4EYYQ

Crystal structure of the icmr-icmq complex from legionella pneumophila
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
188
Chain Sequence
MKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGAASQAQLQAESHLANQIALQSGQQEIYVSLYSSDGSNLQSWEKIVGSLPISRPIYADEEDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGKPLLTLKDKSISLENISRFVHVSGVYRYSNGRLIKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords IcmR
publication title IcmQ in the Type 4b secretion system contains an NAD+ binding domain.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 47
structure length 188
sequence length 191
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4eyyQ01
3.20.170.50 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 4eyyQ02
1LP1B 1MFTA 3MHVA 2WMMA 2M5AB 2ZAEB 5DJUB 2HR3A 2OTKE 4K3AA 1S3JA 3PH0A 5C39A 4ASVA 1BDCA 4HKZH 5EFWB 2UWJE 4KJMA 4GOFA 1BDDA 4HJGH 2B88A 1NVOA 2RKLA 1U7MA 1JMBA 2KUBA 2KZJA 1EC5A 2KS1B 2B89A 1EDJA 1EDLA 4WWIA 1X0TA 3ZDMA 2LXBA 1ZW0A 2LXCB 2P58A 2JWDA 3QWOC 4MN4C 4IOIH 4ZNCA 4K35A 4NPDA 4ASWA 1ZXGA 1OVRA 4ZMDA 2M0BA 1LT1A 1EDKA 4JBZA 4BXLA 2LR2A 4NPEA 2QVAA 1Q2NA 3RGUA 2SPZA 5DJTB 1EDIA 1FC2C 1DEEG 1H0TA 3FXEA 3MZWB 1OVUA 1SS1A 1H0TB 2KIKA 1OVVA 5CBOA 4CPGA 2QRXA 4GOEA 3S1KA 3FXDA 4GODA 5K5GB 2K3RA 2Q1KA 2KI7B 2R44A 4NPFX 1U7JA 4EYYQ 2KZIA 5CBNA 4HB1A 1Y47A 2B87A 1JM0A 1LP1A 2I8DA 2B87B 2M5AA
chains in the Genus database with same CATH superfamily
1IK9A 1T2KC 3TNUA 1SQXG 1M90Q 3E1RA 5C39A 1NKNA 1NTMG 1JEKA 1Y8AA 3NXSA 4U7JA 1AJYA 5KTBA 3O6QB 3H1KG 3RK2B 3SFEC 1NTKD 1GL2A 3M0DC 2FFDC 1HH0A 2WPSA 3CC2P 1URQC 2LXBA 2IYPA 2P58A 3H1ID 1KQLA 2O01H 3JSVC 4RESB 1LWUB 2JDIH 5AW7B 1JY2O 3H1HD 1RQVA 2V7QH 4ZMDA 1LT9A 1JTHA 1LTGC 3H1JD 1X8YA 5KLVD 3G6EP 1A02J 1L4AA 2HPCA 3H1LE 1NGMB 1PP9D 1H0TA 3FXEA 1EXJA 1KB9H 1JY2P 2W90A 1YJ9P 2BCCD 2OYHC 3HUSC 5H2FH 5CBOA 2WSCJ 2KYVA 5GTIE 4XA4A 2IX7C 1SQQD 3CI9A 1MV8A 1VQPP 1Q82Q 4EYYQ 1IZNB 1N7SC 1YQ4C 1P84E 2AUAA 1GW4A 1U57A 1Y47A 2QJPC 1LJ2A 2I8DA 1L0ND 1L2PA 1HBWA 3AEDC 1W5CE 3CWBD 2WTYA 1JOCA 3WUVA 2AXCA 5M1BA 2C0XA 1KZUB 2W8ZA 3NMDA 1SFCC 2KP8A 1U7MA 3CL3D 3WUTA 1NU1J 1EC5A 3WMM0 3CMAP 5KAFH 1NJIQ 2YNYA 3V2NA 3H1JE 3L72G 2LXCB 3VMXA 1S4XA 2HODB 1BSNA 4K35A 2WSFH 4JQ0D 2OYIB 4GT1A 1ZXGA 2M0BA 1SQXK 3AE1C 3D6ZA 1FOSF 2LR2A 3RK3E 2M3EA 1Q2NA 3NFQA 4PD4H 1M56D 5KJ7D 1KN7A 1DEEG 1YJNP 1DEBA 1OW7A 2NRGA 3H1HG 5AW5B 1RE4A 1L0LD 1SLQA 2R5BA 4UB8H 2OQQA 1PPJE 3CX5D 2W6AA 3BCCG 3AE9C 3B5NA 1IFNA 2KLVA 3A5TA 4N3YB 1S9KE 1PP9G 2FYNB 1PGJA 2XKMA 2YIUB 2P1JA 1YBKA 2J58A 5E79H 2XNDH 3I56P 1IFPA 3L73E 1ZRTD 1SQQG 2HR3A 3Q5SA 4HKZH 2A06D 1NKZB 5CMZA 1KQGB 1NVOA 3Q5RA 1CZQA 5APXA 2HLOA 1G2CB 2ZXEB 3H32A 1W2EA 3R4YA 5AVVB 2FKWB 3A0BH 1BE3J 2Y0EA 1M1KQ 2KB7P 1LNQA 1NYHA 3MIWA 2Y9YA 2H7HA 1RF1A 1OW8A 1DD3A 3EWKA 1L0LE 2ZYDA 4LGDE 4DT0A 2JP3A 2R32A 3IFMA 1BGYE 3P32A 3JCUH 3CXHD 2AEMA 2AXTH 3HTKB 3G71P 1BCCE 3TSIA 3V2PA 5B5EH 1ZRTE 5CCHA 1M1JB 2JQNA 2N1TA 1EXIA 1KD1Q 1AVOA 2NPSB 1NTKK 3AE5C 1IK7A 2R3CA 4H0LB 2OGUA 3L4FA 4GIFA 2AEJA 2HG5D 3H1LJ 4K3AA 1S3JA 1QVGO 3AEEC 4N78E 3RK2D 2AEFA 3TK1A 1KILE 5BVZA 1SQBE 1VL2A 1ZP0C 2RKLA 3HD7A 3EFFK 2KS1B 1NU1D 1N73A 2V4HA 3V4QA 1R5LA 3IN6A 3KHUA 1VQLP 2QIWA 1RHZB 2BEZF 5BU5A 3KYQA 2QE7H 3L74G 1KYOH 5KLIB 1SQQK 2P2UA 2YO3A 2QJKB 5B66E 1RE4C 4H13B 3L75G 2N9YB 2WWWA 1SQPE 2YKQA 3M0DA 2FFDA 1J1EB 3PJSK 2E75B 3HRNA 4M3LA 4WY4B 1LTJC 1MZ9A 5APVA 2ZT9C 4GOEA 1W2BO 1FZEA 4GODA 2LKMA 2FBWC 3HE5B 3BATA 4IL6X 5KKZB 4WB4A 3KDPB 1U7JA 1YJWP 1TU3F 1VDFA 2IBZE 3CMEP 4OGQB 1FZBA 1OW6A 5AVSB 2OARA 2UWJE 2KLUA 3BASA 2RH0A 2J5UA 3L70E 3CCMP 2A45G 2H8PD 2KK7A 2K37A 1XTGB 3GHGA 1FJPA 4WWIA 5KJ7C 3MTUE 1Q81Q 1RF1C 1LTBC 1MFZA 1BE3D 1VQNP 4I7ZC 4DCKA 4EIJA 4NPDA 3L73J 1VQMP 1NU1G 2KSEA 1FZCA 1K9MQ 1VF5C 3U1CA 3LIDA 2N1TB 1ZR2A 1KB9E 4OWFA 5H2FE 1KILB 1OVVA 5APQA 3AECC 1IFJA 3S1KA 2K9JB 2IFMA 2K3RA 3E7KA 1A02F 5L8RJ 2D2CB 2WSSH 3CX5I 3H6PA 2O1JA 1L0LJ 1BDCA 2B87B 1LP1B 3MHVA 1FU1A 2VRSA 5DJUB 1G1JA 3HD7C 1SQXE 3H1LD 2B9BA 1VQOP 1K04A 1BGYJ 1N73C 1HGVA 4RKUJ 1NTME 4KJMA 1VQ5P 1DX7A 2KUBA 5KAFE 1FDIA 2JO1A 1BCCJ 4W7ZA 2Q6QA 1T6AA 1PL5A 2I1KA 1ZLLA 4GDOA 2FXOA 4IFFA 1P84D 2FFDB 2JR8A 1HVVA 1URQB 1EQ7A 1NTZG 4PD4E 3V5BA 1AV1A 4BXLA 4NPEA 3CCVP 3Q5PA 1JB0J 2OTJP 3M9QA 5AW3B 1IO4A 2PP6A 1EDIA 1SQBJ 2E76C 3VMAA 1CI6A 3LW5H 3II6A 2GUSA 1S5LH 1SS1A 3VP8A 2R5DA 3M06A 1HUCA 4UB8E 3TGUD 2BEQD 4R4MA 2NPSD 2W83C 3H25A 2Z5IA 3CXHI 3A0HH 2GA1A 5CJ4A 3MP7B 4C46A 4H0LD 5E79E 1LTTC 2WVRA 3WU2H 2OYHB 3RBZA 3HUSB 3CPWO 3IF4A 1NU1K 3SWYA 2WPVB 4HYTB 3RK3D 4ASVA 1N7SB 1SQPJ 1E5WA 3GHGC 2A45I 1IC2A 2QJPB 3I5CA 2J59M 2B88A 5TISH 3VP9A 1YTZI 3L71G 1H89A 3CD6P 1MUUA 4XFJA 1PPJD 4H44B 3H1LG 3A0BE 1S9KD 1FZCC 1SFCB 4MN4C 3M9HA 3M91A 3GW6A 3TF5A 4H13D 4ASWA 1GMJA 3L73D 1LT1A 3TGUE 2Q3IA 2HYNA 2WT7A 1Q90D 1X9VA 2E75D 1S72P 2OTLP 2POHA 3L70J 4WY4D 3JCUE 1ZN5A 1KYOD 2AXTE 3T97B 3V2RA 1AQTA 2Y0CA 1NTKG 3PLNA 2KIKA 5B5EE 3BVHA 2O01J 3C9IA 3BCCE 3EQ2A 1X22A 3H1IG 5BU8B 2YO2A 2V7QJ 4OGQD 3HE4B 3USSA 3CCRP 3AEBC 1FZFA 4TT3H 1NTZK 3O8ZA 1MFTA 4AQRD 2M5AB 3M9BA 2OYIC 2L5GB 3G3ZA 3H1JG 3CC7P 5AW8B 5KLVG 3TNUB 4JYCA 1PGPA 2O01N 1BGYD 2O0QA 1LTJA 1BDDA 2WSEH 4WVZA 1QLED 1RE3A 4ZKUA 2BCCG 1GL2B 1EDJA 1SQVD 3F5HA 1BCCD 1N8RQ 3V4WA 2KOGA 2PFXA 3SSUA 2K1AA 3F89A 3W67A 1KYOE 1PFIA 4C7RA 2QJYB 5CCHD 3LIEA 1L0NG 1SQXJ 2XV5A 3CWBG 1LT9B 1JTHB 3G4SP 3RGUA 4N78D 3AE7C 1L4AB 2HPCB 1NTMJ 2H88C 4GKGA 4KT0J 1KILD 1SQBD 1FAVA 2JKVA 1H0TB 1N2DC 1WRGA 5KJ7A 1HJBA 5GTHH 1KTMA 1Y9BA 1JCDA 3L73G 3TDKA 2FYUE 1KQFB 5CCGD 2M8RA 2D2CD 2WSFJ 4LLHA 1BSHA 4NPFX 1FDOA 3VMYA 1JO5A 1JMMA 2E42A 4EDFA 3N7NA 1EZVE 2MKVA 1VQ6P 1SQVE 4AUWA 3EFGA 4PV1B 1T2KD 1SQPD 1FZAA 1GZLA 3NTNA 1YQ3C 2C9NY 2WITA 3RL0B 1OWAA 3SFDC 1L0LG 3SWKA 1WFXA 1USDA 1H8AA 1NOHA 3ZDMA 1UIXA 2KSJA 2IYOA 1URQD 1BGYG 1M1JC 2Q3EA 2NPSC 2QM8A 1DH3A 2IBZD 2KNCA 1BCCG 3VYIA 5KLVK 1P84I 3D71A 2MJZA 2E43A 4XE5B 1MKMA 3W68A 3L75E 3CCUP 1AQ5A 2A06G 4Y99B 3L70D 5KAIH 4L73A 3RK3C 4D6TE 4LC1A 4CPGA 3D6YA 2QRXA 3L72J 1DIPA 3GLMA 3PTZA 1AFOA 3B5NB 1KMIZ 1HWTC 5APTA 1SQBG 1LTJB 2K9YA 2ZYAA 2C0WA 3D70A 4YTPC 2ZT9B 1L0NK 3TGUJ 1YIJP 2FXPA 1N7SD 1RE3C 2JJLA 5KLIC 3WUUA 3Q3DA 2W6JH 1K73Q 1KB9D 3L35A 4H13C 3O6QA 4H44D 3MGNA 1J1EC 3IAOA 1USEA 2B89A 1EDLA 1SFCD 2E75C 3BCCJ 4WY4C 3B71A 2ZYGA 1JY2N 2QSIA 1SQPG 3H32B 2JWDA 2Z4EA 3CX5H 4IOIH 1LWUA 1DD4A 4OH8B 3ITKA 3OAKA 2QM7A 4UB6H 1RF1B 1QGKB 3QH9A 3BRTB 4JBZA 1SQXD 3GG2A 2DW3A 1T3JA 3MUDA 5AVWB 1S5LE 1CSBA 1NTMD 2Z5HA 4OVNF 2G8YA 4I2LC 1VQ8P 3GF7A 3I55P 1VF5B 1L0LK 4RJTA 3A0HE 3FXDA 1S5LX 3WU2E 2H89C 2KI7B 4W7YA 3CCEP 3L70G 1JUNA 3AE6C 4IFDK 1IFIA 4PD4D 1T3UA 1OIPA 1H88A 3CCSP 4U3FE 2O0PA 1QL1A 5TISE 1GL2D 1AVYA 2E74B 3N4XA 1E79H 2XDJA 1CW5A 2FYUJ 3HD7B 2O3JA 1NAFA 2KZJA 5AVXB 3CXHH 1N73B 1M8OB 1IJDB 5AVTB 1SQBK 2HODA 2WSCH 3QWOC 1J1DB 1NO4A 1Z56A 2OYIA 1FS0E 4IL6H 5AW9B 2D2CC 3H1KE 3VN0A 1KFNA 1SQVJ 1L4AD 2W6BA 5AW1B 1JNMA 1N7LA 5APSA 2A45H 1KORA 3IR9A 3CC4P 2SPZA 1S1CX 3RBXA 5CJ0A 3L37A 1ZR4A 1OXZA 2E76B 1FOSE 3OJAB 3L72D 1SQPK 2XNXA 1VQ4P 2G3AA 2RN0A 4YXWH 1BE3G 2KXPB 3KPEA 2HW2A 3AE3C 5AVQB 1PGQA 4WBAA 3L74J 1YYCA 4PV1D 3RK2C 4EOTA 3KZIH 3L75J 2OTKE 3PH0A 3PHLA 3RL0D 4L76A 2Y9ZA 1VQKP 1PGOA 4D6TJ 2JEEA 3B8EB 2XU6A 1PV3A 1GK4A 1IFMA 2PRRA 1PZQA 3L71E 1GW3A 1GU5A 1LWUC 1G2CA 3Q1MA 3GHGB 3BCCD 1FJKA 2ZFCA 3S9OA 2P67A 3MUDC 1HF9A 2WZ7A 1K8AQ 1OVRA 1FZCB 5AW0B 5APWA 3B4SA 2P7JA 4I6MC 3L72E 2ZXXA 5DJTB 2IBZI 1FC2C 1LTAC 1ZV8A 5GTHE 2WPQA 1OVUA 4JF7A 1NTKE 2I1JA 1YI2P 3B5ND 3HTKA 2GM4A 3L36A 1Q86Q 2PAJA 4RO0A 1FZGA 1M1JA 1RF0A 3FX0A 4H44C 5AW2B 2NPSA 2ZT9D 1K05A 3H1IE 3Q2YA 2E5TA 1JY3O 1SVFA 4O9BA 4PJ0H 1HGZA 1JM0A 3OW2O 3H1HE 2QG4A 1G1IA 3LW5J 3ABVC 5KLVE 1RY3A 2WQYC 1VQ9P 1S2EA 1JY3P 2JWAA 5APUA 2CPBA 1PP9E 3AEAC 2NZ2A 1JMBA 2IPPA 3CCLP 2KS1A 2FYUD 1KB9I 4DJGA 2BCCE 3TGUG 5APYA 4YXDC 1SQQE 3UIAA 1NTMK 3GF3A 5AVZB 1RH5B 4ZNCA 3FGAD 1EZVD 3K5BA 2FXMA 1KFMA 1L0NE 1EDKA 5AVYB 2K88A 3CWBE 3FWLA 4U3FJ 4Z1MH 2YXRB 3BRVB 2FY8A 1YTZT 3GMAA 1NAYA 2HFED 5KAIE 1VF5D 1VQ7P 1CI6B 2P10A 2M3BA 2Y0DA 4WY4A 1GD2E 1FE6A 2FYNC 2YIUC 4C7NA 2N1TD 1PPJG 1GL2C 5AW6B 2Q1KA 3HE5A 3E1IA 5GTIH 3P7KA 2N9BA 1GU4A 3U1AA 2ZJSE 2R3SA 4A7PA 1XTCC 3H1KJ 1QVFO 3C8VA 1OMIA 1NTZJ 1P84H 1VPCA 3L74D 1SP4A 3R2PA 1WMKA 2ZAEB 2QJYC 3L75D 2E74D 1LT9C 4L74A 4B86A 3HD7D 4PD4I 3G9RA 1L4AC 4HJGH 4D6TD 4KHXA 2ZVOB 4YPCA 1RQUA 3S4RA 1QX8A 3CX5E 1OZHA 3MD0A 3RL0g 4UB6E 2FYUG 2BASA 1T8ZA 1ZMEC 2IDBA 3CCQP 3AE2C 2Q9IA 2WSEJ 3KQGA 2WT7B 3AE8C 2A06E 3A2AA 1JCCA 3PRJA 1RF0C 3V6IA 4PV1C 4DZOA 3A7OA 3L71J 1EZVG 1KILA 2E76D 2YXQB 3RL0C 2XZRA 1HJ0A 1SQVG 2W27A 3L74E 1X79B 2K9JA 3AEFC 4H0LC 1KV4A 5K5GB 2Q7CA 5CCGA 2PGDA 3RK3B 2R44A 2CPSA 3PP5A 2KZIA 1NWQA 2C9LY 1N86A 2ZVNB 2B87A 1LP1A 1AA0A 1FDMA 4JYBA 4I1LA 1WT6A 2FYZA 5EFWB 4BRYA 3VOPA 4GOFA 1OFCX 1NTKJ 4AYCA 4Y99C 2WPRA 3CXHE 1LTIC 2YKOA 5TJHA 3TYYA 1ZW0A 1M57D 3H1IJ 4TLFA 2IZ1A 2QJKC 4IL6E 4QMAA 3B5NC 4D6TG 5AW4B 4BWNA 1URQA 3H1HJ 3H1JJ 4C7NB 5KLVJ 2QVAA 4U3FD 4ZKPA 1Q7YQ 1PP9J 4R4LA 1NH4A 3AE4C 2IZ0A 2YMKA 4Y28J 5AVRB 4HH2A 5KKZC 2BCCJ 1LGHB 3SWFA 2Q5UA 3P8CD 2L91A 1NU1E 1SQQJ 3C1LA 4OGQC 1KC8Q 2QA4P 4I7ZB 2OYHA 4W80A 1J2JB 3HUSA 1OX3A 5CBNA 4HB1A 3H1KD 2FYUK 3A3YB 1UIIA 1L0NJ 1LTSC 1ZOYC 3KZIE 3CWBJ 2IBZG 2YKPA 1GDTA 2RMZA 1NTZD 2WMMA 4EI2A 1YITP 1FBMA 1N7SA 1KYOI 1NHLA 3M0AA 1GTWA 4IFMA 2IFNA 4L75A 1SQVK 1PIXA 2OYOA 1X0TA 2CK3H 1HTLC 1SFCA 3U59A 2GUVA 3VTPC 1M7LA 5CCHC 2N1TC 1IFDA 5CHXA 1KQSO 1R8EA 1JY3N 2O1KA 4DOJA 3P8CE 1GK6A 2KNCB 2ITAA 1KILC 2QEXP 4JPZB 3V2QA 1D7MA 1EZVI 5B66H 3FWNA 3P8MC 3OA7A 3T97A 3CLQA 3MZWB 4N6JA 5CCGC 1YHQP 3L71D 3JC22 2E74C 5AVUB 1NTZE 1QEXA 1R5SA 4U3FG 2YMYA 3CCJP 4BRYB 4PJ0E 2E5YA 1QL2A 3KXDA 3HE4A 3VMZA 2H43A 1BE3E 3AEGC 1J1DC 2M5AA
chains in the Genus database with same CATH topology
1LP1B 1MFTA 3MHVA 2WMMA 2M5AB 2ZAEB 5DJUB 2HR3A 2OTKE 4K3AA 1S3JA 3PH0A 5C39A 4ASVA 2O0PA 1BDCA 4HKZH 5EFWB 2UWJE 2O0QA 4KJMA 4GOFA 1BDDA 4HJGH 2B88A 1NVOA 2RKLA 1U7MA 1JMBA 2KUBA 2KZJA 1EC5A 2KS1B 2B89A 1EDJA 1EDLA 1WFXA 4WWIA 1X0TA 3ZDMA 2LXBA 1ZW0A 2LXCB 2P58A 2JWDA 3QWOC 4MN4C 4IOIH 4ZNCA 4K35A 4NPDA 4ASWA 1ZXGA 1OVRA 4ZMDA 2M0BA 1LT1A 1EDKA 4JBZA 4BXLA 2LR2A 4NPEA 2QVAA 1Q2NA 3RGUA 2SPZA 5DJTB 1EDIA 1FC2C 1DEEG 1H0TA 3FXEA 3MZWB 1OVUA 1SS1A 1H0TB 2KIKA 1OVVA 5CBOA 4CPGA 2QRXA 4GOEA 3S1KA 3FXDA 4GODA 5K5GB 2K3RA 2Q1KA 2JQNA 2KI7B 2R44A 4NPFX 1U7JA 4EYYQ 2KZIA 2HW2A 5CBNA 4HB1A 1Y47A 2B87A 1JM0A 1LP1A 2I8DA 2B87B 2M5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LP1 B;  1MFT A;  3MHV A;  2WMM A;  2M5A B;  2ZAE B;  5DJU B;  2HR3 A;  2OTK E;  4K3A A;  1S3J A;  3PH0 A;  5C39 A;  4ASV A;  1BDC A;  4HKZ H;  5EFW B;  2UWJ E;  4KJM A;  4GOF A;  1BDD A;  4HJG H;  2B88 A;  1NVO A;  2RKL A;  1U7M A;  1JMB A;  2KUB A;  2KZJ A;  1EC5 A;  2KS1 B;  2B89 A;  1EDJ A;  1EDL A;  4WWI A;  1X0T A;  3ZDM A;  2LXB A;  1ZW0 A;  2LXC B;  2P58 A;  2JWD A;  3QWO C;  4MN4 C;  4IOI H;  4ZNC A;  4K35 A;  4NPD A;  4ASW A;  1ZXG A;  1OVR A;  4ZMD A;  2M0B A;  1LT1 A;  1EDK A;  4JBZ A;  4BXL A;  2LR2 A;  4NPE A;  2QVA A;  1Q2N A;  3RGU A;  2SPZ A;  5DJT B;  1EDI A;  1FC2 C;  1DEE G;  1H0T A;  3FXE A;  3MZW B;  1OVU A;  1SS1 A;  1H0T B;  2KIK A;  1OVV A;  5CBO A;  4CPG A;  2QRX A;  4GOE A;  3S1K A;  3FXD A;  4GOD A;  5K5G B;  2K3R A;  2Q1K A;  2KI7 B;  2R44 A;  4NPF X;  1U7J A;  4EYY Q;  2KZI A;  5CBN A;  4HB1 A;  1Y47 A;  2B87 A;  1JM0 A;  1LP1 A;  2I8D A;  2B87 B;  2M5A A; 
#chains in the Genus database with same CATH topology
 1IK9 A;  1T2K C;  3TNU A;  1SQX G;  1M90 Q;  3E1R A;  5C39 A;  1NKN A;  1NTM G;  1JEK A;  1Y8A A;  3NXS A;  4U7J A;  1AJY A;  5KTB A;  3O6Q B;  3H1K G;  3RK2 B;  3SFE C;  1NTK D;  1GL2 A;  3M0D C;  2FFD C;  1HH0 A;  2WPS A;  3CC2 P;  1URQ C;  2LXB A;  2IYP A;  2P58 A;  3H1I D;  1KQL A;  2O01 H;  3JSV C;  4RES B;  1LWU B;  2JDI H;  5AW7 B;  1JY2 O;  3H1H D;  1RQV A;  2V7Q H;  4ZMD A;  1LT9 A;  1JTH A;  1LTG C;  3H1J D;  1X8Y A;  5KLV D;  3G6E P;  1A02 J;  1L4A A;  2HPC A;  3H1L E;  1NGM B;  1PP9 D;  1H0T A;  3FXE A;  1EXJ A;  1KB9 H;  1JY2 P;  2W90 A;  1YJ9 P;  2BCC D;  2OYH C;  3HUS C;  5H2F H;  5CBO A;  2WSC J;  2KYV A;  5GTI E;  4XA4 A;  2IX7 C;  1SQQ D;  3CI9 A;  1MV8 A;  1VQP P;  1Q82 Q;  4EYY Q;  1IZN B;  1N7S C;  1YQ4 C;  1P84 E;  2AUA A;  1GW4 A;  1U57 A;  1Y47 A;  2QJP C;  1LJ2 A;  2I8D A;  1L0N D;  1L2P A;  1HBW A;  3AED C;  1W5C E;  3CWB D;  2WTY A;  1JOC A;  3WUV A;  2AXC A;  5M1B A;  2C0X A;  1KZU B;  2W8Z A;  3NMD A;  1SFC C;  2KP8 A;  1U7M A;  3CL3 D;  3WUT A;  1NU1 J;  1EC5 A;  3WMM 0;  3CMA P;  5KAF H;  1NJI Q;  2YNY A;  3V2N A;  3H1J E;  3L72 G;  2LXC B;  3VMX A;  1S4X A;  2HOD B;  1BSN A;  4K35 A;  2WSF H;  4JQ0 D;  2OYI B;  4GT1 A;  1ZXG A;  2M0B A;  1SQX K;  3AE1 C;  3D6Z A;  1FOS F;  2LR2 A;  3RK3 E;  2M3E A;  1Q2N A;  3NFQ A;  4PD4 H;  1M56 D;  5KJ7 D;  1KN7 A;  1DEE G;  1YJN P;  1DEB A;  1OW7 A;  2NRG A;  3H1H G;  5AW5 B;  1RE4 A;  1L0L D;  1SLQ A;  2R5B A;  4UB8 H;  2OQQ A;  1PPJ E;  3CX5 D;  2W6A A;  3BCC G;  3AE9 C;  3B5N A;  1IFN A;  2KLV A;  3A5T A;  4N3Y B;  1S9K E;  1PP9 G;  2FYN B;  1PGJ A;  2XKM A;  2YIU B;  2P1J A;  1YBK A;  2J58 A;  5E79 H;  2XND H;  3I56 P;  1IFP A;  3L73 E;  1ZRT D;  1SQQ G;  2HR3 A;  3Q5S A;  4HKZ H;  2A06 D;  1NKZ B;  5CMZ A;  1KQG B;  1NVO A;  3Q5R A;  1CZQ A;  5APX A;  2HLO A;  1G2C B;  2ZXE B;  3H32 A;  1W2E A;  3R4Y A;  5AVV B;  2FKW B;  3A0B H;  1BE3 J;  2Y0E A;  1M1K Q;  2KB7 P;  1LNQ A;  1NYH A;  3MIW A;  2Y9Y A;  2H7H A;  1RF1 A;  1OW8 A;  1DD3 A;  3EWK A;  1L0L E;  2ZYD A;  4LGD E;  4DT0 A;  2JP3 A;  2R32 A;  3IFM A;  1BGY E;  3P32 A;  3JCU H;  3CXH D;  2AEM A;  2AXT H;  3HTK B;  3G71 P;  1BCC E;  3TSI A;  3V2P A;  5B5E H;  1ZRT E;  5CCH A;  1M1J B;  2JQN A;  2N1T A;  1EXI A;  1KD1 Q;  1AVO A;  2NPS B;  1NTK K;  3AE5 C;  1IK7 A;  2R3C A;  4H0L B;  2OGU A;  3L4F A;  4GIF A;  2AEJ A;  2HG5 D;  3H1L J;  4K3A A;  1S3J A;  1QVG O;  3AEE C;  4N78 E;  3RK2 D;  2AEF A;  3TK1 A;  1KIL E;  5BVZ A;  1SQB E;  1VL2 A;  1ZP0 C;  2RKL A;  3HD7 A;  3EFF K;  2KS1 B;  1NU1 D;  1N73 A;  2V4H A;  3V4Q A;  1R5L A;  3IN6 A;  3KHU A;  1VQL P;  2QIW A;  1RHZ B;  2BEZ F;  5BU5 A;  3KYQ A;  2QE7 H;  3L74 G;  1KYO H;  5KLI B;  1SQQ K;  2P2U A;  2YO3 A;  2QJK B;  5B66 E;  1RE4 C;  4H13 B;  3L75 G;  2N9Y B;  2WWW A;  1SQP E;  2YKQ A;  3M0D A;  2FFD A;  1J1E B;  3PJS K;  2E75 B;  3HRN A;  4M3L A;  4WY4 B;  1LTJ C;  1MZ9 A;  5APV A;  2ZT9 C;  4GOE A;  1W2B O;  1FZE A;  4GOD A;  2LKM A;  2FBW C;  3HE5 B;  3BAT A;  4IL6 X;  5KKZ B;  4WB4 A;  3KDP B;  1U7J A;  1YJW P;  1TU3 F;  1VDF A;  2IBZ E;  3CME P;  4OGQ B;  1FZB A;  1OW6 A;  5AVS B;  2OAR A;  2UWJ E;  2KLU A;  3BAS A;  2RH0 A;  2J5U A;  3L70 E;  3CCM P;  2A45 G;  2H8P D;  2KK7 A;  2K37 A;  1XTG B;  3GHG A;  1FJP A;  4WWI A;  5KJ7 C;  3MTU E;  1Q81 Q;  1RF1 C;  1LTB C;  1MFZ A;  1BE3 D;  1VQN P;  4I7Z C;  4DCK A;  4EIJ A;  4NPD A;  3L73 J;  1VQM P;  1NU1 G;  2KSE A;  1FZC A;  1K9M Q;  1VF5 C;  3U1C A;  3LID A;  2N1T B;  1ZR2 A;  1KB9 E;  4OWF A;  5H2F E;  1KIL B;  1OVV A;  5APQ A;  3AEC C;  1IFJ A;  3S1K A;  2K9J B;  2IFM A;  2K3R A;  3E7K A;  1A02 F;  5L8R J;  2D2C B;  2WSS H;  3CX5 I;  3H6P A;  2O1J A;  1L0L J;  1BDC A;  2B87 B;  1LP1 B;  3MHV A;  1FU1 A;  2VRS A;  5DJU B;  1G1J A;  3HD7 C;  1SQX E;  3H1L D;  2B9B A;  1VQO P;  1K04 A;  1BGY J;  1N73 C;  1HGV A;  4RKU J;  1NTM E;  4KJM A;  1VQ5 P;  1DX7 A;  2KUB A;  5KAF E;  1FDI A;  2JO1 A;  1BCC J;  4W7Z A;  2Q6Q A;  1T6A A;  1PL5 A;  2I1K A;  1ZLL A;  4GDO A;  2FXO A;  4IFF A;  1P84 D;  2FFD B;  2JR8 A;  1HVV A;  1URQ B;  1EQ7 A;  1NTZ G;  4PD4 E;  3V5B A;  1AV1 A;  4BXL A;  4NPE A;  3CCV P;  3Q5P A;  1JB0 J;  2OTJ P;  3M9Q A;  5AW3 B;  1IO4 A;  2PP6 A;  1EDI A;  1SQB J;  2E76 C;  3VMA A;  1CI6 A;  3LW5 H;  3II6 A;  2GUS A;  1S5L H;  1SS1 A;  3VP8 A;  2R5D A;  3M06 A;  1HUC A;  4UB8 E;  3TGU D;  2BEQ D;  4R4M A;  2NPS D;  2W83 C;  3H25 A;  2Z5I A;  3CXH I;  3A0H H;  2GA1 A;  5CJ4 A;  3MP7 B;  4C46 A;  4H0L D;  5E79 E;  1LTT C;  2WVR A;  3WU2 H;  2OYH B;  3RBZ A;  3HUS B;  3CPW O;  3IF4 A;  1NU1 K;  3SWY A;  2WPV B;  4HYT B;  3RK3 D;  4ASV A;  1N7S B;  1SQP J;  1E5W A;  3GHG C;  2A45 I;  1IC2 A;  2QJP B;  3I5C A;  2J59 M;  2B88 A;  5TIS H;  3VP9 A;  1YTZ I;  3L71 G;  1H89 A;  3CD6 P;  1MUU A;  4XFJ A;  1PPJ D;  4H44 B;  3H1L G;  3A0B E;  1S9K D;  1FZC C;  1SFC B;  4MN4 C;  3M9H A;  3M91 A;  3GW6 A;  3TF5 A;  4H13 D;  4ASW A;  1GMJ A;  3L73 D;  1LT1 A;  3TGU E;  2Q3I A;  2HYN A;  2WT7 A;  1Q90 D;  1X9V A;  2E75 D;  1S72 P;  2OTL P;  2POH A;  3L70 J;  4WY4 D;  3JCU E;  1ZN5 A;  1KYO D;  2AXT E;  3T97 B;  3V2R A;  1AQT A;  2Y0C A;  1NTK G;  3PLN A;  2KIK A;  5B5E E;  3BVH A;  2O01 J;  3C9I A;  3BCC E;  3EQ2 A;  1X22 A;  3H1I G;  5BU8 B;  2YO2 A;  2V7Q J;  4OGQ D;  3HE4 B;  3USS A;  3CCR P;  3AEB C;  1FZF A;  4TT3 H;  1NTZ K;  3O8Z A;  1MFT A;  4AQR D;  2M5A B;  3M9B A;  2OYI C;  2L5G B;  3G3Z A;  3H1J G;  3CC7 P;  5AW8 B;  5KLV G;  3TNU B;  4JYC A;  1PGP A;  2O01 N;  1BGY D;  2O0Q A;  1LTJ A;  1BDD A;  2WSE H;  4WVZ A;  1QLE D;  1RE3 A;  4ZKU A;  2BCC G;  1GL2 B;  1EDJ A;  1SQV D;  3F5H A;  1BCC D;  1N8R Q;  3V4W A;  2KOG A;  2PFX A;  3SSU A;  2K1A A;  3F89 A;  3W67 A;  1KYO E;  1PFI A;  4C7R A;  2QJY B;  5CCH D;  3LIE A;  1L0N G;  1SQX J;  2XV5 A;  3CWB G;  1LT9 B;  1JTH B;  3G4S P;  3RGU A;  4N78 D;  3AE7 C;  1L4A B;  2HPC B;  1NTM J;  2H88 C;  4GKG A;  4KT0 J;  1KIL D;  1SQB D;  1FAV A;  2JKV A;  1H0T B;  1N2D C;  1WRG A;  5KJ7 A;  1HJB A;  5GTH H;  1KTM A;  1Y9B A;  1JCD A;  3L73 G;  3TDK A;  2FYU E;  1KQF B;  5CCG D;  2M8R A;  2D2C D;  2WSF J;  4LLH A;  1BSH A;  4NPF X;  1FDO A;  3VMY A;  1JO5 A;  1JMM A;  2E42 A;  4EDF A;  3N7N A;  1EZV E;  2MKV A;  1VQ6 P;  1SQV E;  4AUW A;  3EFG A;  4PV1 B;  1T2K D;  1SQP D;  1FZA A;  1GZL A;  3NTN A;  1YQ3 C;  2C9N Y;  2WIT A;  3RL0 B;  1OWA A;  3SFD C;  1L0L G;  3SWK A;  1WFX A;  1USD A;  1H8A A;  1NOH A;  3ZDM A;  1UIX A;  2KSJ A;  2IYO A;  1URQ D;  1BGY G;  1M1J C;  2Q3E A;  2NPS C;  2QM8 A;  1DH3 A;  2IBZ D;  2KNC A;  1BCC G;  3VYI A;  5KLV K;  1P84 I;  3D71 A;  2MJZ A;  2E43 A;  4XE5 B;  1MKM A;  3W68 A;  3L75 E;  3CCU P;  1AQ5 A;  2A06 G;  4Y99 B;  3L70 D;  5KAI H;  4L73 A;  3RK3 C;  4D6T E;  4LC1 A;  4CPG A;  3D6Y A;  2QRX A;  3L72 J;  1DIP A;  3GLM A;  3PTZ A;  1AFO A;  3B5N B;  1KMI Z;  1HWT C;  5APT A;  1SQB G;  1LTJ B;  2K9Y A;  2ZYA A;  2C0W A;  3D70 A;  4YTP C;  2ZT9 B;  1L0N K;  3TGU J;  1YIJ P;  2FXP A;  1N7S D;  1RE3 C;  2JJL A;  5KLI C;  3WUU A;  3Q3D A;  2W6J H;  1K73 Q;  1KB9 D;  3L35 A;  4H13 C;  3O6Q A;  4H44 D;  3MGN A;  1J1E C;  3IAO A;  1USE A;  2B89 A;  1EDL A;  1SFC D;  2E75 C;  3BCC J;  4WY4 C;  3B71 A;  2ZYG A;  1JY2 N;  2QSI A;  1SQP G;  3H32 B;  2JWD A;  2Z4E A;  3CX5 H;  4IOI H;  1LWU A;  1DD4 A;  4OH8 B;  3ITK A;  3OAK A;  2QM7 A;  4UB6 H;  1RF1 B;  1QGK B;  3QH9 A;  3BRT B;  4JBZ A;  1SQX D;  3GG2 A;  2DW3 A;  1T3J A;  3MUD A;  5AVW B;  1S5L E;  1CSB A;  1NTM D;  2Z5H A;  4OVN F;  2G8Y A;  4I2L C;  1VQ8 P;  3GF7 A;  3I55 P;  1VF5 B;  1L0L K;  4RJT A;  3A0H E;  3FXD A;  1S5L X;  3WU2 E;  2H89 C;  2KI7 B;  4W7Y A;  3CCE P;  3L70 G;  1JUN A;  3AE6 C;  4IFD K;  1IFI A;  4PD4 D;  1T3U A;  1OIP A;  1H88 A;  3CCS P;  4U3F E;  2O0P A;  1QL1 A;  5TIS E;  1GL2 D;  1AVY A;  2E74 B;  3N4X A;  1E79 H;  2XDJ A;  1CW5 A;  2FYU J;  3HD7 B;  2O3J A;  1NAF A;  2KZJ A;  5AVX B;  3CXH H;  1N73 B;  1M8O B;  1IJD B;  5AVT B;  1SQB K;  2HOD A;  2WSC H;  3QWO C;  1J1D B;  1NO4 A;  1Z56 A;  2OYI A;  1FS0 E;  4IL6 H;  5AW9 B;  2D2C C;  3H1K E;  3VN0 A;  1KFN A;  1SQV J;  1L4A D;  2W6B A;  5AW1 B;  1JNM A;  1N7L A;  5APS A;  2A45 H;  1KOR A;  3IR9 A;  3CC4 P;  2SPZ A;  1S1C X;  3RBX A;  5CJ0 A;  3L37 A;  1ZR4 A;  1OXZ A;  2E76 B;  1FOS E;  3OJA B;  3L72 D;  1SQP K;  2XNX A;  1VQ4 P;  2G3A A;  2RN0 A;  4YXW H;  1BE3 G;  2KXP B;  3KPE A;  2HW2 A;  3AE3 C;  5AVQ B;  1PGQ A;  4WBA A;  3L74 J;  1YYC A;  4PV1 D;  3RK2 C;  4EOT A;  3KZI H;  3L75 J;  2OTK E;  3PH0 A;  3PHL A;  3RL0 D;  4L76 A;  2Y9Z A;  1VQK P;  1PGO A;  4D6T J;  2JEE A;  3B8E B;  2XU6 A;  1PV3 A;  1GK4 A;  1IFM A;  2PRR A;  1PZQ A;  3L71 E;  1GW3 A;  1GU5 A;  1LWU C;  1G2C A;  3Q1M A;  3GHG B;  3BCC D;  1FJK A;  2ZFC A;  3S9O A;  2P67 A;  3MUD C;  1HF9 A;  2WZ7 A;  1K8A Q;  1OVR A;  1FZC B;  5AW0 B;  5APW A;  3B4S A;  2P7J A;  4I6M C;  3L72 E;  2ZXX A;  5DJT B;  2IBZ I;  1FC2 C;  1LTA C;  1ZV8 A;  5GTH E;  2WPQ A;  1OVU A;  4JF7 A;  1NTK E;  2I1J A;  1YI2 P;  3B5N D;  3HTK A;  2GM4 A;  3L36 A;  1Q86 Q;  2PAJ A;  4RO0 A;  1FZG A;  1M1J A;  1RF0 A;  3FX0 A;  4H44 C;  5AW2 B;  2NPS A;  2ZT9 D;  1K05 A;  3H1I E;  3Q2Y A;  2E5T A;  1JY3 O;  1SVF A;  4O9B A;  4PJ0 H;  1HGZ A;  1JM0 A;  3OW2 O;  3H1H E;  2QG4 A;  1G1I A;  3LW5 J;  3ABV C;  5KLV E;  1RY3 A;  2WQY C;  1VQ9 P;  1S2E A;  1JY3 P;  2JWA A;  5APU A;  2CPB A;  1PP9 E;  3AEA C;  2NZ2 A;  1JMB A;  2IPP A;  3CCL P;  2KS1 A;  2FYU D;  1KB9 I;  4DJG A;  2BCC E;  3TGU G;  5APY A;  4YXD C;  1SQQ E;  3UIA A;  1NTM K;  3GF3 A;  5AVZ B;  1RH5 B;  4ZNC A;  3FGA D;  1EZV D;  3K5B A;  2FXM A;  1KFM A;  1L0N E;  1EDK A;  5AVY B;  2K88 A;  3CWB E;  3FWL A;  4U3F J;  4Z1M H;  2YXR B;  3BRV B;  2FY8 A;  1YTZ T;  3GMA A;  1NAY A;  2HFE D;  5KAI E;  1VF5 D;  1VQ7 P;  1CI6 B;  2P10 A;  2M3B A;  2Y0D A;  4WY4 A;  1GD2 E;  1FE6 A;  2FYN C;  2YIU C;  4C7N A;  2N1T D;  1PPJ G;  1GL2 C;  5AW6 B;  2Q1K A;  3HE5 A;  3E1I A;  5GTI H;  3P7K A;  2N9B A;  1GU4 A;  3U1A A;  2ZJS E;  2R3S A;  4A7P A;  1XTC C;  3H1K J;  1QVF O;  3C8V A;  1OMI A;  1NTZ J;  1P84 H;  1VPC A;  3L74 D;  1SP4 A;  3R2P A;  1WMK A;  2ZAE B;  2QJY C;  3L75 D;  2E74 D;  1LT9 C;  4L74 A;  4B86 A;  3HD7 D;  4PD4 I;  3G9R A;  1L4A C;  4HJG H;  4D6T D;  4KHX A;  2ZVO B;  4YPC A;  1RQU A;  3S4R A;  1QX8 A;  3CX5 E;  1OZH A;  3MD0 A;  3RL0 g;  4UB6 E;  2FYU G;  2BAS A;  1T8Z A;  1ZME C;  2IDB A;  3CCQ P;  3AE2 C;  2Q9I A;  2WSE J;  3KQG A;  2WT7 B;  3AE8 C;  2A06 E;  3A2A A;  1JCC A;  3PRJ A;  1RF0 C;  3V6I A;  4PV1 C;  4DZO A;  3A7O A;  3L71 J;  1EZV G;  1KIL A;  2E76 D;  2YXQ B;  3RL0 C;  2XZR A;  1HJ0 A;  1SQV G;  2W27 A;  3L74 E;  1X79 B;  2K9J A;  3AEF C;  4H0L C;  1KV4 A;  5K5G B;  2Q7C A;  5CCG A;  2PGD A;  3RK3 B;  2R44 A;  2CPS A;  3PP5 A;  2KZI A;  1NWQ A;  2C9L Y;  1N86 A;  2ZVN B;  2B87 A;  1LP1 A;  1AA0 A;  1FDM A;  4JYB A;  4I1L A;  1WT6 A;  2FYZ A;  5EFW B;  4BRY A;  3VOP A;  4GOF A;  1OFC X;  1NTK J;  4AYC A;  4Y99 C;  2WPR A;  3CXH E;  1LTI C;  2YKO A;  5TJH A;  3TYY A;  1ZW0 A;  1M57 D;  3H1I J;  4TLF A;  2IZ1 A;  2QJK C;  4IL6 E;  4QMA A;  3B5N C;  4D6T G;  5AW4 B;  4BWN A;  1URQ A;  3H1H J;  3H1J J;  4C7N B;  5KLV J;  2QVA A;  4U3F D;  4ZKP A;  1Q7Y Q;  1PP9 J;  4R4L A;  1NH4 A;  3AE4 C;  2IZ0 A;  2YMK A;  4Y28 J;  5AVR B;  4HH2 A;  5KKZ C;  2BCC J;  1LGH B;  3SWF A;  2Q5U A;  3P8C D;  2L91 A;  1NU1 E;  1SQQ J;  3C1L A;  4OGQ C;  1KC8 Q;  2QA4 P;  4I7Z B;  2OYH A;  4W80 A;  1J2J B;  3HUS A;  1OX3 A;  5CBN A;  4HB1 A;  3H1K D;  2FYU K;  3A3Y B;  1UII A;  1L0N J;  1LTS C;  1ZOY C;  3KZI E;  3CWB J;  2IBZ G;  2YKP A;  1GDT A;  2RMZ A;  1NTZ D;  2WMM A;  4EI2 A;  1YIT P;  1FBM A;  1N7S A;  1KYO I;  1NHL A;  3M0A A;  1GTW A;  4IFM A;  2IFN A;  4L75 A;  1SQV K;  1PIX A;  2OYO A;  1X0T A;  2CK3 H;  1HTL C;  1SFC A;  3U59 A;  2GUV A;  3VTP C;  1M7L A;  5CCH C;  2N1T C;  1IFD A;  5CHX A;  1KQS O;  1R8E A;  1JY3 N;  2O1K A;  4DOJ A;  3P8C E;  1GK6 A;  2KNC B;  2ITA A;  1KIL C;  2QEX P;  4JPZ B;  3V2Q A;  1D7M A;  1EZV I;  5B66 H;  3FWN A;  3P8M C;  3OA7 A;  3T97 A;  3CLQ A;  3MZW B;  4N6J A;  5CCG C;  1YHQ P;  3L71 D;  3JC2 2;  2E74 C;  5AVU B;  1NTZ E;  1QEX A;  1R5S A;  4U3F G;  2YMY A;  3CCJ P;  4BRY B;  4PJ0 E;  2E5Y A;  1QL2 A;  3KXD A;  3HE4 A;  3VMZ A;  2H43 A;  1BE3 E;  3AEG C;  1J1D C;  2M5A A; 
#chains in the Genus database with same CATH homology
 1LP1 B;  1MFT A;  3MHV A;  2WMM A;  2M5A B;  2ZAE B;  5DJU B;  2HR3 A;  2OTK E;  4K3A A;  1S3J A;  3PH0 A;  5C39 A;  4ASV A;  2O0P A;  1BDC A;  4HKZ H;  5EFW B;  2UWJ E;  2O0Q A;  4KJM A;  4GOF A;  1BDD A;  4HJG H;  2B88 A;  1NVO A;  2RKL A;  1U7M A;  1JMB A;  2KUB A;  2KZJ A;  1EC5 A;  2KS1 B;  2B89 A;  1EDJ A;  1EDL A;  1WFX A;  4WWI A;  1X0T A;  3ZDM A;  2LXB A;  1ZW0 A;  2LXC B;  2P58 A;  2JWD A;  3QWO C;  4MN4 C;  4IOI H;  4ZNC A;  4K35 A;  4NPD A;  4ASW A;  1ZXG A;  1OVR A;  4ZMD A;  2M0B A;  1LT1 A;  1EDK A;  4JBZ A;  4BXL A;  2LR2 A;  4NPE A;  2QVA A;  1Q2N A;  3RGU A;  2SPZ A;  5DJT B;  1EDI A;  1FC2 C;  1DEE G;  1H0T A;  3FXE A;  3MZW B;  1OVU A;  1SS1 A;  1H0T B;  2KIK A;  1OVV A;  5CBO A;  4CPG A;  2QRX A;  4GOE A;  3S1K A;  3FXD A;  4GOD A;  5K5G B;  2K3R A;  2Q1K A;  2JQN A;  2KI7 B;  2R44 A;  4NPF X;  1U7J A;  4EYY Q;  2KZI A;  2HW2 A;  5CBN A;  4HB1 A;  1Y47 A;  2B87 A;  1JM0 A;  1LP1 A;  2I8D A;  2B87 B;  2M5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...