The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
195
|
structure length |
195
|
Chain Sequence |
AVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the uncharacterized human protein C8orf32 with bound peptide.
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Homo sapiens
|
molecule keywords |
Uncharacterized protein C8orf32
|
total genus |
51
|
structure length |
195
|
sequence length |
195
|
ec nomenclature |
ec
3.5.1.122: Protein N-terminal glutamine amidohydrolase. |
pdb deposition date | 2008-02-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF09764 | Nt_Gln_amidase | N-terminal glutamine amidase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | C8orf32 fold | Protein N-terminal glutamine amidohydrolase, alpha beta roll |
#chains in the Genus database with same CATH superfamily 4W79 A; 3C9Q A; #chains in the Genus database with same CATH topology 2KSV A; 4W79 A; 2F4M A; 3KD4 A; 2F4O A; 3A55 A; 3C9Q A; 4U65 E; 3ESW A; 4FGP A; 3ISR A; 4FGQ A; 4FGO A; 2ZK9 X; 3A56 A; 3A54 A; #chains in the Genus database with same CATH homology 4W79 A; 3C9Q A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...