4EYYQ

Crystal structure of the icmr-icmq complex from legionella pneumophila
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
188
Chain Sequence
MKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGAASQAQLQAESHLANQIALQSGQQEIYVSLYSSDGSNLQSWEKIVGSLPISRPIYADEEDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGKPLLTLKDKSISLENISRFVHVSGVYRYSNGRLIKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IcmR
publication title IcmQ in the Type 4b secretion system contains an NAD+ binding domain.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein binding
total genus 47
structure length 188
sequence length 191
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4eyyQ01
3.20.170.50 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 4eyyQ02
2LR2A 3RGUA 3FXEA 2B87A 5CBNA 4KJMA 2KZJA 3MZWB 4ASWA 1OVUA 2UWJE 3PH0A 2LXCB 4ZMDA 4ZNCA 1Q2NA 4GOFA 2M0BA 1OVVA 1EC5A 5DJUB 1LP1B 1SS1A 2KIKA 2KUBA 5C39A 1OVRA 1EDIA 3QWOC 2KZIA 2QVAA 1U7MA 1JMBA 1DEEG 2B89A 2M5AB 1EDJA 4NPEA 2I8DA 2B87B 1NVOA 1BDDA 3ZDMA 5EFWB 1ZXGA 1H0TA 1MFTA 1U7JA 4GOEA 1JM0A 2HR3A 2WMMA 2B88A 4IOIH 1LT1A 1EDLA 4BXLA 4NPDA 4ASVA 2QRXA 2P58A 4K35A 2ZAEB 4MN4C 2R44A 1X0TA 4CPGA 4HKZH 2RKLA 1S3JA 2LXBA 4WWIA 3S1KA 2K3RA 5CBOA 2Q1KA 4JBZA 1EDKA 4GODA 1Y47A 1LP1A 4K3AA 4EYYQ 1BDCA 4NPFX 2KS1B 3FXDA 1ZW0A 2JWDA 4HB1A 5K5GB 1FC2C 2SPZA 5DJTB 1H0TB 2KI7B 2OTKE 3MHVA 2M5AA 4HJGH
chains in the Genus database with same CATH superfamily
5KLVG 2FXOA 4KJMA 4IFFA 1KN7A 1SQPD 1S1CX 3IF4A 1M56D 2E5TA 1KZUB 1FOSE 2K1AA 3AEFC 1WT6A 1QVFO 3GLMA 2IPPA 1NH4A 1PPJG 2FKWB 1BSHA 3L71D 4I2LC 3NFQA 2POHA 5AVYB 1RF1A 4H44C 3RBXA 3GHGA 5H2FH 2IYOA 3H1JG 3G71P 1EZVI 2J58A 1MFZA 1YTZT 3ZDMA 1SQQJ 3JCUH 1MFTA 1LTJA 2PRRA 5E79E 3CCEP 1U7JA 3M9BA 4PV1D 2WSSH 4H0LD 3EWKA 1XTGB 4PJ0E 1M1JB 4HKZH 2N1TC 1DD4A 3S1KA 5B5EE 1GU5A 1N73A 1BDCA 1DEBA 1PP9J 1FAVA 2OYHA 3A0HH 3AEGC 2LKMA 3L74E 5AW6B 3BRTB 2P2UA 1NOHA 2KZJA 2H43A 1NHLA 1ZRTE 4PD4H 3A7OA 1PL5A 2P10A 3AE5C 2KB7P 1PP9E 1L4AB 3V2NA 1PGPA 3GG2A 1XTCC 1G2CA 3BASA 2M0BA 1OVVA 3Q3DA 3B5NC 3TNUA 2IZ1A 3F89A 1CW5A 1JCCA 2RH0A 1K8AQ 1CZQA 1SQBK 1P84I 2YKQA 3M0AA 3G9RA 5CCGC 5CCHC 1BDDA 2YO2A 2BCCE 3AE4C 5M1BA 1SP4A 2E5YA 1SVFA 2NZ2A 1OIPA 1BE3G 1Q81Q 3SWYA 4M3LA 2B88A 3V2RA 1K9MQ 3TSIA 1FE6A 4LC1A 2O0PA 1VQ6P 2IBZG 4CPGA 4N78E 2OTLP 2XU6A 1KYOD 5AVWB 1GL2A 3L70E 2HLOA 1DX7A 1OXZA 4UB8H 1ZW0A 4AYCA 1KORA 2WSEH 2E74B 2O01N 4EIJA 4I6MC 1BCCJ 1JTHB 4HJGH 1SQBJ 2H88C 1NAYA 3H32B 1SQQD 1OFCX 3HTKA 4ASWA 1J1DC 2QJKC 3RL0g 3CPWO 5TJHA 2WWWA 4JF7A 1L4AD 5GTIH 1HUCA 1Q2NA 1VQMP 1LT9B 1YHQP 2O1JA 1EXJA 1H88A 5AVSB 2FFDB 1KB9H 1SQXE 1L0NG 4WVZA 1EZVD 3RK2C 2Q3EA 3HRNA 5H2FE 4WY4D 4D6TJ 2FYZA 2W6JH 3CCJP 1JY2N 2IZ0A 1Q7YQ 1SFCB 1U57A 3RK3E 1SLQA 1W2BO 1PP9D 5KAIH 2QA4P 3JCUE 3NXSA 2AXCA 3V2PA 1KC8Q 3USSA 1NO4A 2W27A 4QMAA 3VMZA 1RE4A 4IL6H 1LGHB 3E7KA 5AVQB 2HG5D 4D6TE 1JUNA 4U3FJ 3O6QB 3AE1C 3AEBC 3N7NA 1VQ5P 2E75C 3I55P 2E74D 5B66H 5KAFH 1W5CE 1H0TB 3CXHI 3H1LJ 1IFNA 3A0HE 4N78D 1RY3A 2KNCA 1KILE 5APYA 4DJGA 1PZQA 4PD4E 1LJ2A 3P32A 3CLQA 1AA0A 3CWBD 1BGYJ 2B9BA 3L72J 3A0BH 5KJ7C 5APQA 3H1IJ 1M1JA 3BRVB 2V7QH 4ZKPA 2D2CC 2FXPA 5AW3B 3VP8A 1N7SD 4Y99B 1OVRA 1L0LE 2GUSA 1S5LX 3MP7B 3KDPB 1FZAA 1USDA 1DEEG 3L75E 1BGYE 2K9JB 1VQ8P 1SFCD 1VQ9P 1LWUA 3D70A 1T8ZA 4XFJA 2YIUC 4JYBA 1ZOYC 1JY3P 3MTUE 3CX5I 1SQVG 1BCCD 2OYIB 4C7RA 1YTZI 3BCCJ 1EDLA 5BU8B 1SQBD 1KYOH 2R5DA 3AEDC 5APXA 4I1LA 1X0TA 2BEQD 1MV8A 1L4AA 3M91A 1N8RQ 1HBWA 3L73G 1LNQA 2YXQB 5CJ4A 2XNXA 1GW3A 1FZBA 3BCCE 1VQ7P 5DJTB 1QL1A 2WQYC 2ZT9B 1SQPE 1R8EA 3M0DA 2YKPA 1DH3A 1G1JA 3PP5A 2OTJP 3CCRP 1FDIA 2J59M 3IR9A 1H89A 1JB0J 3EQ2A 3R4YA 3L71E 1M90Q 5GTHE 3KZIH 3VMXA 2W6AA 5GTIE 3L35A 3EFGA 4TLFA 5DJUB 3CCVP 4L73A 2AXTH 4UB6H 3LW5H 4U3FD 3QWOC 1FBMA 1URQA 1KB9E 1RF1C 2M3EA 1L2PA 3Q2YA 4PD4D 5EFWB 1QVGO 1NTKD 1LTAC 1GU4A 1USEA 1JTHA 4C7NB 5KAIE 3H1LD 1LTJC 3H32A 2WPQA 2G3AA 1OWAA 2ZAEB 3GF7A 1R5SA 2NPSA 4OGQC 2O1KA 4HH2A 3SFDC 1LT9A 3R2PA 3CCSP 3HE4A 3L72D 2ZJSE 3IFMA 3L74G 3D6ZA 3I5CA 2N1TB 3H1ID 2AEMA 2ZYGA 3KYQA 4YXDC 2FFDA 1YJNP 2QJYC 3CXHD 3L36A 1N73C 3WMM0 2ZT9D 3MHVA 5KAFE 5B66E 2QIWA 1SFCA 1Q86Q 2V7QJ 1PP9G 1ZV8A 3FWLA 3G4SP 1SQQK 4JYCA 1IFIA 3CCMP 2C0XA 2LXCB 1HGVA 3TF5A 2QEXP 3BCCD 2WTYA 1S9KD 1P84H 3C8VA 1M8OB 2HFED 4L75A 3O6QA 2BCCG 3CC7P 3HD7A 3CCUP 3B5NB 4B86A 4AQRD 1RQUA 2KSJA 1Q82Q 4H44D 4GDOA 2W6BA 3CL3D 2KLVA 3KPEA 1IC2A 2QG4A 1QEXA 1H0TA 1JMMA 3CX5D 4WBAA 5AW4B 3TK1A 3L70G 3NTNA 3WUTA 2JP3A 1KYOE 4TT3H 1KB9D 2WT7B 2RKLA 2PGDA 3AE3C 3CMEP 4GIFA 3V6IA 3NMDA 3T97B 2WITA 2N1TD 3VOPA 1GDTA 1GL2C 1YI2P 4YXWH 2O01J 5K5GB 2WVRA 1KILA 5KLVK 3W67A 2K9JA 1SQQE 1MUUA 3LIDA 2KYVA 3CC2P 2Q6QA 5AW1B 3P8CE 2OYIA 1KQGB 3LW5J 4I7ZC 1A02F 3AE8C 1SQXG 2WPRA 1J1DB 2AEJA 2QJKB 3AE6C 1MKMA 3KZIE 1KQLA 2HODA 4H0LC 1SS1A 3E1RA 2QJPB 3UIAA 1EZVE 2IDBA 5AVUB 3B5ND 3H1HG 3Q5SA 1FU1A 2ZVOB 2AXTE 4H13C 1EDJA 3H25A 2K88A 2KLUA 3RK2B 1AVYA 1VF5C 5KKZC 1S5LH 2FBWC 2FYUK 1JY3O 5CCGD 2MJZA 4GOEA 5CCHD 1JM0A 4D6TG 4R4LA 2WMMA 5KLVJ 1LT1A 1RHZB 1KFMA 4EI2A 1GK4A 5APWA 1RE4C 2ZXEB 4WY4B 1QL2A 2VRSA 3SWFA 2M3BA 1QX8A 1LTGC 2HYNA 2N9YB 3CWBJ 3CXHH 3V5BA 5AW0B 4NPFX 2K37A 1PGQA 5AW2B 4KHXA 5KLVE 1WFXA 1YIJP 2FY8A 2IFMA 3L37A 3BVHA 2CPBA 2V4HA 3H1JJ 1PGOA 1YBKA 2WSFH 1YQ3C 2IX7C 3TYYA 3CWBE 4C7NA 2A06D 4JPZB 2FYUJ 2GA1A 3Q1MA 3IN6A 3CC4P 1L0LG 1RQVA 3SFEC 1NU1G 2MKVA 3OAKA 3RL0C 1FJPA 3L75G 4W7YA 1BGYG 1N7LA 1N2DC 1KQFB 5AVZB 1P84E 5C39A 1FZCB 3H1KG 1M1JC 1M7LA 2Q5UA 2ZYDA 2D2CB 3OJAB 2JDIH 3CX5H 4YTPC 3P8CD 1NVOA 2FYUE 4U7JA 3RK2D 3S4RA 3KXDA 1NTKK 1BCCE 2N9BA 2W83C 1VQOP 2R3CA 1CSBA 1LWUC 1SQBE 1N7SB 2YIUB 3VP9A 5AW8B 4NPDA 3B4SA 2QRXA 2KS1A 1VQ4P 1NTMG 1NTZD 2JWAA 2CPSA 1HJ0A 3CD6P 2ZFCA 3AE2C 1L4AC 1FDMA 1SQPG 3EFFK 4XE5B 2QSIA 2YNYA 2IBZI 2E75D 2OTKE 2AEFA 5AW5B 3VTPC 1HGZA 2WSCH 3L71G 1UIIA 3HUSB 1Q90D 5CCHA 2KK7A 4O9BA 3M0DC 1GD2E 2H7HA 3Q5PA 3P8MC 1NTKJ 3C9IA 2PFXA 3SSUA 1BE3J 2FYNB 5KLVD 1HH0A 1GMJA 3AEAC 2WT7A 1FZGA 1K04A 5KJ7D 4U3FE 1L0NK 3C1LA 1MZ9A 3T97A 2A45G 2D2CD 2QVAA 1T3JA 1NTKE 1PPJD 2I8DA 1KMIZ 1URQC 3H1LE 1E5WA 1OW8A 1S5LE 3H1JD 3I56P 4IOIH 1P84D 4DCKA 4ASVA 3PJSK 4K35A 2PAJA 4MN4C 4DT0A 2GM4A 3L72E 4DOJA 3CCQP 2P67A 2PP6A 2FYUD 2NPSC 3H1IE 4JBZA 1WMKA 4OGQB 4OVNF 4R4MA 2WSFJ 4EYYQ 3CXHE 1LT9C 4IFDK 1FC2C 1L0NJ 2W8ZA 2K9YA 2QJYB 1OW7A 1N73B 3D6YA 1NAFA 3PTZA 4IFMA 1KV4A 3JC22 3QH9A 2W90A 3WUUA 4UB8E 1DD3A 5E79H 1S9KE 3FGAD 3KHUA 1S72P 1K73Q 1L0NE 4WY4A 3KQGA 1VPCA 1E79H 3VMAA 1T3UA 2O01H 2XZRA 1T2KD 4PJ0H 2WPVB 1NYHA 4LGDE 5AVVB 1G2CB 2OGUA 3HD7C 1RE3A 3RK3C 2E76C 3CX5E 4GKGA 1OMIA 1S4XA 1SQVK 4OH8B 2I1KA 1AV1A 1PV3A 3PHLA 1OW6A 1AJYA 3M9QA 2BASA 2HPCB 3MIWA 4LLHA 2QM7A 4H44B 3GHGC 2WSCJ 1VDFA 1BE3D 4OGQD 1NWQA 1JY3N 3S9OA 2Z4EA 4N6JA 5KJ7A 1SQQG 1IFPA 3FXDA 2Y0CA 1FZCA 2AUAA 1JY2O 3PLNA 3U1AA 2IBZD 4IL6E 1WRGA 1AQ5A 3H6PA 2HW2A 1GL2B 2Q3IA 5BU5A 5CBNA 4YPCA 4W7ZA 1KILC 1PIXA 2C9NY 2RMZA 2YO3A 1OVUA 1N7SA 2UWJE 1FDOA 2JEEA 1GK6A 1EZVG 4GT1A 1SQVJ 2Q7CA 1JOCA 4I7ZB 4A7PA 5CHXA 3VYIA 3HTKB 2OYHC 1UIXA 1HWTC 5TISH 2KZIA 3L73J 1T6AA 1QLED 2B87B 3FWNA 1ZXGA 1X22A 4DZOA 1KQSO 3A0BE 3ABVC 4H13B 1L0ND 2HR3A 5KLIC 1ZN5A 3HUSA 5KKZB 4BXLA 3L73E 3OW2O 5KTBA 1FOSF 1NTZK 1R5LA 1S3JA 2KP8A 5APVA 2LXBA 2OYOA 2K3RA 1J1EC 1YJWP 1Y47A 4OWFA 3A5TA 3V4QA 5APSA 2SPZA 3GMAA 3CWBG 1GL2D 3RGUA 4Y28J 2M8RA 3AEEC 2A06E 2E43A 1OX3A 2YMYA 3MD0A 1HVVA 3B8EB 2CK3H 4GOFA 2KNCB 2KOGA 2FYUG 3RL0B 1A02J 1NTZJ 1BCCG 3N4XA 1D7MA 1OZHA 3AE9C 3L74J 1SQBG 4PV1C 3A2AA 3VN0A 3IAOA 4H13D 2XNDH 1VF5D 1VL2A 2Y9ZA 2C9LY 3TGUJ 2E42A 2OQQA 3GW6A 1NTZE 1G1IA 3SWKA 1LWUB 4UB6E 2BEZF 3AECC 2R44A 1JEKA 3TDKA 2YKOA 1SQVD 3AE7C 4XA4A 3HE5B 4K3AA 1RF0A 3MUDA 5CMZA 3TGUE 3G3ZA 2BCCJ 3FX0A 1GZLA 4BRYB 4C46A 3L73D 2I1JA 3CMAP 1K05A 2WZ7A 1ZR2A 5APUA 2Z5HA 5AW9B 1SQXK 4U3FG 2HPCA 1LTSC 1JY2P 2FXMA 3U1CA 2R32A 2E75B 1CI6B 3L70J 3ITKA 1NTKG 1LP1B 3RL0D 2ZXXA 3H1LG 3LIEA 1PPJE 1FZFA 1N86A 3BATA 2ZVNB 5TISE 4AUWA 1S2EA 4NPEA 1FZEA 2G8YA 3RBZA 2JQNA 4WB4A 1QGKB 3H1JE 1URQB 1YQ4C 3GF3A 3L72G 3H1IG 2L91A 2N1TA 4RKUJ 3CCLP 1X8YA 3P7KA 4L76A 1ZMEC 4BWNA 1KD1Q 1YITP 1SQXJ 1IK7A 2R3SA 2Y0EA 2NPSB 5GTHH 2Q9IA 2QJPC 2KI7B 3JSVC 3H1HJ 3HE4B 4EOTA 2R5BA 3FXEA 2B87A 2Y0DA 3BCCG 3L74D 3MZWB 1LTTC 1X79B 3F5HA 1NJIQ 1ZRTD 1L0LK 1NU1K 3M06A 1LTBC 3B5NA 3CI9A 4ZNCA 3TGUD 2A45H 4PD4I 5AVXB 3H1HE 1EC5A 2O0QA 1IFMA 2ITAA 4WY4C 1IK9A 5CCGA 1KFNA 1BSNA 4RJTA 3WU2H 2QE7H 1AFOA 2RN0A 2M5AB 2O3JA 3B71A 3Q5RA 2BCCD 1VQKP 3HD7B 1RE3C 3RK3B 1URQD 2E76B 2ZYAA 1AVOA 2XKMA 4KT0J 1M1KQ 4RESB 1NTMK 2P58A 2Y9YA 4ZKUA 3MGNA 1BE3E 4WWIA 1RF1B 1L0LJ 2GUVA 1NU1J 1EDKA 1SQPK 4GODA 3GHGB 2E74C 3V4WA 3L70D 2IBZE 3L75J 2NPSD 2C0WA 2OARA 2JKVA 3H1KJ 1H8AA 1Y9BA 1LTJB 1FZCC 2XDJA 4N3YB 1NKNA 1NKZB 2Z5IA 1W2EA 3A3YB 1NU1E 3M9HA 1FJKA 1LTIC 3E1IA 4JQ0D 1KILB 3PH0A 2H8PD 3II6A 1PFIA 4ZMDA 1ZR4A 1TU3F 2FFDC 1N7SC 3H1KE 1HF9A 1NTMJ 1IFDA 2KIKA 2KUBA 1EQ7A 2QM8A 4L74A 1SFCC 2WPSA 3HE5A 1U7MA 2OYHB 1SQXD 1JMBA 3O8ZA 1VQLP 2WSEJ 1SQPJ 2HODB 1KB9I 1VQNP 2DW3A 1JCDA 2J5UA 3W68A 4BRYA 3HD7D 3RK3D 2E76D 1NTME 3H1HD 1HJBA 2A45I 3L71J 5APTA 4EDFA 2L5GB 5KLIB 3HUSC 5AW7B 1NGMB 2YXRB 2YMKA 4Z1MH 3D71A 3TNUB 3OA7A 2XV5A 5B5EH 4D6TD 1CI6A 3WUVA 1AQTA 1LP1A 2FYNC 1X9VA 1FS0E 1ZP0C 2A06G 1J1EB 2JWDA 2P1JA 2LR2A 5CJ0A 1J2JB 1GW4A 1T2KC 1RH5B 3V2QA 2JJLA 1KILD 1JO5A 1IO4A 1IJDB 4Y99C 1EXIA 2H89C 1IZNB 2JO1A 1M57D 1EDIA 2IYPA 1L0LD 1NU1D 2B89A 3L4FA 1DIPA 3U59A 3PRJA 1YYCA 1JNMA 4IL6X 3WU2E 1HTLC 1VQPP 3L75D 2OYIC 1IFJA 3G6EP 1NTZG 1BGYD 4W80A 1YJ9P 4PV1B 3H1KD 1KTMA 5AVRB 1Z56A 2KSEA 2P7JA 1ZLLA 4H0LB 1GTWA 5AVTB 2IFNA 1SQVE 5BVZA 3TGUG 4RO0A 1KYOI 5CBOA 2Q1KA 1PGJA 3K5BA 1VF5B 2ZT9C 2KS1B 2KXPB 5L8RJ 1Y8AA 1NTMD 2NRGA 4HB1A 4HYTB 3VMYA 2JR8A 1RF0C 3MUDC 2M5AA
chains in the Genus database with same CATH topology
2LR2A 3RGUA 3FXEA 2B87A 5CBNA 4KJMA 2KZJA 3MZWB 4ASWA 1OVUA 2UWJE 3PH0A 2LXCB 4ZMDA 4ZNCA 2HW2A 1Q2NA 4GOFA 2M0BA 1OVVA 1EC5A 5DJUB 1LP1B 1SS1A 2KIKA 2KUBA 5C39A 2O0QA 1OVRA 1EDIA 3QWOC 2KZIA 2QVAA 1U7MA 1JMBA 1DEEG 2B89A 2M5AB 1EDJA 4NPEA 2I8DA 2B87B 1NVOA 1BDDA 3ZDMA 5EFWB 1ZXGA 1H0TA 1MFTA 2JQNA 1U7JA 4GOEA 1JM0A 2HR3A 2WMMA 2B88A 4IOIH 1LT1A 1EDLA 4BXLA 4NPDA 4ASVA 2QRXA 2P58A 4K35A 2ZAEB 2O0PA 4MN4C 2R44A 1X0TA 4CPGA 4HKZH 2RKLA 1S3JA 2LXBA 4WWIA 3S1KA 2K3RA 5CBOA 2Q1KA 4JBZA 1EDKA 4GODA 1Y47A 1LP1A 4K3AA 4EYYQ 1BDCA 4NPFX 2KS1B 3FXDA 1ZW0A 2JWDA 4HB1A 5K5GB 1FC2C 2SPZA 1WFXA 5DJTB 1H0TB 2KI7B 2OTKE 3MHVA 2M5AA 4HJGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LR2 A;  3RGU A;  3FXE A;  2B87 A;  5CBN A;  4KJM A;  2KZJ A;  3MZW B;  4ASW A;  1OVU A;  2UWJ E;  3PH0 A;  2LXC B;  4ZMD A;  4ZNC A;  1Q2N A;  4GOF A;  2M0B A;  1OVV A;  1EC5 A;  5DJU B;  1LP1 B;  1SS1 A;  2KIK A;  2KUB A;  5C39 A;  1OVR A;  1EDI A;  3QWO C;  2KZI A;  2QVA A;  1U7M A;  1JMB A;  1DEE G;  2B89 A;  2M5A B;  1EDJ A;  4NPE A;  2I8D A;  2B87 B;  1NVO A;  1BDD A;  3ZDM A;  5EFW B;  1ZXG A;  1H0T A;  1MFT A;  1U7J A;  4GOE A;  1JM0 A;  2HR3 A;  2WMM A;  2B88 A;  4IOI H;  1LT1 A;  1EDL A;  4BXL A;  4NPD A;  4ASV A;  2QRX A;  2P58 A;  4K35 A;  2ZAE B;  4MN4 C;  2R44 A;  1X0T A;  4CPG A;  4HKZ H;  2RKL A;  1S3J A;  2LXB A;  4WWI A;  3S1K A;  2K3R A;  5CBO A;  2Q1K A;  4JBZ A;  1EDK A;  4GOD A;  1Y47 A;  1LP1 A;  4K3A A;  4EYY Q;  1BDC A;  4NPF X;  2KS1 B;  3FXD A;  1ZW0 A;  2JWD A;  4HB1 A;  5K5G B;  1FC2 C;  2SPZ A;  5DJT B;  1H0T B;  2KI7 B;  2OTK E;  3MHV A;  2M5A A;  4HJG H; 
#chains in the Genus database with same CATH topology
 5KLV G;  2FXO A;  4KJM A;  4IFF A;  1KN7 A;  1SQP D;  1S1C X;  3IF4 A;  1M56 D;  2E5T A;  1KZU B;  1FOS E;  2K1A A;  3AEF C;  1WT6 A;  1QVF O;  3GLM A;  2IPP A;  1NH4 A;  1PPJ G;  2FKW B;  1BSH A;  3L71 D;  4I2L C;  3NFQ A;  2POH A;  5AVY B;  1RF1 A;  4H44 C;  3RBX A;  3GHG A;  5H2F H;  2IYO A;  3H1J G;  3G71 P;  1EZV I;  2J58 A;  1MFZ A;  1YTZ T;  3ZDM A;  1SQQ J;  3JCU H;  1MFT A;  1LTJ A;  2PRR A;  5E79 E;  3CCE P;  1U7J A;  3M9B A;  4PV1 D;  2WSS H;  4H0L D;  3EWK A;  1XTG B;  4PJ0 E;  1M1J B;  4HKZ H;  2N1T C;  1DD4 A;  3S1K A;  5B5E E;  1GU5 A;  1N73 A;  1BDC A;  1DEB A;  1PP9 J;  1FAV A;  2OYH A;  3A0H H;  3AEG C;  2LKM A;  3L74 E;  5AW6 B;  3BRT B;  2P2U A;  1NOH A;  2KZJ A;  2H43 A;  1NHL A;  1ZRT E;  4PD4 H;  3A7O A;  1PL5 A;  2P10 A;  3AE5 C;  2KB7 P;  1PP9 E;  1L4A B;  3V2N A;  1PGP A;  3GG2 A;  1XTC C;  1G2C A;  3BAS A;  2M0B A;  1OVV A;  3Q3D A;  3B5N C;  3TNU A;  2IZ1 A;  3F89 A;  1CW5 A;  1JCC A;  2RH0 A;  1K8A Q;  1CZQ A;  1SQB K;  1P84 I;  2YKQ A;  3M0A A;  3G9R A;  5CCG C;  5CCH C;  1BDD A;  2YO2 A;  2BCC E;  3AE4 C;  5M1B A;  1SP4 A;  2E5Y A;  1SVF A;  2NZ2 A;  1OIP A;  1BE3 G;  1Q81 Q;  3SWY A;  4M3L A;  2B88 A;  3V2R A;  1K9M Q;  3TSI A;  1FE6 A;  4LC1 A;  2O0P A;  1VQ6 P;  2IBZ G;  4CPG A;  4N78 E;  2OTL P;  2XU6 A;  1KYO D;  5AVW B;  1GL2 A;  3L70 E;  2HLO A;  1DX7 A;  1OXZ A;  4UB8 H;  1ZW0 A;  4AYC A;  1KOR A;  2WSE H;  2E74 B;  2O01 N;  4EIJ A;  4I6M C;  1BCC J;  1JTH B;  4HJG H;  1SQB J;  2H88 C;  1NAY A;  3H32 B;  1SQQ D;  1OFC X;  3HTK A;  4ASW A;  1J1D C;  2QJK C;  3RL0 g;  3CPW O;  5TJH A;  2WWW A;  4JF7 A;  1L4A D;  5GTI H;  1HUC A;  1Q2N A;  1VQM P;  1LT9 B;  1YHQ P;  2O1J A;  1EXJ A;  1H88 A;  5AVS B;  2FFD B;  1KB9 H;  1SQX E;  1L0N G;  4WVZ A;  1EZV D;  3RK2 C;  2Q3E A;  3HRN A;  5H2F E;  4WY4 D;  4D6T J;  2FYZ A;  2W6J H;  3CCJ P;  1JY2 N;  2IZ0 A;  1Q7Y Q;  1SFC B;  1U57 A;  3RK3 E;  1SLQ A;  1W2B O;  1PP9 D;  5KAI H;  2QA4 P;  3JCU E;  3NXS A;  2AXC A;  3V2P A;  1KC8 Q;  3USS A;  1NO4 A;  2W27 A;  4QMA A;  3VMZ A;  1RE4 A;  4IL6 H;  1LGH B;  3E7K A;  5AVQ B;  2HG5 D;  4D6T E;  1JUN A;  4U3F J;  3O6Q B;  3AE1 C;  3AEB C;  3N7N A;  1VQ5 P;  2E75 C;  3I55 P;  2E74 D;  5B66 H;  5KAF H;  1W5C E;  1H0T B;  3CXH I;  3H1L J;  1IFN A;  3A0H E;  4N78 D;  1RY3 A;  2KNC A;  1KIL E;  5APY A;  4DJG A;  1PZQ A;  4PD4 E;  1LJ2 A;  3P32 A;  3CLQ A;  1AA0 A;  3CWB D;  1BGY J;  2B9B A;  3L72 J;  3A0B H;  5KJ7 C;  5APQ A;  3H1I J;  1M1J A;  3BRV B;  2V7Q H;  4ZKP A;  2D2C C;  2FXP A;  5AW3 B;  3VP8 A;  1N7S D;  4Y99 B;  1OVR A;  1L0L E;  2GUS A;  1S5L X;  3MP7 B;  3KDP B;  1FZA A;  1USD A;  1DEE G;  3L75 E;  1BGY E;  2K9J B;  1VQ8 P;  1SFC D;  1VQ9 P;  1LWU A;  3D70 A;  1T8Z A;  4XFJ A;  2YIU C;  4JYB A;  1ZOY C;  1JY3 P;  3MTU E;  3CX5 I;  1SQV G;  1BCC D;  2OYI B;  4C7R A;  1YTZ I;  3BCC J;  1EDL A;  5BU8 B;  1SQB D;  1KYO H;  2R5D A;  3AED C;  5APX A;  4I1L A;  1X0T A;  2BEQ D;  1MV8 A;  1L4A A;  3M91 A;  1N8R Q;  1HBW A;  3L73 G;  1LNQ A;  2YXQ B;  5CJ4 A;  2XNX A;  1GW3 A;  1FZB A;  3BCC E;  1VQ7 P;  5DJT B;  1QL1 A;  2WQY C;  2ZT9 B;  1SQP E;  1R8E A;  3M0D A;  2YKP A;  1DH3 A;  1G1J A;  3PP5 A;  2OTJ P;  3CCR P;  1FDI A;  2J59 M;  3IR9 A;  1H89 A;  1JB0 J;  3EQ2 A;  3R4Y A;  3L71 E;  1M90 Q;  5GTH E;  3KZI H;  3VMX A;  2W6A A;  5GTI E;  3L35 A;  3EFG A;  4TLF A;  5DJU B;  3CCV P;  4L73 A;  2AXT H;  4UB6 H;  3LW5 H;  4U3F D;  3QWO C;  1FBM A;  1URQ A;  1KB9 E;  1RF1 C;  2M3E A;  1L2P A;  3Q2Y A;  4PD4 D;  5EFW B;  1QVG O;  1NTK D;  1LTA C;  1GU4 A;  1USE A;  1JTH A;  4C7N B;  5KAI E;  3H1L D;  1LTJ C;  3H32 A;  2WPQ A;  2G3A A;  1OWA A;  2ZAE B;  3GF7 A;  1R5S A;  2NPS A;  4OGQ C;  2O1K A;  4HH2 A;  3SFD C;  1LT9 A;  3R2P A;  3CCS P;  3HE4 A;  3L72 D;  2ZJS E;  3IFM A;  3L74 G;  3D6Z A;  3I5C A;  2N1T B;  3H1I D;  2AEM A;  2ZYG A;  3KYQ A;  4YXD C;  2FFD A;  1YJN P;  2QJY C;  3CXH D;  3L36 A;  1N73 C;  3WMM 0;  2ZT9 D;  3MHV A;  5KAF E;  5B66 E;  2QIW A;  1SFC A;  1Q86 Q;  2V7Q J;  1PP9 G;  1ZV8 A;  3FWL A;  3G4S P;  1SQQ K;  4JYC A;  1IFI A;  3CCM P;  2C0X A;  2LXC B;  1HGV A;  3TF5 A;  2QEX P;  3BCC D;  2WTY A;  1S9K D;  1P84 H;  3C8V A;  1M8O B;  2HFE D;  4L75 A;  3O6Q A;  2BCC G;  3CC7 P;  3HD7 A;  3CCU P;  3B5N B;  4B86 A;  4AQR D;  1RQU A;  2KSJ A;  1Q82 Q;  4H44 D;  4GDO A;  2W6B A;  3CL3 D;  2KLV A;  3KPE A;  1IC2 A;  2QG4 A;  1QEX A;  1H0T A;  1JMM A;  3CX5 D;  4WBA A;  5AW4 B;  3TK1 A;  3L70 G;  3NTN A;  3WUT A;  2JP3 A;  1KYO E;  4TT3 H;  1KB9 D;  2WT7 B;  2RKL A;  2PGD A;  3AE3 C;  3CME P;  4GIF A;  3V6I A;  3NMD A;  3T97 B;  2WIT A;  2N1T D;  3VOP A;  1GDT A;  1GL2 C;  1YI2 P;  4YXW H;  2O01 J;  5K5G B;  2WVR A;  1KIL A;  5KLV K;  3W67 A;  2K9J A;  1SQQ E;  1MUU A;  3LID A;  2KYV A;  3CC2 P;  2Q6Q A;  5AW1 B;  3P8C E;  2OYI A;  1KQG B;  3LW5 J;  4I7Z C;  1A02 F;  3AE8 C;  1SQX G;  2WPR A;  1J1D B;  2AEJ A;  2QJK B;  3AE6 C;  1MKM A;  3KZI E;  1KQL A;  2HOD A;  4H0L C;  1SS1 A;  3E1R A;  2QJP B;  3UIA A;  1EZV E;  2IDB A;  5AVU B;  3B5N D;  3H1H G;  3Q5S A;  1FU1 A;  2ZVO B;  2AXT E;  4H13 C;  1EDJ A;  3H25 A;  2K88 A;  2KLU A;  3RK2 B;  1AVY A;  1VF5 C;  5KKZ C;  1S5L H;  2FBW C;  2FYU K;  1JY3 O;  5CCG D;  2MJZ A;  4GOE A;  5CCH D;  1JM0 A;  4D6T G;  4R4L A;  2WMM A;  5KLV J;  1LT1 A;  1RHZ B;  1KFM A;  4EI2 A;  1GK4 A;  5APW A;  1RE4 C;  2ZXE B;  4WY4 B;  1QL2 A;  2VRS A;  3SWF A;  2M3B A;  1QX8 A;  1LTG C;  2HYN A;  2N9Y B;  3CWB J;  3CXH H;  3V5B A;  5AW0 B;  4NPF X;  2K37 A;  1PGQ A;  5AW2 B;  4KHX A;  5KLV E;  1WFX A;  1YIJ P;  2FY8 A;  2IFM A;  3L37 A;  3BVH A;  2CPB A;  2V4H A;  3H1J J;  1PGO A;  1YBK A;  2WSF H;  1YQ3 C;  2IX7 C;  3TYY A;  3CWB E;  4C7N A;  2A06 D;  4JPZ B;  2FYU J;  2GA1 A;  3Q1M A;  3IN6 A;  3CC4 P;  1L0L G;  1RQV A;  3SFE C;  1NU1 G;  2MKV A;  3OAK A;  3RL0 C;  1FJP A;  3L75 G;  4W7Y A;  1BGY G;  1N7L A;  1N2D C;  1KQF B;  5AVZ B;  1P84 E;  5C39 A;  1FZC B;  3H1K G;  1M1J C;  1M7L A;  2Q5U A;  2ZYD A;  2D2C B;  3OJA B;  2JDI H;  3CX5 H;  4YTP C;  3P8C D;  1NVO A;  2FYU E;  4U7J A;  3RK2 D;  3S4R A;  3KXD A;  1NTK K;  1BCC E;  2N9B A;  2W83 C;  1VQO P;  2R3C A;  1CSB A;  1LWU C;  1SQB E;  1N7S B;  2YIU B;  3VP9 A;  5AW8 B;  4NPD A;  3B4S A;  2QRX A;  2KS1 A;  1VQ4 P;  1NTM G;  1NTZ D;  2JWA A;  2CPS A;  1HJ0 A;  3CD6 P;  2ZFC A;  3AE2 C;  1L4A C;  1FDM A;  1SQP G;  3EFF K;  4XE5 B;  2QSI A;  2YNY A;  2IBZ I;  2E75 D;  2OTK E;  2AEF A;  5AW5 B;  3VTP C;  1HGZ A;  2WSC H;  3L71 G;  1UII A;  3HUS B;  1Q90 D;  5CCH A;  2KK7 A;  4O9B A;  3M0D C;  1GD2 E;  2H7H A;  3Q5P A;  3P8M C;  1NTK J;  3C9I A;  2PFX A;  3SSU A;  1BE3 J;  2FYN B;  5KLV D;  1HH0 A;  1GMJ A;  3AEA C;  2WT7 A;  1FZG A;  1K04 A;  5KJ7 D;  4U3F E;  1L0N K;  3C1L A;  1MZ9 A;  3T97 A;  2A45 G;  2D2C D;  2QVA A;  1T3J A;  1NTK E;  1PPJ D;  2I8D A;  1KMI Z;  1URQ C;  3H1L E;  1E5W A;  1OW8 A;  1S5L E;  3H1J D;  3I56 P;  4IOI H;  1P84 D;  4DCK A;  4ASV A;  3PJS K;  4K35 A;  2PAJ A;  4MN4 C;  4DT0 A;  2GM4 A;  3L72 E;  4DOJ A;  3CCQ P;  2P67 A;  2PP6 A;  2FYU D;  2NPS C;  3H1I E;  4JBZ A;  1WMK A;  4OGQ B;  4OVN F;  4R4M A;  2WSF J;  4EYY Q;  3CXH E;  1LT9 C;  4IFD K;  1FC2 C;  1L0N J;  2W8Z A;  2K9Y A;  2QJY B;  1OW7 A;  1N73 B;  3D6Y A;  1NAF A;  3PTZ A;  4IFM A;  1KV4 A;  3JC2 2;  3QH9 A;  2W90 A;  3WUU A;  4UB8 E;  1DD3 A;  5E79 H;  1S9K E;  3FGA D;  3KHU A;  1S72 P;  1K73 Q;  1L0N E;  4WY4 A;  3KQG A;  1VPC A;  1E79 H;  3VMA A;  1T3U A;  2O01 H;  2XZR A;  1T2K D;  4PJ0 H;  2WPV B;  1NYH A;  4LGD E;  5AVV B;  1G2C B;  2OGU A;  3HD7 C;  1RE3 A;  3RK3 C;  2E76 C;  3CX5 E;  4GKG A;  1OMI A;  1S4X A;  1SQV K;  4OH8 B;  2I1K A;  1AV1 A;  1PV3 A;  3PHL A;  1OW6 A;  1AJY A;  3M9Q A;  2BAS A;  2HPC B;  3MIW A;  4LLH A;  2QM7 A;  4H44 B;  3GHG C;  2WSC J;  1VDF A;  1BE3 D;  4OGQ D;  1NWQ A;  1JY3 N;  3S9O A;  2Z4E A;  4N6J A;  5KJ7 A;  1SQQ G;  1IFP A;  3FXD A;  2Y0C A;  1FZC A;  2AUA A;  1JY2 O;  3PLN A;  3U1A A;  2IBZ D;  4IL6 E;  1WRG A;  1AQ5 A;  3H6P A;  2HW2 A;  1GL2 B;  2Q3I A;  5BU5 A;  5CBN A;  4YPC A;  4W7Z A;  1KIL C;  1PIX A;  2C9N Y;  2RMZ A;  2YO3 A;  1OVU A;  1N7S A;  2UWJ E;  1FDO A;  2JEE A;  1GK6 A;  1EZV G;  4GT1 A;  1SQV J;  2Q7C A;  1JOC A;  4I7Z B;  4A7P A;  5CHX A;  3VYI A;  3HTK B;  2OYH C;  1UIX A;  1HWT C;  5TIS H;  2KZI A;  3L73 J;  1T6A A;  1QLE D;  2B87 B;  3FWN A;  1ZXG A;  1X22 A;  4DZO A;  1KQS O;  3A0B E;  3ABV C;  4H13 B;  1L0N D;  2HR3 A;  5KLI C;  1ZN5 A;  3HUS A;  5KKZ B;  4BXL A;  3L73 E;  3OW2 O;  5KTB A;  1FOS F;  1NTZ K;  1R5L A;  1S3J A;  2KP8 A;  5APV A;  2LXB A;  2OYO A;  2K3R A;  1J1E C;  1YJW P;  1Y47 A;  4OWF A;  3A5T A;  3V4Q A;  5APS A;  2SPZ A;  3GMA A;  3CWB G;  1GL2 D;  3RGU A;  4Y28 J;  2M8R A;  3AEE C;  2A06 E;  2E43 A;  1OX3 A;  2YMY A;  3MD0 A;  1HVV A;  3B8E B;  2CK3 H;  4GOF A;  2KNC B;  2KOG A;  2FYU G;  3RL0 B;  1A02 J;  1NTZ J;  1BCC G;  3N4X A;  1D7M A;  1OZH A;  3AE9 C;  3L74 J;  1SQB G;  4PV1 C;  3A2A A;  3VN0 A;  3IAO A;  4H13 D;  2XND H;  1VF5 D;  1VL2 A;  2Y9Z A;  2C9L Y;  3TGU J;  2E42 A;  2OQQ A;  3GW6 A;  1NTZ E;  1G1I A;  3SWK A;  1LWU B;  4UB6 E;  2BEZ F;  3AEC C;  2R44 A;  1JEK A;  3TDK A;  2YKO A;  1SQV D;  3AE7 C;  4XA4 A;  3HE5 B;  4K3A A;  1RF0 A;  3MUD A;  5CMZ A;  3TGU E;  3G3Z A;  2BCC J;  3FX0 A;  1GZL A;  4BRY B;  4C46 A;  3L73 D;  2I1J A;  3CMA P;  1K05 A;  2WZ7 A;  1ZR2 A;  5APU A;  2Z5H A;  5AW9 B;  1SQX K;  4U3F G;  2HPC A;  1LTS C;  1JY2 P;  2FXM A;  3U1C A;  2R32 A;  2E75 B;  1CI6 B;  3L70 J;  3ITK A;  1NTK G;  1LP1 B;  3RL0 D;  2ZXX A;  3H1L G;  3LIE A;  1PPJ E;  1FZF A;  1N86 A;  3BAT A;  2ZVN B;  5TIS E;  4AUW A;  1S2E A;  4NPE A;  1FZE A;  2G8Y A;  3RBZ A;  2JQN A;  4WB4 A;  1QGK B;  3H1J E;  1URQ B;  1YQ4 C;  3GF3 A;  3L72 G;  3H1I G;  2L91 A;  2N1T A;  4RKU J;  3CCL P;  1X8Y A;  3P7K A;  4L76 A;  1ZME C;  4BWN A;  1KD1 Q;  1YIT P;  1SQX J;  1IK7 A;  2R3S A;  2Y0E A;  2NPS B;  5GTH H;  2Q9I A;  2QJP C;  2KI7 B;  3JSV C;  3H1H J;  3HE4 B;  4EOT A;  2R5B A;  3FXE A;  2B87 A;  2Y0D A;  3BCC G;  3L74 D;  3MZW B;  1LTT C;  1X79 B;  3F5H A;  1NJI Q;  1ZRT D;  1L0L K;  1NU1 K;  3M06 A;  1LTB C;  3B5N A;  3CI9 A;  4ZNC A;  3TGU D;  2A45 H;  4PD4 I;  5AVX B;  3H1H E;  1EC5 A;  2O0Q A;  1IFM A;  2ITA A;  4WY4 C;  1IK9 A;  5CCG A;  1KFN A;  1BSN A;  4RJT A;  3WU2 H;  2QE7 H;  1AFO A;  2RN0 A;  2M5A B;  2O3J A;  3B71 A;  3Q5R A;  2BCC D;  1VQK P;  3HD7 B;  1RE3 C;  3RK3 B;  1URQ D;  2E76 B;  2ZYA A;  1AVO A;  2XKM A;  4KT0 J;  1M1K Q;  4RES B;  1NTM K;  2P58 A;  2Y9Y A;  4ZKU A;  3MGN A;  1BE3 E;  4WWI A;  1RF1 B;  1L0L J;  2GUV A;  1NU1 J;  1EDK A;  1SQP K;  4GOD A;  3GHG B;  2E74 C;  3V4W A;  3L70 D;  2IBZ E;  3L75 J;  2NPS D;  2C0W A;  2OAR A;  2JKV A;  3H1K J;  1H8A A;  1Y9B A;  1LTJ B;  1FZC C;  2XDJ A;  4N3Y B;  1NKN A;  1NKZ B;  2Z5I A;  1W2E A;  3A3Y B;  1NU1 E;  3M9H A;  1FJK A;  1LTI C;  3E1I A;  4JQ0 D;  1KIL B;  3PH0 A;  2H8P D;  3II6 A;  1PFI A;  4ZMD A;  1ZR4 A;  1TU3 F;  2FFD C;  1N7S C;  3H1K E;  1HF9 A;  1NTM J;  1IFD A;  2KIK A;  2KUB A;  1EQ7 A;  2QM8 A;  4L74 A;  1SFC C;  2WPS A;  3HE5 A;  1U7M A;  2OYH B;  1SQX D;  1JMB A;  3O8Z A;  1VQL P;  2WSE J;  1SQP J;  2HOD B;  1KB9 I;  1VQN P;  2DW3 A;  1JCD A;  2J5U A;  3W68 A;  4BRY A;  3HD7 D;  3RK3 D;  2E76 D;  1NTM E;  3H1H D;  1HJB A;  2A45 I;  3L71 J;  5APT A;  4EDF A;  2L5G B;  5KLI B;  3HUS C;  5AW7 B;  1NGM B;  2YXR B;  2YMK A;  4Z1M H;  3D71 A;  3TNU B;  3OA7 A;  2XV5 A;  5B5E H;  4D6T D;  1CI6 A;  3WUV A;  1AQT A;  1LP1 A;  2FYN C;  1X9V A;  1FS0 E;  1ZP0 C;  2A06 G;  1J1E B;  2JWD A;  2P1J A;  2LR2 A;  5CJ0 A;  1J2J B;  1GW4 A;  1T2K C;  1RH5 B;  3V2Q A;  2JJL A;  1KIL D;  1JO5 A;  1IO4 A;  1IJD B;  4Y99 C;  1EXI A;  2H89 C;  1IZN B;  2JO1 A;  1M57 D;  1EDI A;  2IYP A;  1L0L D;  1NU1 D;  2B89 A;  3L4F A;  1DIP A;  3U59 A;  3PRJ A;  1YYC A;  1JNM A;  4IL6 X;  3WU2 E;  1HTL C;  1VQP P;  3L75 D;  2OYI C;  1IFJ A;  3G6E P;  1NTZ G;  1BGY D;  4W80 A;  1YJ9 P;  4PV1 B;  3H1K D;  1KTM A;  5AVR B;  1Z56 A;  2KSE A;  2P7J A;  1ZLL A;  4H0L B;  1GTW A;  5AVT B;  2IFN A;  1SQV E;  5BVZ A;  3TGU G;  4RO0 A;  1KYO I;  5CBO A;  2Q1K A;  1PGJ A;  3K5B A;  1VF5 B;  2ZT9 C;  2KS1 B;  2KXP B;  5L8R J;  1Y8A A;  1NTM D;  2NRG A;  4HB1 A;  4HYT B;  3VMY A;  2JR8 A;  1RF0 C;  3MUD C;  2M5A A; 
#chains in the Genus database with same CATH homology
 2LR2 A;  3RGU A;  3FXE A;  2B87 A;  5CBN A;  4KJM A;  2KZJ A;  3MZW B;  4ASW A;  1OVU A;  2UWJ E;  3PH0 A;  2LXC B;  4ZMD A;  4ZNC A;  2HW2 A;  1Q2N A;  4GOF A;  2M0B A;  1OVV A;  1EC5 A;  5DJU B;  1LP1 B;  1SS1 A;  2KIK A;  2KUB A;  5C39 A;  2O0Q A;  1OVR A;  1EDI A;  3QWO C;  2KZI A;  2QVA A;  1U7M A;  1JMB A;  1DEE G;  2B89 A;  2M5A B;  1EDJ A;  4NPE A;  2I8D A;  2B87 B;  1NVO A;  1BDD A;  3ZDM A;  5EFW B;  1ZXG A;  1H0T A;  1MFT A;  2JQN A;  1U7J A;  4GOE A;  1JM0 A;  2HR3 A;  2WMM A;  2B88 A;  4IOI H;  1LT1 A;  1EDL A;  4BXL A;  4NPD A;  4ASV A;  2QRX A;  2P58 A;  4K35 A;  2ZAE B;  2O0P A;  4MN4 C;  2R44 A;  1X0T A;  4CPG A;  4HKZ H;  2RKL A;  1S3J A;  2LXB A;  4WWI A;  3S1K A;  2K3R A;  5CBO A;  2Q1K A;  4JBZ A;  1EDK A;  4GOD A;  1Y47 A;  1LP1 A;  4K3A A;  4EYY Q;  1BDC A;  4NPF X;  2KS1 B;  3FXD A;  1ZW0 A;  2JWD A;  4HB1 A;  5K5G B;  1FC2 C;  2SPZ A;  1WFX A;  5DJT B;  1H0T B;  2KI7 B;  2OTK E;  3MHV A;  2M5A A;  4HJG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...