Z9C A;  3HOY J;  4IHX A;  4OIO F;  4N9I A;  3DBH B;  1R49 A;  2Z99 A;  1FPQ A;  1YLF A;  3OYC A;  4Y17 A;  4IJA A;  2ICW G;  4NUB A;  2O61 A;  1OFC X;  2HZD A;  2X6Y A;  3BC8 A;  2L54 A;  2JPB A;  4FT8 A;  2MH9 A;  5C3E J;  4Q4Z F;  2RDP A;  1SAN A;  3BQZ A;  3ZMU A;  2DT5 A;  2JTV A;  3FMR A;  4NC7 A;  4KFC A;  1T2K A;  2HYF A;  3I59 A;  1X4O A;  1TWG J;  4W1U A;  3ABM H;  1ORK A;  3ULQ B;  4YFX F;  4RGR A;  4FE7 A;  3JRC A;  2ZBK A;  3FXM A;  3I59 B;  4GO1 A;  3WU1 B;  3HDD A;  2A5W A;  2M4K A;  3DEW A;  5EF6 A;  4XRS A;  4X6A J;  3AFH A;  4G6Q A;  5ILU A;  1IUF A;  2F4I A;  3BR3 A;  4F91 B;  2YUS A;  1AOY A;  3H92 A;  2ZFW A;  2E60 A;  1MND A;  1TWC J;  4U0V A;  5DUK A;  2LP0 A;  2VPR A;  5F08 A;  3QOD A;  1HCR A;  2JA6 J;  4BQO A;  3BCB A;  4N4O B;  2QQA A;  1ZTR A;  1ZYR F;  1OCR H;  1YS6 A;  5GAH J;  3BOQ A;  1G3S A;  3GTO J;  1LE8 A;  1XSD A;  3AL0 C;  4JQF A;  2FML A;  1FOX A;  3BQY A;  3BJA A;  1B1B A;  3ABT A;  3HOW J;  5DTD A;  2HPI A;  3OY9 A;  1W1W E;  4RDU A;  2W24 A;  2XF5 A;  2R5Z A;  4BE0 A;  3V8L A;  2LFB A;  1DU6 A;  5DM6 F;  2QGU A;  3OR1 C;  4LG3 A;  4NHJ A;  3C7J A;  1UB9 A;  4ZYD A;  1BI2 A;  2OU2 A;  3CC2 I;  3PIO F;  3K4C A;  3A0H C;  1G8X A;  3BCA A;  4IKF A;  4BJ5 C;  4EEF G;  1J5Y A;  3CP8 A;  4IF4 A;  4B3X A;  1WSU A;  1U5T C;  1XB4 A;  2XHK A;  1RPW A;  2L4A A;  1FP2 A;  1TQM A;  3ZQF A;  3WTU C;  1U9N A;  1S3J A;  3VSL A;  4XMY A;  4CZZ A;  4YIR X;  3G1L A;  4L0Z B;  2L2O A;  3E5U A;  2V1X A;  2DPU A;  3AG1 H;  1GLN A;  3E6D A;  2CV2 A;  2LRD A;  1HSJ A;  2RNJ A;  2VQG A;  3KCC A;  4KDP A;  3KFW X;  3IAM 2;  3EDP A;  3OS0 A;  2BXZ A;  4KJZ A;  3BG3 A;  1YO5 C;  1D3Y A;  2HFH A;  2IT0 A;  2ETH A;  2OD5 A;  4A5M A;  4F55 A;  4BHB A;  4LFU A;  1BC8 C;  1WJB A;  1SFO J;  3I54 A;  1GDT A;  3F8F A;  4CCL A;  5J40 A;  3FM3 A;  2R7W A;  3ZQC A;  4LD5 A;  2B7E A;  2CQX A;  5F0C A;  2K5C A;  1EH8 A;  1CF7 A;  1T95 A;  1WRJ A;  2FMY A;  3H9J A;  1J2X A;  1PUE E;  3CC4 I;  1DPR A;  2A3S A;  2FU4 A;  3K4J A;  3G2B A;  1J0R A;  4S05 A;  4IRG A;  1WPK A;  3ABU A;  3BLY A;  2XF6 A;  3AG3 H;  1YW8 A;  3ISP A;  1I6H J;  2PBI A;  4BL0 B;  1UEL B;  3S8P A;  4MIM A;  1XC5 A;  2IBD A;  2XGE A;  4KIB A;  2E1C A;  2IA2 A;  2DN0 A;  2FQ4 A;  1LDD A;  4BYY A;  3CCY A;  4M6V A;  1BW6 A;  1NTC A;  3UR3 C;  3JRB A;  2IEK A;  2VL8 A;  1FTT A;  5TJJ A;  2VKD A;  4UUS B;  2EB7 A;  1VF9 A;  3EUK L;  1FIA A;  1XCB A;  1ZRC A;  1E2X A;  4BAC A;  1P9Q C;  1YX3 A;  1JJ6 C;  3COA C;  1G4D A;  2JA5 J;  3CMA I;  3F8M A;  3BTC A;  1S72 I;  3QQA A;  2B9S A;  2A68 F;  2KKO A;  3V7S A;  4CXF A;  2K4J A;  3DBL B;  1K6Y A;  2ZME A;  4KN7 X;  1MMA A;  1WJA A;  1VQ6 I;  5C4J J;  1ONV A;  4HDU A;  3MZH A;  3DCF A;  2BW3 A;  3FXO A;  3BY6 A;  3HRT A;  2KIF A;  5ERI A;  2DA5 A;  4LOC A;  4RA2 A;  4KMU X;  1OYW A;  1U9O A;  1FMW A;  2HYG D;  2R3S A;  4DNC A;  4MEY F;  3NEU A;  4E7H A;  2BW3 B;  4M71 A;  5D5X B;  4ETS A;  5D5U B;  3ML6 A;  3R0A A;  1TP4 A;  1KON A;  1ETK A;  4XRS G;  4BQN A;  1AKH A;  3PFI A;  1ZAO A;  4UVC A;  2HXO A;  2HTJ A;  4HBL A;  2CYY A;  1X1C A;  4OU0 A;  3A1Y A;  1BJZ A;  2Y0S A;  1X4P A;  4BEH B;  1R5I D;  1R71 A;  4HA8 A;  3ERM A;  1UAA A;  2HWV A;  4OIN F;  3A03 A;  2E2J J;  2DPD A;  3TKY A;  5IOY A;  1LB2 A;  3S32 A;  4E7Z A;  4G7Z F;  4CCO A;  1O3S A;  2N8G A;  3AG2 H;  5DD4 A;  5K7F A;  2KZG A;  2ELK A;  2FX0 A;  2AS5 F;  1A6I A;  1M1E B;  2BE5 F;  2LKS A;  4PSW A;  5BNG A;  2VB6 A;  4GGG A;  5BMZ A;  2XVC A;  3DPT A;  3CTA A;  4IOC F;  3LSK A;  3WOD F;  2DOF A;  2DI3 A;  2K4B A;  5E1X A;  1P6R A;  1VQO I;  4RGS A;  2MGQ A;  1W4M A;  4UV8 A;  3HOV J;  1BR1 A;  2MLG A;  4A69 C;  1G6N A;  3ZN0 A;  1V54 H;  4ZC3 A;  1IUY A;  1S29 A;  3S3N A;  2G7U A;  1O7L A;  2IS1 A;  3TOA A;  3VEP A;  2K02 A;  2LH9 A;  5LGT A;  4A3D J;  4Y13 A;  4U88 A;  3HSE A;  1JHH A;  4M72 A;  1FT9 A;  3S93 A;  1JKP C;  5IYC J;  5HOD A;  1X1D A;  1JUM A;  3MQ0 A;  3F21 A;  3TGN A;  4CSW A;  2GWR A;  4RAZ A;  3K4N A;  1W7P B;  3CJN A;  1XSV A;  2JMW A;  5LD2 C;  1TW2 A;  2HDC A;  2CS3 A;  4A3L J;  3IUO A;  3GVA A;  2LBF B;  4KIG A;  2NVU B;  2DFI A;  4UB8 C;  2WAE A;  4KIT B;  5ICG A;  1NH3 A;  1ETQ A;  2VLA A;  4NB5 A;  2LRE A;  4RLQ A;  2H94 A;  4XLE A;  2GM4 A;  1UHS A;  2CW7 A;  3E97 A;  2MC4 A;  3HEF A;  4JK1 X;  4OIR F;  1ZGW A;  1F4K A;  1R58 A;  5J3L A;  2NNN A;  5J4V A;  2IW5 A;  4KNY A;  4A5N A;  2VOP A;  4KIS A;  1FOY A;  4HPQ A;  4E7I A;  2DDA A;  3E0J B;  2L5Q A;  3WHC A;  5FKL A;  1QU3 A;  5EEA A;  2VQH A;  3FBI B;  2XAJ A;  4DYR A;  4I0B A;  3C1D A;  2VBW A;  2STT A;  2Y31 A;  2VT2 A;  3F6O A;  1WJD A;  2P4W A;  1U5T A;  2LLK A;  4DZP A;  2QZ8 A;  3H35 A;  2R5Z B;  2ECB A;  1D1C A;  4LB5 A;  4O6J A;  1H88 C;  3L1P A;  1RKT A;  2KDO A;  2L9V A;  1QA6 A;  5EG0 A;  3OYA A;  4A3M J;  4XKV A;  3SFI A;  2NYX A;  1A04 A;  5IP6 A;  4OIP F;  1SVM A;  2HQ5 A;  3P9K A;  3J7Z I;  2Y48 A;  1QGP A;  4LJZ F;  1IN4 A;  1REP C;  2R7X A;  4AVZ A;  2QM3 A;  2BZT A;  1OYI A;  2OTL I;  5E79 C;  3FK6 A;  4IVN A;  2V7F A;  3DU5 A;  5E3N A;  1X2M A;  2X6O A;  2L02 A;  2I10 A;  4K2E A;  2VBZ A;  4HQM A;  3JSP A;  2HR3 A;  4KA4 A;  1LE8 B;  1VQ7 I;  2R7F A;  3PNY A;  1X2N A;  2CU7 A;  2NOG A;  4I2O A;  4A3G J;  1VI0 A;  2K9L A;  1U8B A;  5LHI A;  2HKX A;  5DS9 A;  2E5N A;  3F0C A;  4B48 A;  3DXJ F;  3GUD A;  1HST A;  3ERE D;  1U0J A;  2V1N A;  1FMV A;  2FBI A;  3GF2 A;  2WY8 Q;  3OYI A;  1I3A A;  3I58 A;  4G6T B;  2CQN A;  3CJQ B;  3G4S I;  1BJA A;  2XAQ A;  3BR5 A;  5D5V B;  3FXQ A;  2R0Q C;  3HG9 A;  3OYN A;  4O3M A;  2XRL A;  4ZYA A;  4RBO A;  3QU6 A;  4KT6 A;  4JX5 A;  4FHT A;  1BW5 A;  3QPS A;  3PSF A;  4ENK A;  2GZW A;  3OIP A;  1JKQ C;  1B72 A;  1MIJ A;  4OMY A;  2IAI A;  1IN8 A;  1YJW I;  5HLG A;  4DBR A;  2PJR A;  4XSZ F;  3RTR A;  3IH4 A;  2HQR A;  1O3Q A;  3KE2 A;  3BG5 A;  3WTY C;  4A3C J;  1Y0N A;  3RSN A;  2QBY B;  1IW7 F;  1JXS A;  2LF7 A;  3V8J A;  3KPH A;  2FJ1 A;  1KQ0 A;  3HM5 A;  1HW2 A;  2X1C A;  3FKJ A;  1OCZ H;  4H0E A;  1WQ2 A;  4IZZ A;  3RQ4 A;  5IPA A;  3DKW A;  2HNH A;  2YU3 A;  3W2A A;  4E7K A;  3ZQH A;  1Q1H A;  3V8K A;  3C18 A;  4EVI A;  2LK2 A;  3S15 J;  2X1D A;  2F2E A;  2DFH A;  4QIW N;  3WTZ A;  2QF7 A;  5L3C A;  1FBQ A;  3E6B A;  3QYE A;  2MW8 A;  4BY1 J;  4HRI A;  2F4M B;  1PUF B;  1SEU A;  3QRF F;  2ME0 A;  3HYI A;  2DA6 A;  2E5Z A;  1MNM C;  3F8B A;  1MBK A;  5M5W J;  3PIP F;  1S5L C;  2O8K A;  1IN5 A;  2ADU A;  1SD6 A;  1JGS A;  1S9H A;  2C6Y A;  2E1M B;  1YQA A;  1Z7L A;  4M6Y A;  2O5R A;  5GAG J;  5FD6 A;  3SEZ A;  1DU0 A;  3WE2 A;  2OV7 A;  4ABZ A;  4RAY A;  1K83 J;  5EZH A;  1NHA A;  2FNP A;  5D8L B;  1W0T A;  2PMZ N;  4FX4 A;  3B6C A;  1F9N A;  3I9V 2;  1Q1V A;  1Y1W J;  2STW A;  5IY5 H;  3LQQ A;  1D0Z A;  4UNO A;  3DKX A;  1GT0 C;  1Z3X A;  4LK0 F;  5CQG A;  3EQL F;  3FIS A;  3VOD A;  4V2F A;  2P8T A;  3FDY A;  1BIA A;  4XR6 A;  3LSP A;  2R5Y A;  1IXS B;  2DOA A;  4XOR A;  5KCM A;  1YE9 A;  3KP3 A;  5HOO A;  4WXH A;  2M2E A;  1ETW A;  3OL4 A;  2ECC A;  2JZY A;  3H5N A;  2XC7 A;  1K6O A;  5M5Y J;  2E1N A;  3BWG A;  2Z3Y A;  3QOE A;  1LFP A;  4HLY A;  3OS2 A;  4B43 A;  4D5C A;  3NAR A;  1QNT A;  3JTH A;  1RUN A;  4UVB A;  2DTR A;  4IHS A;  3PO3 J;  2F5F A;  4NQW B;  3T8R A;  1YG2 A;  4WWC A;  3OWT A;  3WHB A;  1HLV A;  4ZDP A;  2B0L A;  2XAH A;  5D6F A;  4Z6Y A;  1R9T J;  2EV6 A;  3DFG A;  4HQE A;  3HHH A;  4YEL A;  1I39 A;  2RNG A;  1UST A;  3A02 A;  2EJR A;  2F48 A;  3N97 A;  2WB1 A;  2ZNZ A;  1U78 A;  4HAM A;  1ZG5 A;  2V9V A;  2JRM A;  4F52 A;  1YIT I;  1TZL A;  1J09 A;  4QPO A;  4QTR A;  5E8G A;  2CQ7 A;  3IC7 A;  1QPI A;  3LSH A;  2ZJQ F;  1ZG1 A;  4FAS D;  1D1B A;  1FC3 A;  1OR7 A;  1Z77 A;  3V42 A;  1BIB A;  1YX5 A;  3EET A;  5FLM J;  4Y3O A;  1ZRF A;  3F72 A;  5EZG A;  2FXA A;  4U7B A;  4MEX F;  2LF8 A;  4PZJ A;  4OMZ A;  3IHU A;  2EFO A;  3F3X A;  3B02 A;  2EV5 A;  5EEH A;  1U3E M;  2BY3 A;  1V3F A;  2Z5U A;  3CUQ A;  4HZF A;  4NDL A;  5FO5 A;  3JSO A;  2EQR A;  3D1N I;  1N75 A;  2F5E A;  2MD5 A;  1X19 A;  1PJR A;  1TWA J;  1Z3Y A;  2P5L C;  3DWL E;  5EJC A;  3MCZ A;  3CUQ B;  4E7S A;  1F43 A;  2W7N A;  3EUH A;  1SFX A;  3MZ8 A;  2EWN A;  1ETY A;  4RLF A;  3PQK A;  2PX9 A;  2WWY A;  3CME I;  2CRG A;  3FMS A;  2KZV A;  2J5P A;  5JVT A;  3CUO A;  1MDM B;  2IGK A;  3M3Y J;  1KU2 A;  4IX7 A;  2IGM A;  2CFX A;  1RR8 C;  4FIS A;  4MGR A;  1UJ8 A;  3J80 Z;  3P9I A;  2ISZ A;  2COM A;  2YX4 A;  1MDM A;  1N78 A;  5B1A H;  1FY7 A;  1J7K A;  2WC2 A;  3HL2 A;  2P5K A;  1RET A;  3F8N A;  1UFM A;  2OUM A;  5HDG A;  3T5X A;  3J81 Z;  5EDN A;  1YS7 A;  4LLL A;  2FOW A;  2WTE A;  4XM3 A;  3W3C A;  2A69 F;  3GXO A;  4FTH A;  3HHG A;  4ENN A;  3HSF A;  2NNY A;  1I27 A;  2RVC A;  4RMN A;  2R92 J;  1X3U A;  2Q2E B;  2M30 A;  2O0Y A;  4I09 A;  3HOT A;  3TDZ C;  2ID6 A;  1H89 C;  3CMY A;  2KRF A;  3CO6 C;  1RI7 A;  1TQI A;  2YSR A;  1MBF A;  4YEJ A;  1D8K A;  2K85 A;  1EH7 A;  4LLG F;  1CQT A;  3LSI A;  3L2R A;  3NRV A;  2CG4 A;  1EF4 A;  4N0B A;  2KRC A;  5DV5 A;  2QKL B;  4AU7 A;  3CCM I;  3I4M J;  1MJB A;  1HF0 A;  1ZH5 A;  1TW3 A;  2KFD A;  3BDD A;  2W57 A;  4AD9 A;  3CCE I;  4BJ6 C;  3ABK H;  3H3Z A;  2KQR A;  4XN3 A;  2D5V A;  2AXT C;  2WAQ A;  3PQJ A;  3F23 A;  2M34 A;  4II2 A;  2UXN A;  3O8H A;  1OKR A;  4B44 A;  2R4G A;  4JOM A;  1OCP A;  1IN7 A;  1DQU A;  4A0Z A;  3GFJ A;  2MH2 A;  3N4M A;  4ANJ A;  4A12 A;  4HNU A;  3HBL A;  5F6F A;  3IP4 B;  3DU6 A;  4HG2 A;  3L9F A;  3LSR A;  4PJ0 C;  2CV1 A;  1S8N A;  1XG1 A;  4BS9 A;  3NQO A;  4RS8 A;  2XAS A;  4ASN A;  4L9T A;  1LDK B;  1ZGJ A;  2PJP A;  4I02 A;  1ZQ3 P;  3RKW A;  2EZH A;  3Q0V A;  4RAF A;  3WTX C;  4P96 A;  4S0H B;  2BVM A;  2BEO A;  1QZY A;  4E70 A;  3HUG B;  5JVG F;  3FXU A;  3TP0 A;  1MH4 A;  1RUO A;  1YYV A;  3BZ6 A;  4C30 A;  4G6D A;  3PM1 A;  2VQL A;  5J1Y A;  2Z9O A;  1H9T A;  5GTI C;  1XGM A;  5B5E C;  2LMD A;  2ZCW A;  1T33 A;  4E4H A;  4ESB A;  4Y7N J;  1BA5 A;  1HC8 A;  1FTZ A;  3LL7 A;  3SZP A;  5ICE A;  2XPU A;  3BG7 A;  3RKX A;  3KYD B;  1WJE A;  2DDB A;  3TO7 A;  2KMU A;  3VYT B;  1Y1V J;  5D4R A;  1XTA A;  3AL0 B;  1WH7 A;  5KHD A;  3I5U A;  3OYK A;  5B66 C;  3CF2 A;  1WVR A;  3V7C A;  5CVU A;  2ELJ A;  1MBG A;  5FJ8 J;  2L7K A;  1YOV B;  2ZJP F;  2MSY A;  2VE8 A;  2ZXH A;  2K3F A;  2DCE A;  2VC0 A;  4KIF A;  4XOP A;  1IXR C;  4ZZD A;  1X1P A;  3FXL A;  3KP6 A;  4ITV A;  5K5O A;  2GXB A;  2FD5 A;  2MLK A;  2XAG A;  2VIX A;  2E1O A;  3CCR I;  2M7A A;  1IRG A;  1IO2 A;  1SMY F;  2XF7 A;  1XSX A; 
#chains in the Genus database with same CATH homology
 4PSW A;  4LIV A;  2VB6 A;  3OYF A;  1SFK A;  2WAF A;  3DPT A;  3VYR B;  3LSK A;  2HDW A;  4XKC A;  2VAS A;  3RPU D;  1BR1 A;  3C2G A;  1PYV A;  4RM3 A;  3S3M A;  4ZC3 A;  4Y4R A;  3S3N A;  3QYF A;  3DTK A;  2IS1 A;  1EA3 A;  1SAU A;  3K4L A;  2PJR B;  2LH9 A;  4D9J A;  4XLA A;  3PUB A;  4XLC A;  3DKY A;  3S93 A;  1QHH D;  2ZSI B;  4EYY Q;  1X1D A;  1AA7 A;  1MMN A;  4HST A;  1V5F A;  4CSW A;  1JI8 A;  3MD2 A;  4ZTF A;  3K4N A;  5LD2 C;  4F93 B;  2CS3 A;  2LY1 A;  3IUO A;  2LBF B;  2V26 A;  4KIT B;  2WAE A;  3PFY A;  2VLA A;  4DOZ A;  2LRE A;  4RLQ A;  4BDZ A;  4XLE A;  2X51 A;  2HPM A;  3L2U A;  2CW7 A;  3CZ6 A;  1Y56 A;  2MC4 A;  2CV0 A;  4PFO A;  4BDY A;  1D0Y A;  2LC2 A;  1D1A A;  5HVQ C;  3MKY B;  4II3 A;  3OYH A;  4KIS A;  3DTE A;  4HPQ A;  4E7I A;  2Z1D A;  3E0J B;  2L5Q A;  4MLO A;  2VKH A;  4BGD A;  1QU3 A;  3L2W A;  2ZXI A;  4B47 A;  2VQH A;  3ZGK A;  4BUP A;  3FBI B;  4HNT A;  2JQN A;  2R7R A;  4ZDO A;  2R7Q A;  4RM2 A;  4XLF A;  4E7L A;  1WJD A;  4PJN A;  1WJF A;  3OYM A;  1BR4 A;  3H5R A;  3OR2 C;  3H35 A;  3OS1 A;  3VDX A;  1D1C A;  2WY7 Q;  4R79 A;  3H9Q A;  1HA8 A;  2PMZ A;  2ZFU A;  4ZJZ A;  5FRO A;  4IQJ A;  2KDO A;  4CUG A;  1BOB A;  3OYA A;  4BE2 A;  4XKV A;  2JVG A;  3FHN A;  3A4C A;  3CES A;  2CUJ A;  5FRM A;  1Z21 A;  2JVH A;  2RQQ A;  3K6G A;  3HC7 A;  3PNV A;  2W00 A;  4BU2 A;  2IS2 A;  1Y6I A;  3OMY A;  4U87 A;  3HPG A;  5HNF A;  2R7X A;  2GOM A;  3LSG A;  4AVZ A;  3OYB A;  5CQE A;  4LIT A;  2AQE A;  3FBN B;  3DEE A;  2UV1 A;  3ZR8 X;  2WAD A;  2WBM A;  2V7F A;  3DU5 A;  3L2V A;  2IXS A;  1BR2 A;  2DXI A;  2GOX B;  2KHM A;  1W36 C;  2OC6 A;  2X85 A;  3M8J A;  3MKZ A;  4XKB A;  4XKW A;  4N4N B;  3DPU A;  1D0X A;  2R7T A;  3RCO A;  4PSX A;  3PNY A;  3LFU A;  1ERD A;  2UUZ A;  4PJJ A;  5JHF A;  4BQQ A;  3OIQ A;  2K9L A;  3KX2 A;  2E5N A;  3PL8 A;  3OYL A;  1IRX A;  2KL4 A;  3LSM A;  4B48 A;  2R7U A;  1W36 D;  2HW2 A;  2Z16 A;  1U0J A;  2M7B A;  3PJR A;  2V1N A;  1FMV A;  4QPQ A;  2WY8 Q;  3OYI A;  4EAT A;  1V5E A;  4G6T B;  4P1W A;  3CJQ B;  1WFX A;  4X0G A;  3K4B A;  2AQF A;  4BXF A;  2CW8 A;  2M0M A;  5HNH A;  2I8D A;  1UG0 A;  3NWT A;  1OLT A;  3HXL A;  3HG9 A;  1N77 A;  3OYN A;  4CCM A;  1R6R A;  4BE1 A;  4ZYA A;  4KT6 A;  3DPL C;  4BJT A;  3ZXS A;  3PSF A;  2VXZ A;  3OIP A;  2M3A A;  2O0Q A;  3SEQ A;  3HOS A;  3CP2 A;  3H5A A;  2BVL A;  4DBR A;  2HVR A;  2PJR A;  3TL4 X;  2W82 A;  2IGN A;  3N05 A;  2ZSH B;  3RTR A;  5KNL A;  4P5O A;  3M1C A;  4XON A;  4Y33 A;  2X1E A;  4C2U A;  3GBG A;  3UNG C;  2RRE A;  3RSN A;  3J7A Y;  3VYS B;  4J01 A;  3H9G A;  1TT0 A;  2X1C A;  4FET A;  3FKJ A;  3ONQ A;  3EUA A;  2NOJ B;  4IZZ A;  3RQ4 A;  2KLO A;  4NNJ A;  2HNH A;  3W2A A;  4E7K A;  3EPZ A;  1LVK A;  2R7O A;  2V4J C;  1ZEL A;  3OOU A;  2F5V A;  2HQA A;  2X1D A;  2VXD A;  3HPH A;  4HRI A;  5TGT A;  3QYE A;  3AKZ A;  3KEY A;  3OYG A;  5LFA A;  1QHG A;  2E5Z A;  4BEH A;  2JA2 A;  2XAU A;  2JUG A;  3BG6 A;  4H4K C;  4PFP A;  3MMY B;  1MW7 A;  1S9H A;  2L9S A;  3I3L A;  2IS6 A;  3D5R C;  2E1M B;  2W4S A;  1Z7L A;  4J00 A;  2O5R A;  4XL9 A;  3SEZ A;  2OV7 A;  4LIU A;  3VWB A;  2VJ4 A;  3I9V 2;  1NG6 A;  3K4K A;  2V9K A;  2MD0 A;  1D0Z A;  2FUG 2;  4YRV A;  3DKX A;  3K70 C;  4OAY A;  1Z3X A;  5CQG A;  3FDY A;  2A6T A;  4XR6 A;  3ZRG A;  2DOA A;  4XOR A;  5KCM A;  1YE9 A;  5HOO A;  3OYC A;  2VJI A;  3OL4 A;  4NUB A;  2HZD A;  2IGO A;  2LYC A;  2X6Y A;  3BC8 A;  2F6C A;  3H5N A;  2HVQ A;  3VSK A;  2XC7 A;  2CMP A;  3NWS A;  2DT7 B;  3QOE A;  3MKW B;  1LFP A;  4PJM A;  3OS2 A;  4NC7 A;  2R7V A;  1MMD A;  4B43 A;  3HKZ A;  2L9N A;  3D5L A;  2VPL A;  1X4O A;  4NQW B;  3PNT A;  2XDV A;  3OWT A;  4PK4 A;  3S3O A;  4ZDP A;  3DQV C;  3W2V A;  1WJC A;  4YEL A;  2RNG A;  3PSI A;  4IQ4 A;  2WB1 A;  4CCK A;  4F52 A;  2A5W A;  2M4K A;  1TZL A;  1G59 A;  1J09 A;  2Q1Z B;  4XQF A;  4QPO A;  4CA0 A;  3AFH A;  2F4I A;  3LSH A;  4F91 B;  2V6E A;  4FAS D;  3K4M A;  1D1B A;  2E60 A;  1MND A;  1DGR M;  2Z2S B;  4CZC A;  3QOD A;  3V42 A;  1YX5 A;  4Y3O A;  4BQO A;  1VZ0 A;  3BCB A;  4N4O B;  1V5G A;  4U7B A;  3EUH C;  3K70 D;  4XN0 A;  2R7S A;  5HLT A;  3AL0 C;  4JQF A;  1OR7 C;  1N75 A;  2DJI A;  2K9M A;  3CJR B;  1X19 A;  1PJR A;  1Z3Y A;  2HPI A;  3DWL E;  3OY9 A;  2XF5 A;  5CKT A;  4E7S A;  2W7N A;  4BE0 A;  3L2Q A;  4RLF A;  3OR1 C;  4LG3 A;  3U21 A;  2KZV A;  2O0P A;  3K4C A;  2LG4 A;  2IGK A;  1G8X A;  3BCA A;  4IKF A;  4BJ5 C;  4IX7 A;  3A2K A;  2IGM A;  3CP8 A;  4B3X A;  4NC8 A;  3K10 A;  1N78 A;  3VSL A;  2JSP A;  4XMY A;  3HL2 A;  2P0W A;  3KYL A;  1E0E A;  1X1A A;  2VJJ A;  2OUM A;  2L2O A;  2KPM A;  2BOL A;  2CUZ A;  4XM3 A;  1GLN A;  3W3C A;  2MYS A;  2CV2 A;  2LRD A;  2XF7 A;  2VQG A;  3C2H A;  2LOO A;  4RMN A;  4E7J A;  3IAM 2;  3OS0 A;  4DBQ A;  4KJZ A;  2Q2E B;  1MMG A;  3CMM A;  3HOT A;  4AYB A;  3E1S A;  4F55 A;  1WJB A;  5FRN A;  4YEJ A;  3VYU B;  3TMO A;  4CCL A;  2R7W A;  2MFZ A;  3LSI A;  3L2R A;  2K5C A;  4PJL A;  1T95 A;  3H9J A;  2KRC A;  3SZG A;  2QKL B;  4AU7 A;  3K4J A;  4C2T A;  3G2B A;  2E1M C;  4BJ6 C;  4XN3 A;  2KQR A;  3BLY A;  2WAQ A;  2XF6 A;  2W1O A;  2KRH A;  4II2 A;  4B44 A;  3D5S C;  2DT6 A;  4XNF A;  2R4G A;  4JOM A;  1UEL B;  4BL0 B;  3S8P A;  1DQU A;  4DGW B;  4ANJ A;  4HNU A;  4F3Q A;  3IP4 B;  3UR3 C;  2UWM A;  2WA0 A;  3DU6 A;  4HG2 A;  2VL8 A;  2CV1 A;  2VKD A;  4BS9 A;  4E6K G;  3OYD A;  3EUK L;  1LDK B;  1LKX A;  3OYJ A;  2M4G A;  4BAC A;  2MAB A;  4XOT A;  3ZCO A;  2BVM A;  2CH0 A;  1YX3 A;  1P9Q C;  3HUG B;  4OAZ A;  1NG7 A;  4C9Y A;  4CH7 A;  4ZDL A;  3LMM A;  2CFO A;  4HEA 2;  4GRI A;  4OWR B;  4C30 A;  1K6Y A;  2VQL A;  2HVS A;  1MMA A;  1WJA A;  2IS4 A;  4E4H A;  2BW3 A;  3LL7 A;  3SYT A;  2X6X A;  2HU9 A;  3BG7 A;  4PUS A;  2VQC A;  2LBF A;  1WJE A;  1FMW A;  3VYT B;  2KMU A;  4F92 B;  3OYE A;  3AL0 B;  4E7H A;  2BW3 B;  5KHD A;  3OYK A;  3CF2 A;  3SDB A;  4D1Q A;  1DGW Y;  1KON A;  2X6W A;  3DTI A;  5CPR B;  4BQN A;  2KP6 A;  3QYB A;  2ELJ A;  1T0F C;  2QKM B;  1X1B A;  2L7K A;  3F9K A;  2VJ5 A;  3H0D A;  4DIQ A;  3ZQQ A;  2ZXH A;  3W2W A;  4ZTJ A;  1X1C A;  2DCE A;  4XOP A;  3A1Y A;  1DP3 A;  1WJ5 A;  2Y0S A;  1X4P A;  3OL3 A;  2XSJ C;  4BEH B;  3TBI A;  1UAA A;  3DLA A;  4ITV A;  4CCJ A;  4DJA A;  4HSR A;  3IAS 2;  2VIX A;  1MNE A;  4CCN A;  3S32 A;  4E7Z A;  4CCO A;  2M7A A;  4XLH A;  2K3P A;  2LY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...