4EYYQ

Crystal structure of the icmr-icmq complex from legionella pneumophila
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
191
structure length
188
Chain Sequence
b'MKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGAASQAQLQAESHLANQIALQSGQQEIYVSLYSSDGSNLQSWEKIVGSLPISRPIYADEEDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGKPLLTLKDKSISLENISRFVHVSGVYRYSNGRLIKNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IcmR
molecule tags Protein binding
source organism Legionella pneumophila subsp. pneumophila
publication title IcmQ in the Type 4b secretion system contains an NAD+ binding domain.
pubmed doi rcsb
total genus 47
structure length 188
sequence length 191
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4eyyQ01
3.20.170.50 Alpha Beta Alpha-Beta Barrel ADP-ribosylation fold ADP-ribosylation fold 4eyyQ02
1FC2C 4K35A 1EC5A 2HR3A 5EFWB 5CBOA 2M5AB 1OVVA 2KIKA 2ZAEB 1NVOA 1BDCA 5C39A 5K5GB 1H0TA 4GODA 4NPDA 4HKZH 3FXDA 2JWDA 1JMBA 3ZDMA 4MN4C 5DJTB 3PH0A 2I8DA 1Y47A 2RKLA 1U7JA 2LR2A 4GOFA 2KI7B 2B87A 5DJUB 2P58A 2SPZA 4ASVA 1LP1B 1JM0A 1MFTA 2KZIA 1LT1A 1U7MA 4WWIA 1Q2NA 4HB1A 2UWJE 3S1KA 1EDKA 4JBZA 3FXEA 1OVUA 2QVAA 2KUBA 4NPFX 4CPGA 2R44A 2Q1KA 2B89A 2B88A 1LP1A 3RGUA 3MZWB 1S3JA 1EDIA 4HJGH 1DEEG 2KZJA 4K3AA 2K3RA 1X0TA 3QWOC 4ASWA 2WMMA 4IOIH 2LXBA 2OTKE 1SS1A 1OVRA 2LXCB 4ZMDA 2QRXA 4ZNCA 5CBNA 4BXLA 1BDDA 1H0TB 3MHVA 1EDJA 4NPEA 1EDLA 4EYYQ 2B87B 1ZXGA 2M0BA 2KS1B 4KJMA 2M5AA 1ZW0A 4GOEA
chains in the Genus database with same CATH superfamily
2QSIA 1IO4A 2KB7P 4RJTA 1PGQA 1URQC 3NTNA 5GTIH 1FDOA 3H1LJ 1NTKG 3B71A 1MFZA 2GA1A 3QH9A 3RK3E 1N7SA 4AQRD 4BRYA 3AE2C 4Y28J 2HR3A 3CWBE 2IZ1A 3L72D 3LW5J 1JTHB 1RE4C 2CPBA 2YKQA 3H1KG 4L75A 1RH5B 3SWYA 1NVOA 1VL2A 1S2EA 1LT9B 1ZR2A 1L0LJ 2CPSA 1KFMA 3FX0A 5C39A 1OW7A 2FFDA 2WSEH 2KXPB 1DIPA 1HGZA 2E75C 2B9BA 2RH0A 4HKZH 2AXTH 3B4SA 3S9OA 3V2PA 3WUUA 1SQXE 3CX5E 1T3JA 2JWDA 2WSFJ 1JMBA 3MTUE 1LWUB 3RK2C 2AEJA 1M57D 5CCGC 2FY8A 1CW5A 1FJPA 2AXTE 4JYCA 1OZHA 3HTKA 3TDKA 2HPCA 1QGKB 1BCCE 1DD4A 3P32A 4LLHA 2OYOA 3CC4P 1FZCC 1LTGC 2CK3H 2ZT9B 3M9BA 4U3FJ 1FE6A 1RQVA 1WMKA 3RK2D 3L75E 3AE3C 1SVFA 1QEXA 3BVHA 1E5WA 2HLOA 3AE5C 5KJ7C 1GK6A 1U7JA 4RESB 3CCQP 2OTJP 1YITP 1GL2B 1KFNA 1LTJB 2KS1A 2KI7B 2R3SA 2XZRA 4JF7A 5KLVD 2FFDC 5DJUB 1HJ0A 1RF0A 2J5UA 2JEEA 1SQVG 1KV4A 3L71G 5KJ7D 2K1AA 2NZ2A 4U3FD 1X22A 2IYOA 2P1JA 4N78E 1JEKA 4UB8H 4XE5B 4YXWH 1Q81Q 1MV8A 3JC22 1N7SC 1ZV8A 4I7ZB 3TYYA 4EI2A 4ZKPA 3BRVB 3CXHI 2PFXA 3GLMA 3H1KE 4HB1A 3K5BA 2JO1A 1KC8Q 2O1KA 1H89A 2N9YB 1EDKA 3AEFC 3B5NA 1RE3A 3PTZA 2ITAA 2W83C 3VP8A 1USDA 1FJKA 2WQYC 3OA7A 4DCKA 5B5EH 1X8YA 3TNUB 5KLVJ 2HODB 2IBZD 3SFDC 1PFIA 3H1ID 1PIXA 2I1KA 3V2QA 2Q1KA 5GTIE 2PAJA 3L74D 3KDPB 3D6ZA 1BGYE 1YQ4C 2B88A 2KLVA 1PPJG 3H1KJ 4B86A 4C7NA 5B5EE 3RK3B 1FOSE 5KTBA 2E75D 1L0LD 2M8RA 1N2DC 1BE3J 1NU1J 2E75B 3GW6A 2YO3A 5APVA 5BU5A 3PRJA 2HW2A 1BCCD 3A2AA 1YHQP 1N7LA 2K9YA 2FXMA 1FBMA 2K3RA 1VQ8P 1BE3E 1NU1E 1W5CE 2WWWA 3IAOA 3O6QA 4ASWA 1EXJA 3L75G 2KNCA 1VQ4P 2DW3A 1M8OB 1NHLA 3IF4A 4L74A 3BCCD 1GMJA 4IFMA 5KLIC 2OTKE 1FS0E 5KLVK 3BRTB 1PP9J 1U57A 3CXHE 1ZMEC 1NGMB 5M1BA 1P84D 5APQA 4D6TD 2YMKA 5H2FH 1YJ9P 2GUVA 1SQVE 2H88C 5AW8B 5KJ7A 3CL3D 2BEZF 1KILB 3AEBC 1KILC 3KYQA 1M90Q 1VQ9P 2ZYDA 1L2PA 2ZJSE 3MHVA 3C8VA 1R5SA 1L0LG 3A0BH 3L36A 1IFNA 1KB9H 2KS1B 3H1LD 3H32A 3MP7B 1SLQA 2E76B 2N1TB 2QM7A 1BGYG 1IFIA 3L70G 1ZW0A 1NTMG 2N1TD 3E1RA 4YTPC 1S9KD 5AW0B 1WFXA 3TGUD 5TISE 3C9IA 2O1JA 4GOEA 5AVUB 1M1KQ 1SQQG 1USEA 2IBZE 2E74C 1FC2C 4H0LC 1GDTA 3T97A 1H88A 1JY3P 1EZVG 1KB9I 1G2CA 4UB6H 4EOTA 1UIXA 1AQTA 2IFMA 3R4YA 2ZYGA 2Q6QA 4D6TJ 4H44B 1N73B 1LWUA 2V7QJ 1SQPJ 5EFWB 5APWA 5CHXA 5AW9B 3RL0C 1SP4A 3RK3C 1FDMA 2O0PA 1KTMA 2M5AB 2KYVA 2KIKA 2AEFA 2OYHC 1LTIC 3H32B 3CX5H 1RQUA 4IL6X 1P84I 5K5GB 5L8RJ 1IJDB 3NFQA 1FZGA 2P2UA 2VRSA 1FAVA 1BSNA 2BCCD 5E79E 2WSCH 2Q7CA 1KYOI 3CC2P 1AJYA 1EXIA 5AW3B 1BCCG 1SQBD 2QJYC 1N7SB 2XKMA 2KP8A 3E1IA 2FYUJ 3A7OA 3L74E 1YTZT 1NTKJ 2E5TA 4OVNF 5APSA 1AFOA 2IDBA 3W68A 2WPQA 1GL2D 4W80A 1PPJD 3SWFA 1HJBA 1SQBG 4AUWA 3V4QA 3O6QB 1BE3G 1FZBA 1NU1G 1KYOH 2BCCE 3PH0A 3L70D 3I5CA 3I55P 1NO4A 1S4XA 1IFPA 2FYUE 1QLED 1Y47A 3AECC 3EQ2A 3KQGA 2QJPC 2K9JB 3L73J 1N86A 2ZYAA 3RBZA 1KB9D 3A0HH 2Y0CA 3Q5RA 1L0NK 2OYIA 1ZP0C 1EZVD 2QJYB 3LIDA 4L73A 5AW6B 4DT0A 1OMIA 1NKZB 3IR9A 5KAFE 3R2PA 4W7ZA 2BEQD 3HUSA 5AW7B 4IFFA 1URQA 4Y99C 2OTLP 3A0BE 3U1CA 3AE9C 2V7QH 1JUNA 1LT1A 1KB9E 3Q1MA 2W6BA 3FWNA 4WWIA 3TNUA 2UWJE 1X9VA 1SQPK 5APUA 1NTKD 3VP9A 3WUTA 1KQFB 4GIFA 2FYUD 3EFGA 3GF3A 3L75J 2W6JH 1KILE 3B5NB 4JBZA 5APXA 3S1KA 3CMAP 1DH3A 3P8CE 2R5DA 3GF7A 5KLVE 3OW2O 1OVUA 2QIWA 2XNDH 1J2JB 5CCGD 2IBZG 2A45I 2R44A 2W27A 3H1HD 3RL0g 4IFDK 2MJZA 2B89A 2A45G 3H1LG 1JY3N 1IFJA 5APTA 2E74B 3L70J 5AVWB 5KAIE 3S4RA 1NAYA 2Q5UA 1SQBE 5AVYB 4WY4C 2Q9IA 2HPCB 1SQXJ 1JY2P 1EDIA 1RE4A 1YYCA 1NWQA 2J59M 2P67A 2YIUB 3II6A 3D71A 5AVQB 4O9BA 1X0TA 2PRRA 1DD3A 1JOCA 2XDJA 5AW1B 2ZFCA 2YXQB 1JCDA 2M3BA 3D70A 1KORA 4OGQC 3BCCG 3L71J 2LXBA 1VF5D 5B66E 5H2FE 1YBKA 1RHZB 2LKMA 1VDFA 3H1IJ 1R8EA 2L5GB 1Q82Q 1N7SD 5B66H 5TJHA 2WTYA 2LXCB 2H43A 1JB0J 1M1JA 2I1JA 2YIUC 3H1HG 5CJ4A 4WVZA 1GD2E 2O0QA 4ZNCA 3HUSB 1SQXK 1NH4A 1S9KE 1PL5A 1IC2A 3H25A 1GU4A 1DEBA 4D6TE 1EDJA 4NPEA 1QVGO 1HTLC 1RF0C 3A3YB 4KJMA 4L76A 2FYUG 3AEDC 4Z1MH 3M91A 2K9JA 1SFCC 3P8CD 4TLFA 2NPSC 2Z5IA 1WRGA 2ZVOB 4PD4H 1T3UA 2H89C 4PV1C 3CC7P 1VQMP 2JP3A 2ZT9D 3V6IA 1KQSO 3L72G 3BCCJ 4LC1A 2IFNA 2Y0DA 1SQVD 1KQLA 2ZXEB 3CX5I 4JPZB 4AYCA 1P84H 3CCRP 3D6YA 2JKVA 3LIEA 4EIJA 3WU2H 1NTZD 3KPEA 2FXPA 4K35A 2IBZI 1EZVI 1M7LA 2C0WA 2FKWB 1T8ZA 2AUAA 3VMAA 3G71P 3W67A 1FZEA 2POHA 3AEAC 3BCCE 4U7JA 1NTMD 2XV5A 1IZNB 1BE3D 1NU1D 1NTZK 3GG2A 4I2LC 1OWAA 5E79H 2WT7A 2JQNA 4C46A 1RF1C 3IFMA 2Q3IA 3UIAA 1SQVK 2RMZA 2IX7C 2QM8A 4Y99B 2PGDA 3H1HE 1FZAA 2E76D 2YNYA 2OQQA 1OFCX 3FWLA 2WSCJ 3MUDC 1NAFA 3L74G 1FDIA 2XU6A 3WUVA 1K8AQ 1FZFA 3H1IG 1N73A 4PJ0E 1L0LE 1BGYD 3VTPC 1Y9BA 1SQPE 4H13C 4JQ0D 1KYOE 3T97B 1IFMA 1LTSC 2FYZA 3V5BA 3AE8C 1VF5B 1PP9G 1MKMA 1SQQD 2KSEA 1J1DB 4PJ0H 2HYNA 2RN0A 2QEXP 5DJTB 4D6TG 3CCJP 1AVYA 1JNMA 2C0XA 1JY2O 3L72J 3CCEP 3Q3DA 1H8AA 4LGDE 3SFEC 5AVVB 1NTZJ 1J1EB 2RKLA 3H1KD 1IK7A 1OXZA 1SFCD 1CZQA 1M1JC 2E5YA 2LR2A 3CXHH 1TU3F 3M9HA 5AW2B 2B87A 3KZIE 1QL2A 5BU8B 3L72E 1FOSF 1CI6B 1XTCC 2SPZA 3M0DA 4RO0A 4ASVA 4DJGA 1LP1B 1YI2P 1VQ6P 1JM0A 1D7MA 4GDOA 1KILA 1MFTA 3RL0B 3RK3D 4H44C 3RL0D 2HFED 3TGUG 3VMZA 3HRNA 1Q7YQ 1NTMJ 1SQQJ 2D2CC 3V4WA 3M06A 2H8PD 4YPCA 2AXCA 2G8YA 1LT9C 1AA0A 3G3ZA 3CLQA 1LWUC 3P7KA 3H6PA 3HE4B 5AVXB 3RK2B 2IYPA 3AE1C 1BGYJ 1VQ7P 1AQ5A 5CCHC 1VF5C 2HG5D 5TISH 4OGQD 1BSHA 1N73C 2KNCB 4H13B 3H1JE 3H1LE 2KUBA 2W8ZA 3MGNA 2QG4A 4PV1B 3G4SP 2R32A 2N1TC 3P8MC 4UB6E 3GHGB 1URQB 3VYIA 2O01N 1KMIZ 2WSSH 1YJWP 3RGUA 3L71D 1RF1A 3VMXA 3JCUE 3BASA 1L4AD 5AVZB 2QE7H 1L4AA 3MZWB 3U59A 1S3JA 2ZXXA 1L4AB 5CMZA 2W90A 2IPPA 3WMM0 4DOJA 4HJGH 2N9BA 1DEEG 2M3EA 1NTKK 2YO2A 4XA4A 1RF1B 1KYOD 2KZJA 3L73G 3TK1A 1PP9E 1AV1A 4C7NB 1OX3A 1JO5A 3F89A 1GK4A 2HODA 2WSFH 1ZRTE 2A06E 3EWKA 4IOIH 1Q90D 2R5BA 4R4MA 1ZOYC 2Q3EA 1VQOP 2PP6A 1SQVJ 2H7HA 1MUUA 2L91A 1RE3C 1S5LX 2J58A 3HE4A 1N8RQ 1L0ND 1OW8A 1VQPP 1M56D 2OYHA 2FYNB 5CCGA 3TGUE 1OVRA 4RKUJ 1YIJP 3CPWO 4U3FG 1GW4A 1ZRTD 1QX8A 2A06D 2JWAA 2QJKB 2Y0EA 2YKOA 5BVZA 5KKZB 5CCHA 3ITKA 3V2RA 5CBNA 1NJIQ 2KOGA 2QJKC 4M3LA 4BXLA 1BDDA 1SQQK 4WY4B 1H0TB 3N7NA 3L37A 1PGOA 4PD4E 1UIIA 5KLVG 1NTZE 2K37A 2YKPA 4I6MC 4EYYQ 2B87B 4ZKUA 3VN0A 2OARA 1VQKP 2JJLA 1JY3O 2M5AA 1EQ7A 3LW5H 1PGJA 3Q5PA 1P84E 1T2KD 3CCMP 2OGUA 3CXHD 4GKGA 3VMYA 5KKZC 3L4FA 3TF5A 3CCSP 2JR8A 3HD7C 3PJSK 1EZVE 1G2CB 1QL1A 2FYNC 3B5NC 2GM4A 3KHUA 4HYTB 5CCHD 1E79H 1QVFO 1KN7A 4H0LD 1LGHB 1LNQA 1ZLLA 4U3FE 1PZQA 2NRGA 2E74D 3HTKB 2QA4P 1EC5A 1NU1K 3CWBJ 1HF9A 4I7ZC 3AE6C 1NTMK 4R4LA 2A06G 1OW6A 2C9NY 4PD4I 4WBAA 1T2KC 4PV1D 2G3AA 4GT1A 5CBOA 3IN6A 2OYHB 2N1TA 2O3JA 2R3CA 1OVVA 2ZAEB 3PHLA 2WPRA 4YXDC 1VQ5P 2P10A 1KQGB 2Y9YA 1BDCA 3OAKA 2C9LY 1JCCA 1L0NE 2FFDB 5GTHE 2GUSA 2YXRB 1L4AC 3EFFK 1K73Q 4WY4A 4GODA 4NPDA 5AW4B 1H0TA 3NMDA 1WT6A 1NYHA 3H1HJ 5KAIH 2V4HA 3FXDA 1HVVA 3M0AA 1JTHA 3GHGC 5GTHH 3Q2YA 2BASA 2KLUA 3L73D 4BRYB 3L71E 2D2CB 1A02F 1GL2C 1LTJC 1HUCA 3AE4C 3G9RA 4WB4A 4KHXA 3TSIA 3ZDMA 4MN4C 4A7PA 1LTTC 2WPVB 1ZR4A 4H13D 4OWFA 4W7YA 1FU1A 1RY3A 1SQXD 3CX5D 1VPCA 2KSJA 1NKNA 3NXSA 2ZT9C 3C1LA 2E42A 3KZIH 4KT0J 1FZCB 3N4XA 2I8DA 2NPSD 3B8EB 3JSVC 2AEMA 3G6EP 3OJAB 4GOFA 2FBWC 3BATA 2WITA 2XNXA 3H1JD 2WZ7A 3GMAA 4WY4D 1MZ9A 2BCCJ 2P58A 2Z5HA 1W2BO 1K04A 2O01H 4C7RA 2JDIH 4QMAA 3M9QA 2MKVA 2NPSA 1KILD 3H1IE 3CMEP 2ZVNB 2KZIA 3GHGA 3L75D 1AVOA 3CCUP 1PV3A 1M1JB 1KD1Q 1HGVA 2QJPB 3HE5A 2Y9ZA 1J1EC 4N3YB 3CWBG 3RBXA 3AEEC 1U7MA 1Q2NA 1HBWA 1L0NG 3MIWA 2P7JA 2KK7A 1GTWA 1R5LA 1J1DC 3CCLP 1SFCA 1URQD 3B5ND 1L0LK 3KXDA 3MUDA 3FXEA 4N78D 2QVAA 3AE7C 3H1JJ 4NPFX 4OH8B 3JCUH 4CPGA 2OYIC 1GW3A 1K9MQ 1IK9A 2IZ0A 2YMYA 1S1CX 1LTAC 4H44D 2E76C 3ABVC 1SQPG 3WU2E 3SSUA 1JMMA 3Q5SA 3VOPA 1NOHA 1HWTC 1LP1A 1KZUB 4HH2A 2WSEJ 3HD7B 4IL6E 4TT3H 1CI6A 1SQQE 1Q86Q 1PPJE 1YQ3C 4N6JA 1S5LE 3HD7A 2FYUK 3CI9A 2FXOA 1GL2A 1LTJA 1SQPD 5CJ0A 3USSA 4DZOA 3CCVP 1OIPA 4IL6H 3E7KA 1VQLP 4K3AA 1HH0A 4JYBA 1GZLA 1BCCJ 2A45H 3CWBD 1S5LH 1X79B 3QWOC 1SQBJ 1K05A 3F5HA 1W2EA 2WMMA 4XFJA 5AVRB 4EDFA 3PP5A 1NTME 4BWNA 5KLIB 3O8ZA 1PP9D 1SFCB 3TGUJ 1SS1A 2W6AA 4H0LB 1Z56A 3HD7D 4I1LA 5AW5B 3A0HE 2D2CD 3CD6P 1IFDA 1NTKE 3L35A 3HE5B 4ZMDA 1GU5A 2WPSA 2QRXA 5APYA 1YJNP 3PLNA 1NTZG 5KAFH 2NPSB 1LTBC 1PGPA 1CSBA 3I56P 2E43A 1Y8AA 3L73E 1XTGB 1ZN5A 3AEGC 3H1JG 3M0DC 4UB8E 5AVTB 3SWKA 1S72P 1EDLA 3V2NA 2M0BA 1ZXGA 1LT9A 2WT7B 2WVRA 2Z4EA 2K88A 1VQNP 1YTZI 1SQBK 3FGAD 3HUSC 3U1AA 1G1IA 1LJ2A 3MD0A 1DX7A 4OGQB 1G1JA 1FZCA 1L0NJ 1A02J 4PD4D 2BCCG 5AVSB 3L74J 1SQXG 2O01J 2OYIB 3A5TA 1T6AA 1JY2N 3L70E
chains in the Genus database with same CATH topology
1FC2C 4K35A 1EC5A 2HR3A 5EFWB 5CBOA 2O0PA 2M5AB 1OVVA 2KIKA 2ZAEB 1NVOA 2JQNA 1BDCA 5C39A 5K5GB 1H0TA 4GODA 4NPDA 4HKZH 3FXDA 2JWDA 1JMBA 3ZDMA 4MN4C 5DJTB 3PH0A 2I8DA 1Y47A 2RKLA 1U7JA 2LR2A 4GOFA 2KI7B 2B87A 5DJUB 2P58A 2SPZA 4ASVA 1LP1B 1JM0A 1MFTA 2KZIA 1LT1A 1U7MA 4WWIA 1Q2NA 4HB1A 2UWJE 3S1KA 1EDKA 4JBZA 3FXEA 1OVUA 2QVAA 2KUBA 4NPFX 4CPGA 2R44A 2Q1KA 2B89A 2B88A 1LP1A 3RGUA 3MZWB 1S3JA 1EDIA 4HJGH 1DEEG 2HW2A 2KZJA 4K3AA 2K3RA 1X0TA 3QWOC 4ASWA 2WMMA 4IOIH 2LXBA 2OTKE 1SS1A 1OVRA 2LXCB 4ZMDA 2O0QA 2QRXA 4ZNCA 5CBNA 4BXLA 1BDDA 1H0TB 3MHVA 1EDJA 4NPEA 1EDLA 4EYYQ 2B87B 1ZXGA 2M0BA 2KS1B 4KJMA 2M5AA 1WFXA 1ZW0A 4GOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FC2 C;  4K35 A;  1EC5 A;  2HR3 A;  5EFW B;  5CBO A;  2M5A B;  1OVV A;  2KIK A;  2ZAE B;  1NVO A;  1BDC A;  5C39 A;  5K5G B;  1H0T A;  4GOD A;  4NPD A;  4HKZ H;  3FXD A;  2JWD A;  1JMB A;  3ZDM A;  4MN4 C;  5DJT B;  3PH0 A;  2I8D A;  1Y47 A;  2RKL A;  1U7J A;  2LR2 A;  4GOF A;  2KI7 B;  2B87 A;  5DJU B;  2P58 A;  2SPZ A;  4ASV A;  1LP1 B;  1JM0 A;  1MFT A;  2KZI A;  1LT1 A;  1U7M A;  4WWI A;  1Q2N A;  4HB1 A;  2UWJ E;  3S1K A;  1EDK A;  4JBZ A;  3FXE A;  1OVU A;  2QVA A;  2KUB A;  4NPF X;  4CPG A;  2R44 A;  2Q1K A;  2B89 A;  2B88 A;  1LP1 A;  3RGU A;  3MZW B;  1S3J A;  1EDI A;  4HJG H;  1DEE G;  2KZJ A;  4K3A A;  2K3R A;  1X0T A;  3QWO C;  4ASW A;  2WMM A;  4IOI H;  2LXB A;  2OTK E;  1SS1 A;  1OVR A;  2LXC B;  4ZMD A;  2QRX A;  4ZNC A;  5CBN A;  4BXL A;  1BDD A;  1H0T B;  3MHV A;  1EDJ A;  4NPE A;  1EDL A;  4EYY Q;  2B87 B;  1ZXG A;  2M0B A;  2KS1 B;  4KJM A;  2M5A A;  1ZW0 A;  4GOE A; 
#chains in the Genus database with same CATH topology
 2QSI A;  1IO4 A;  2KB7 P;  4RJT A;  1PGQ A;  1URQ C;  3NTN A;  5GTI H;  1FDO A;  3H1L J;  1NTK G;  3B71 A;  1MFZ A;  2GA1 A;  3QH9 A;  3RK3 E;  1N7S A;  4AQR D;  4BRY A;  3AE2 C;  4Y28 J;  2HR3 A;  3CWB E;  2IZ1 A;  3L72 D;  3LW5 J;  1JTH B;  1RE4 C;  2CPB A;  2YKQ A;  3H1K G;  4L75 A;  1RH5 B;  3SWY A;  1NVO A;  1VL2 A;  1S2E A;  1LT9 B;  1ZR2 A;  1L0L J;  2CPS A;  1KFM A;  3FX0 A;  5C39 A;  1OW7 A;  2FFD A;  2WSE H;  2KXP B;  1DIP A;  1HGZ A;  2E75 C;  2B9B A;  2RH0 A;  4HKZ H;  2AXT H;  3B4S A;  3S9O A;  3V2P A;  3WUU A;  1SQX E;  3CX5 E;  1T3J A;  2JWD A;  2WSF J;  1JMB A;  3MTU E;  1LWU B;  3RK2 C;  2AEJ A;  1M57 D;  5CCG C;  2FY8 A;  1CW5 A;  1FJP A;  2AXT E;  4JYC A;  1OZH A;  3HTK A;  3TDK A;  2HPC A;  1QGK B;  1BCC E;  1DD4 A;  3P32 A;  4LLH A;  2OYO A;  3CC4 P;  1FZC C;  1LTG C;  2CK3 H;  2ZT9 B;  3M9B A;  4U3F J;  1FE6 A;  1RQV A;  1WMK A;  3RK2 D;  3L75 E;  3AE3 C;  1SVF A;  1QEX A;  3BVH A;  1E5W A;  2HLO A;  3AE5 C;  5KJ7 C;  1GK6 A;  1U7J A;  4RES B;  3CCQ P;  2OTJ P;  1YIT P;  1GL2 B;  1KFN A;  1LTJ B;  2KS1 A;  2KI7 B;  2R3S A;  2XZR A;  4JF7 A;  5KLV D;  2FFD C;  5DJU B;  1HJ0 A;  1RF0 A;  2J5U A;  2JEE A;  1SQV G;  1KV4 A;  3L71 G;  5KJ7 D;  2K1A A;  2NZ2 A;  4U3F D;  1X22 A;  2IYO A;  2P1J A;  4N78 E;  1JEK A;  4UB8 H;  4XE5 B;  4YXW H;  1Q81 Q;  1MV8 A;  3JC2 2;  1N7S C;  1ZV8 A;  4I7Z B;  3TYY A;  4EI2 A;  4ZKP A;  3BRV B;  3CXH I;  2PFX A;  3GLM A;  3H1K E;  4HB1 A;  3K5B A;  2JO1 A;  1KC8 Q;  2O1K A;  1H89 A;  2N9Y B;  1EDK A;  3AEF C;  3B5N A;  1RE3 A;  3PTZ A;  2ITA A;  2W83 C;  3VP8 A;  1USD A;  1FJK A;  2WQY C;  3OA7 A;  4DCK A;  5B5E H;  1X8Y A;  3TNU B;  5KLV J;  2HOD B;  2IBZ D;  3SFD C;  1PFI A;  3H1I D;  1PIX A;  2I1K A;  3V2Q A;  2Q1K A;  5GTI E;  2PAJ A;  3L74 D;  3KDP B;  3D6Z A;  1BGY E;  1YQ4 C;  2B88 A;  2KLV A;  1PPJ G;  3H1K J;  4B86 A;  4C7N A;  5B5E E;  3RK3 B;  1FOS E;  5KTB A;  2E75 D;  1L0L D;  2M8R A;  1N2D C;  1BE3 J;  1NU1 J;  2E75 B;  3GW6 A;  2YO3 A;  5APV A;  5BU5 A;  3PRJ A;  2HW2 A;  1BCC D;  3A2A A;  1YHQ P;  1N7L A;  2K9Y A;  2FXM A;  1FBM A;  2K3R A;  1VQ8 P;  1BE3 E;  1NU1 E;  1W5C E;  2WWW A;  3IAO A;  3O6Q A;  4ASW A;  1EXJ A;  3L75 G;  2KNC A;  1VQ4 P;  2DW3 A;  1M8O B;  1NHL A;  3IF4 A;  4L74 A;  3BCC D;  1GMJ A;  4IFM A;  5KLI C;  2OTK E;  1FS0 E;  5KLV K;  3BRT B;  1PP9 J;  1U57 A;  3CXH E;  1ZME C;  1NGM B;  5M1B A;  1P84 D;  5APQ A;  4D6T D;  2YMK A;  5H2F H;  1YJ9 P;  2GUV A;  1SQV E;  2H88 C;  5AW8 B;  5KJ7 A;  3CL3 D;  2BEZ F;  1KIL B;  3AEB C;  1KIL C;  3KYQ A;  1M90 Q;  1VQ9 P;  2ZYD A;  1L2P A;  2ZJS E;  3MHV A;  3C8V A;  1R5S A;  1L0L G;  3A0B H;  3L36 A;  1IFN A;  1KB9 H;  2KS1 B;  3H1L D;  3H32 A;  3MP7 B;  1SLQ A;  2E76 B;  2N1T B;  2QM7 A;  1BGY G;  1IFI A;  3L70 G;  1ZW0 A;  1NTM G;  2N1T D;  3E1R A;  4YTP C;  1S9K D;  5AW0 B;  1WFX A;  3TGU D;  5TIS E;  3C9I A;  2O1J A;  4GOE A;  5AVU B;  1M1K Q;  1SQQ G;  1USE A;  2IBZ E;  2E74 C;  1FC2 C;  4H0L C;  1GDT A;  3T97 A;  1H88 A;  1JY3 P;  1EZV G;  1KB9 I;  1G2C A;  4UB6 H;  4EOT A;  1UIX A;  1AQT A;  2IFM A;  3R4Y A;  2ZYG A;  2Q6Q A;  4D6T J;  4H44 B;  1N73 B;  1LWU A;  2V7Q J;  1SQP J;  5EFW B;  5APW A;  5CHX A;  5AW9 B;  3RL0 C;  1SP4 A;  3RK3 C;  1FDM A;  2O0P A;  1KTM A;  2M5A B;  2KYV A;  2KIK A;  2AEF A;  2OYH C;  1LTI C;  3H32 B;  3CX5 H;  1RQU A;  4IL6 X;  1P84 I;  5K5G B;  5L8R J;  1IJD B;  3NFQ A;  1FZG A;  2P2U A;  2VRS A;  1FAV A;  1BSN A;  2BCC D;  5E79 E;  2WSC H;  2Q7C A;  1KYO I;  3CC2 P;  1AJY A;  1EXI A;  5AW3 B;  1BCC G;  1SQB D;  2QJY C;  1N7S B;  2XKM A;  2KP8 A;  3E1I A;  2FYU J;  3A7O A;  3L74 E;  1YTZ T;  1NTK J;  2E5T A;  4OVN F;  5APS A;  1AFO A;  2IDB A;  3W68 A;  2WPQ A;  1GL2 D;  4W80 A;  1PPJ D;  3SWF A;  1HJB A;  1SQB G;  4AUW A;  3V4Q A;  3O6Q B;  1BE3 G;  1FZB A;  1NU1 G;  1KYO H;  2BCC E;  3PH0 A;  3L70 D;  3I5C A;  3I55 P;  1NO4 A;  1S4X A;  1IFP A;  2FYU E;  1QLE D;  1Y47 A;  3AEC C;  3EQ2 A;  3KQG A;  2QJP C;  2K9J B;  3L73 J;  1N86 A;  2ZYA A;  3RBZ A;  1KB9 D;  3A0H H;  2Y0C A;  3Q5R A;  1L0N K;  2OYI A;  1ZP0 C;  1EZV D;  2QJY B;  3LID A;  4L73 A;  5AW6 B;  4DT0 A;  1OMI A;  1NKZ B;  3IR9 A;  5KAF E;  3R2P A;  4W7Z A;  2BEQ D;  3HUS A;  5AW7 B;  4IFF A;  1URQ A;  4Y99 C;  2OTL P;  3A0B E;  3U1C A;  3AE9 C;  2V7Q H;  1JUN A;  1LT1 A;  1KB9 E;  3Q1M A;  2W6B A;  3FWN A;  4WWI A;  3TNU A;  2UWJ E;  1X9V A;  1SQP K;  5APU A;  1NTK D;  3VP9 A;  3WUT A;  1KQF B;  4GIF A;  2FYU D;  3EFG A;  3GF3 A;  3L75 J;  2W6J H;  1KIL E;  3B5N B;  4JBZ A;  5APX A;  3S1K A;  3CMA P;  1DH3 A;  3P8C E;  2R5D A;  3GF7 A;  5KLV E;  3OW2 O;  1OVU A;  2QIW A;  2XND H;  1J2J B;  5CCG D;  2IBZ G;  2A45 I;  2R44 A;  2W27 A;  3H1H D;  3RL0 g;  4IFD K;  2MJZ A;  2B89 A;  2A45 G;  3H1L G;  1JY3 N;  1IFJ A;  5APT A;  2E74 B;  3L70 J;  5AVW B;  5KAI E;  3S4R A;  1NAY A;  2Q5U A;  1SQB E;  5AVY B;  4WY4 C;  2Q9I A;  2HPC B;  1SQX J;  1JY2 P;  1EDI A;  1RE4 A;  1YYC A;  1NWQ A;  2J59 M;  2P67 A;  2YIU B;  3II6 A;  3D71 A;  5AVQ B;  4O9B A;  1X0T A;  2PRR A;  1DD3 A;  1JOC A;  2XDJ A;  5AW1 B;  2ZFC A;  2YXQ B;  1JCD A;  2M3B A;  3D70 A;  1KOR A;  4OGQ C;  3BCC G;  3L71 J;  2LXB A;  1VF5 D;  5B66 E;  5H2F E;  1YBK A;  1RHZ B;  2LKM A;  1VDF A;  3H1I J;  1R8E A;  2L5G B;  1Q82 Q;  1N7S D;  5B66 H;  5TJH A;  2WTY A;  2LXC B;  2H43 A;  1JB0 J;  1M1J A;  2I1J A;  2YIU C;  3H1H G;  5CJ4 A;  4WVZ A;  1GD2 E;  2O0Q A;  4ZNC A;  3HUS B;  1SQX K;  1NH4 A;  1S9K E;  1PL5 A;  1IC2 A;  3H25 A;  1GU4 A;  1DEB A;  4D6T E;  1EDJ A;  4NPE A;  1QVG O;  1HTL C;  1RF0 C;  3A3Y B;  4KJM A;  4L76 A;  2FYU G;  3AED C;  4Z1M H;  3M91 A;  2K9J A;  1SFC C;  3P8C D;  4TLF A;  2NPS C;  2Z5I A;  1WRG A;  2ZVO B;  4PD4 H;  1T3U A;  2H89 C;  4PV1 C;  3CC7 P;  1VQM P;  2JP3 A;  2ZT9 D;  3V6I A;  1KQS O;  3L72 G;  3BCC J;  4LC1 A;  2IFN A;  2Y0D A;  1SQV D;  1KQL A;  2ZXE B;  3CX5 I;  4JPZ B;  4AYC A;  1P84 H;  3CCR P;  3D6Y A;  2JKV A;  3LIE A;  4EIJ A;  3WU2 H;  1NTZ D;  3KPE A;  2FXP A;  4K35 A;  2IBZ I;  1EZV I;  1M7L A;  2C0W A;  2FKW B;  1T8Z A;  2AUA A;  3VMA A;  3G71 P;  3W67 A;  1FZE A;  2POH A;  3AEA C;  3BCC E;  4U7J A;  1NTM D;  2XV5 A;  1IZN B;  1BE3 D;  1NU1 D;  1NTZ K;  3GG2 A;  4I2L C;  1OWA A;  5E79 H;  2WT7 A;  2JQN A;  4C46 A;  1RF1 C;  3IFM A;  2Q3I A;  3UIA A;  1SQV K;  2RMZ A;  2IX7 C;  2QM8 A;  4Y99 B;  2PGD A;  3H1H E;  1FZA A;  2E76 D;  2YNY A;  2OQQ A;  1OFC X;  3FWL A;  2WSC J;  3MUD C;  1NAF A;  3L74 G;  1FDI A;  2XU6 A;  3WUV A;  1K8A Q;  1FZF A;  3H1I G;  1N73 A;  4PJ0 E;  1L0L E;  1BGY D;  3VTP C;  1Y9B A;  1SQP E;  4H13 C;  4JQ0 D;  1KYO E;  3T97 B;  1IFM A;  1LTS C;  2FYZ A;  3V5B A;  3AE8 C;  1VF5 B;  1PP9 G;  1MKM A;  1SQQ D;  2KSE A;  1J1D B;  4PJ0 H;  2HYN A;  2RN0 A;  2QEX P;  5DJT B;  4D6T G;  3CCJ P;  1AVY A;  1JNM A;  2C0X A;  1JY2 O;  3L72 J;  3CCE P;  3Q3D A;  1H8A A;  4LGD E;  3SFE C;  5AVV B;  1NTZ J;  1J1E B;  2RKL A;  3H1K D;  1IK7 A;  1OXZ A;  1SFC D;  1CZQ A;  1M1J C;  2E5Y A;  2LR2 A;  3CXH H;  1TU3 F;  3M9H A;  5AW2 B;  2B87 A;  3KZI E;  1QL2 A;  5BU8 B;  3L72 E;  1FOS F;  1CI6 B;  1XTC C;  2SPZ A;  3M0D A;  4RO0 A;  4ASV A;  4DJG A;  1LP1 B;  1YI2 P;  1VQ6 P;  1JM0 A;  1D7M A;  4GDO A;  1KIL A;  1MFT A;  3RL0 B;  3RK3 D;  4H44 C;  3RL0 D;  2HFE D;  3TGU G;  3VMZ A;  3HRN A;  1Q7Y Q;  1NTM J;  1SQQ J;  2D2C C;  3V4W A;  3M06 A;  2H8P D;  4YPC A;  2AXC A;  2G8Y A;  1LT9 C;  1AA0 A;  3G3Z A;  3CLQ A;  1LWU C;  3P7K A;  3H6P A;  3HE4 B;  5AVX B;  3RK2 B;  2IYP A;  3AE1 C;  1BGY J;  1VQ7 P;  1AQ5 A;  5CCH C;  1VF5 C;  2HG5 D;  5TIS H;  4OGQ D;  1BSH A;  1N73 C;  2KNC B;  4H13 B;  3H1J E;  3H1L E;  2KUB A;  2W8Z A;  3MGN A;  2QG4 A;  4PV1 B;  3G4S P;  2R32 A;  2N1T C;  3P8M C;  4UB6 E;  3GHG B;  1URQ B;  3VYI A;  2O01 N;  1KMI Z;  2WSS H;  1YJW P;  3RGU A;  3L71 D;  1RF1 A;  3VMX A;  3JCU E;  3BAS A;  1L4A D;  5AVZ B;  2QE7 H;  1L4A A;  3MZW B;  3U59 A;  1S3J A;  2ZXX A;  1L4A B;  5CMZ A;  2W90 A;  2IPP A;  3WMM 0;  4DOJ A;  4HJG H;  2N9B A;  1DEE G;  2M3E A;  1NTK K;  2YO2 A;  4XA4 A;  1RF1 B;  1KYO D;  2KZJ A;  3L73 G;  3TK1 A;  1PP9 E;  1AV1 A;  4C7N B;  1OX3 A;  1JO5 A;  3F89 A;  1GK4 A;  2HOD A;  2WSF H;  1ZRT E;  2A06 E;  3EWK A;  4IOI H;  1Q90 D;  2R5B A;  4R4M A;  1ZOY C;  2Q3E A;  1VQO P;  2PP6 A;  1SQV J;  2H7H A;  1MUU A;  2L91 A;  1RE3 C;  1S5L X;  2J58 A;  3HE4 A;  1N8R Q;  1L0N D;  1OW8 A;  1VQP P;  1M56 D;  2OYH A;  2FYN B;  5CCG A;  3TGU E;  1OVR A;  4RKU J;  1YIJ P;  3CPW O;  4U3F G;  1GW4 A;  1ZRT D;  1QX8 A;  2A06 D;  2JWA A;  2QJK B;  2Y0E A;  2YKO A;  5BVZ A;  5KKZ B;  5CCH A;  3ITK A;  3V2R A;  5CBN A;  1NJI Q;  2KOG A;  2QJK C;  4M3L A;  4BXL A;  1BDD A;  1SQQ K;  4WY4 B;  1H0T B;  3N7N A;  3L37 A;  1PGO A;  4PD4 E;  1UII A;  5KLV G;  1NTZ E;  2K37 A;  2YKP A;  4I6M C;  4EYY Q;  2B87 B;  4ZKU A;  3VN0 A;  2OAR A;  1VQK P;  2JJL A;  1JY3 O;  2M5A A;  1EQ7 A;  3LW5 H;  1PGJ A;  3Q5P A;  1P84 E;  1T2K D;  3CCM P;  2OGU A;  3CXH D;  4GKG A;  3VMY A;  5KKZ C;  3L4F A;  3TF5 A;  3CCS P;  2JR8 A;  3HD7 C;  3PJS K;  1EZV E;  1G2C B;  1QL1 A;  2FYN C;  3B5N C;  2GM4 A;  3KHU A;  4HYT B;  5CCH D;  1E79 H;  1QVF O;  1KN7 A;  4H0L D;  1LGH B;  1LNQ A;  1ZLL A;  4U3F E;  1PZQ A;  2NRG A;  2E74 D;  3HTK B;  2QA4 P;  1EC5 A;  1NU1 K;  3CWB J;  1HF9 A;  4I7Z C;  3AE6 C;  1NTM K;  4R4L A;  2A06 G;  1OW6 A;  2C9N Y;  4PD4 I;  4WBA A;  1T2K C;  4PV1 D;  2G3A A;  4GT1 A;  5CBO A;  3IN6 A;  2OYH B;  2N1T A;  2O3J A;  2R3C A;  1OVV A;  2ZAE B;  3PHL A;  2WPR A;  4YXD C;  1VQ5 P;  2P10 A;  1KQG B;  2Y9Y A;  1BDC A;  3OAK A;  2C9L Y;  1JCC A;  1L0N E;  2FFD B;  5GTH E;  2GUS A;  2YXR B;  1L4A C;  3EFF K;  1K73 Q;  4WY4 A;  4GOD A;  4NPD A;  5AW4 B;  1H0T A;  3NMD A;  1WT6 A;  1NYH A;  3H1H J;  5KAI H;  2V4H A;  3FXD A;  1HVV A;  3M0A A;  1JTH A;  3GHG C;  5GTH H;  3Q2Y A;  2BAS A;  2KLU A;  3L73 D;  4BRY B;  3L71 E;  2D2C B;  1A02 F;  1GL2 C;  1LTJ C;  1HUC A;  3AE4 C;  3G9R A;  4WB4 A;  4KHX A;  3TSI A;  3ZDM A;  4MN4 C;  4A7P A;  1LTT C;  2WPV B;  1ZR4 A;  4H13 D;  4OWF A;  4W7Y A;  1FU1 A;  1RY3 A;  1SQX D;  3CX5 D;  1VPC A;  2KSJ A;  1NKN A;  3NXS A;  2ZT9 C;  3C1L A;  2E42 A;  3KZI H;  4KT0 J;  1FZC B;  3N4X A;  2I8D A;  2NPS D;  3B8E B;  3JSV C;  2AEM A;  3G6E P;  3OJA B;  4GOF A;  2FBW C;  3BAT A;  2WIT A;  2XNX A;  3H1J D;  2WZ7 A;  3GMA A;  4WY4 D;  1MZ9 A;  2BCC J;  2P58 A;  2Z5H A;  1W2B O;  1K04 A;  2O01 H;  4C7R A;  2JDI H;  4QMA A;  3M9Q A;  2MKV A;  2NPS A;  1KIL D;  3H1I E;  3CME P;  2ZVN B;  2KZI A;  3GHG A;  3L75 D;  1AVO A;  3CCU P;  1PV3 A;  1M1J B;  1KD1 Q;  1HGV A;  2QJP B;  3HE5 A;  2Y9Z A;  1J1E C;  4N3Y B;  3CWB G;  3RBX A;  3AEE C;  1U7M A;  1Q2N A;  1HBW A;  1L0N G;  3MIW A;  2P7J A;  2KK7 A;  1GTW A;  1R5L A;  1J1D C;  3CCL P;  1SFC A;  1URQ D;  3B5N D;  1L0L K;  3KXD A;  3MUD A;  3FXE A;  4N78 D;  2QVA A;  3AE7 C;  3H1J J;  4NPF X;  4OH8 B;  3JCU H;  4CPG A;  2OYI C;  1GW3 A;  1K9M Q;  1IK9 A;  2IZ0 A;  2YMY A;  1S1C X;  1LTA C;  4H44 D;  2E76 C;  3ABV C;  1SQP G;  3WU2 E;  3SSU A;  1JMM A;  3Q5S A;  3VOP A;  1NOH A;  1HWT C;  1LP1 A;  1KZU B;  4HH2 A;  2WSE J;  3HD7 B;  4IL6 E;  4TT3 H;  1CI6 A;  1SQQ E;  1Q86 Q;  1PPJ E;  1YQ3 C;  4N6J A;  1S5L E;  3HD7 A;  2FYU K;  3CI9 A;  2FXO A;  1GL2 A;  1LTJ A;  1SQP D;  5CJ0 A;  3USS A;  4DZO A;  3CCV P;  1OIP A;  4IL6 H;  3E7K A;  1VQL P;  4K3A A;  1HH0 A;  4JYB A;  1GZL A;  1BCC J;  2A45 H;  3CWB D;  1S5L H;  1X79 B;  3QWO C;  1SQB J;  1K05 A;  3F5H A;  1W2E A;  2WMM A;  4XFJ A;  5AVR B;  4EDF A;  3PP5 A;  1NTM E;  4BWN A;  5KLI B;  3O8Z A;  1PP9 D;  1SFC B;  3TGU J;  1SS1 A;  2W6A A;  4H0L B;  1Z56 A;  3HD7 D;  4I1L A;  5AW5 B;  3A0H E;  2D2C D;  3CD6 P;  1IFD A;  1NTK E;  3L35 A;  3HE5 B;  4ZMD A;  1GU5 A;  2WPS A;  2QRX A;  5APY A;  1YJN P;  3PLN A;  1NTZ G;  5KAF H;  2NPS B;  1LTB C;  1PGP A;  1CSB A;  3I56 P;  2E43 A;  1Y8A A;  3L73 E;  1XTG B;  1ZN5 A;  3AEG C;  3H1J G;  3M0D C;  4UB8 E;  5AVT B;  3SWK A;  1S72 P;  1EDL A;  3V2N A;  2M0B A;  1ZXG A;  1LT9 A;  2WT7 B;  2WVR A;  2Z4E A;  2K88 A;  1VQN P;  1YTZ I;  1SQB K;  3FGA D;  3HUS C;  3U1A A;  1G1I A;  1LJ2 A;  3MD0 A;  1DX7 A;  4OGQ B;  1G1J A;  1FZC A;  1L0N J;  1A02 J;  4PD4 D;  2BCC G;  5AVS B;  3L74 J;  1SQX G;  2O01 J;  2OYI B;  3A5T A;  1T6A A;  1JY2 N;  3L70 E; 
#chains in the Genus database with same CATH homology
 1FC2 C;  4K35 A;  1EC5 A;  2HR3 A;  5EFW B;  5CBO A;  2O0P A;  2M5A B;  1OVV A;  2KIK A;  2ZAE B;  1NVO A;  2JQN A;  1BDC A;  5C39 A;  5K5G B;  1H0T A;  4GOD A;  4NPD A;  4HKZ H;  3FXD A;  2JWD A;  1JMB A;  3ZDM A;  4MN4 C;  5DJT B;  3PH0 A;  2I8D A;  1Y47 A;  2RKL A;  1U7J A;  2LR2 A;  4GOF A;  2KI7 B;  2B87 A;  5DJU B;  2P58 A;  2SPZ A;  4ASV A;  1LP1 B;  1JM0 A;  1MFT A;  2KZI A;  1LT1 A;  1U7M A;  4WWI A;  1Q2N A;  4HB1 A;  2UWJ E;  3S1K A;  1EDK A;  4JBZ A;  3FXE A;  1OVU A;  2QVA A;  2KUB A;  4NPF X;  4CPG A;  2R44 A;  2Q1K A;  2B89 A;  2B88 A;  1LP1 A;  3RGU A;  3MZW B;  1S3J A;  1EDI A;  4HJG H;  1DEE G;  2HW2 A;  2KZJ A;  4K3A A;  2K3R A;  1X0T A;  3QWO C;  4ASW A;  2WMM A;  4IOI H;  2LXB A;  2OTK E;  1SS1 A;  1OVR A;  2LXC B;  4ZMD A;  2O0Q A;  2QRX A;  4ZNC A;  5CBN A;  4BXL A;  1BDD A;  1H0T B;  3MHV A;  1EDJ A;  4NPE A;  1EDL A;  4EYY Q;  2B87 B;  1ZXG A;  2M0B A;  2KS1 B;  4KJM A;  2M5A A;  1WFX A;  1ZW0 A;  4GOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...