The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
92
|
sequence length |
258
|
structure length |
258
|
Chain Sequence |
NIPGAILHSLAELQDGLNAMIDPSWRAVRSLDNWALAITMESTELLDSYPWKWWKNLNATPDLANVRIELVDIFHFSLSGAMQMRSTPDDEIPAASLKPLKEVMTTFLPAKECTSDPYGFVFFPLTDTQNAIASFRNIIQLANAYRFDVIIECIIYAAEDLGFNLVAYYIAKHTLNCIRQLSGYKDGSYVKVNNGVEDNSLLHNCIKDVSLDEVLDADKYVQAWNSIMANVYEAFQIKESDRKDAERWFALAKENRLA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Crystal Structure of the Leishmania Major Deoxyuridine Triphosphate Nucleotidohydrolase in Complex with Nucleotide Analogues, Dump, and Deoxyuridine.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Leishmania major
|
| molecule keywords |
DUTPASE
|
| total genus |
92
|
| structure length |
258
|
| sequence length |
258
|
| ec nomenclature |
ec
3.6.1.23: dUTP diphosphatase. |
| pdb deposition date | 2006-03-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08761 | dUTPase_2 | dUTPase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | all-alpha NTP pyrophosphatase | Type II deoxyuridine triphosphatase | ||
| Mainly Alpha | Up-down Bundle | all-alpha NTP pyrophosphatases | Type II deoxyuridine triphosphatase |
#chains in the Genus database with same CATH superfamily 1OGK A; 2YAZ A; 2YB0 A; 2CJE A; 4DK2 A; 2YAY A; 1OGL A; #chains in the Genus database with same CATH topology 1OGK A; 2YAZ A; 2YB0 A; 2CJE A; 4DK2 A; 2YAY A; 1OGL A; #chains in the Genus database with same CATH homology 1OGK A; 2YAZ A; 2YB0 A; 1W2Y A; 4DK4 A; 2CJE A; 4DKB A; 2CIC A; 4DK2 A; 4DL8 A; 2YAY A; 1OGL A; 4DLC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
