The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
147
|
structure length |
147
|
Chain Sequence |
TANVVVSNPRPIFTESRSFKAVANGKIYIGQIDTDPVNPANQIPVYIENEDGSHVQITQPLIINAAGKIVYNGQLVKIVTVQGHSMAIYDANGSQVDYIANVLKWDPDQYSIEADKKFKQIEDKIEEILSKIYHIENEIARIKKLIG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Bacteriophage P22 Tailspike: Structure of the Complete Protein and Function of the Interdomain Linker
pubmed doi rcsb |
molecule tags |
Viral protein
|
source organism |
Enterobacteria phage p22
|
molecule keywords |
BIFUNCTIONAL TAIL PROTEIN, PIIGCN4
|
total genus |
35
|
structure length |
147
|
sequence length |
147
|
ec nomenclature | |
pdb deposition date | 2008-02-05 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Tailspike Protein; Chain | Phage P22 tailspike-like, N-terminal domain |
#chains in the Genus database with same CATH superfamily 2XC1 A; 1LKT A; 2VNL A; 2VKY B; #chains in the Genus database with same CATH topology 2XC1 A; 1LKT A; 2VNL A; 2VKY B; #chains in the Genus database with same CATH homology 2XC1 A; 1LKT A; 2VNL A; 2VKY B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...