3ESWA

Complex of yeast pngase with glcnac2-iac.
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
333
structure length
332
Chain Sequence
SSGLVPRGSHMNNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
publication title Structural and mutational studies on the importance of oligosaccharide binding for the activity of yeast PNGase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 111
structure length 332
sequence length 333
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3eswA02
3.10.620.30 Alpha Beta Roll C8orf32 fold C8orf32 fold 3eswA01
1TWHI 3PO3S 2NVXI 1TWAI 3U50C 4QTTA 1Y1WI 1I3QI 3H3VJ 2JA5I 1ZB9A 2F4MA 4MH4A 1YUAA 3S2DI 3EERA 4A3DI 2K5RA 2NVTI 3HOZI 4NBFA 3H0GI 3GTMS 3FKII 3GTGI 4XX2A 3VB9A 2R93I 3A55A 5IP9I 4A3MI 1R9TI 2KSVA 3LUSA 4A3FI 2JA7I 3HOYI 3S17I 4A3BI 4BY7I 2YU9I 1ZB8A 1LQLA 5CM2M 3S1QI 2E2HI 2DE7A 5IP7I 2E2JI 1X3WA 2RBLA 3GTKI 3S16I 2PK7A 3ESWA 2E2II 2B63I 1RO4A 3GCFA 5C44I 3S14I 3S15I 4U65E 1TWFI 4Y52I 3GTOI 4NBEA 1VLAA 3VMGA 2J6AA 3PO2I 1I50I 4NBGA 5C3EI 3PO3I 3GTPI 3GTJI 3S1RI 1K83I 4QTUA 3Q87A 4A3CI 2JS4A 2R7ZI 4A3LI 3S1MI 3GKQA 2R92I 1USPB 4A93I 4A3KI 1NUIA 3RZOI 4Y7NI 1Y1VI 3HOWI 2F4OA 4BXXI 4A3II 4A3JI 4NOZA 2ZK9X 1QYPA 2DE5A 3S2HI 4NBDA 1SFOI 3VMHA 2BJOA 4A3EI 1I6HI 1TFIA 2JA6I 4NBAA 3RZDI 3D6WA 3HOVI 4FGPA 3HOUI 3A54A 4BY1I 3GTQI 4BBSI 2AKLA 3GTLI 1RLYA 4NBHA 2VUMI 3I4NI 2P3YA 4FGQA 1DL6A 1USPA 3HOXI 2KPIA 2NVYI 3VMIA 4BBRI 3S1NI 2JA8I 5C4JI 1PFTA 5C4XI 3I07A 3K7AI 1X3ZA 4NBCA 4X6AI 1TWCI 1Y1VS 4NBBA 3GTMI 1TWGI 2NVQI 3KD4A 1N2FA 4NB8A 2HF1A 3ISRA 3CQZI 1WW9A 2DE6A 4A3GI 4FGOA 2JNYA 3A56A 3I4MI 5FLMI 2JR6A 3M3YI 1L1OC 4NB9A 3M4OI 1ML8A 1WCMI
chains in the Genus database with same CATH superfamily
3PO3S 1M1K1 2M48A 2V8IA 2O4HA 2VPZA 4NH1C 3D2LA 2F4MA 3F3PC 4MH4A 3S2DI 2JIRA 3GTMS 3NFZA 5IP9I 4E31A 3NH5A 4A3MI 1R9TI 3LUSA 1NJI2 2JA7I 3I561 2YU9I 1WZNA 5CM2M 4E33A 5A2Qf 2PK7A 1RO4A 3GCFA 2QEXZ 3S15I 4Y52I 4DGLA 3MZKB 1KQSZ 2J6AA 1VQ51 3MZLB 2OTL1 3GTPI 3J80f 4E2ZA 2VPWA 2LEXA 4A3CI 1NJI1 1YJNZ 3S1MI 3GKQA 4E2XA 3CCV1 4A93I 1NUIA 2LIYA 1S72Z 3RZOI 1Y1VI 2F4OA 5T6BA 1Q7Y2 4BXXI 4A3JI 4NOZA 1RQFA 3S2HI 2DE5A 4MONA 3VMHA 5D1PA 4A3EI 1I6HI 1N8R1 3HKZA 2G2KA 4NBAA 2OZKA 3A54A 3GTQI 3NH4A 4AYBA 1VQL1 1RLYA 3I4NI 2JIMA 3CCR1 1VQ71 3HOXI 1FDIA 3G711 3S1NI 1PFTA 5C4XI 3I56Z 1KD11 3K7AI 4NBCA 2QA4Z 3CQZI 1Q811 1K732 2JR6A 3CCE1 1VQ5Z 3M3YI 2OTLZ 1Z03A 1RNIA 3CMA1 2NVXI 3CCVZ 1TWAI 2QR1B 4MRIA 5D1OB 2QLVB 3H3VJ 2JA5I 1ZB9A 2PM9A 3CCLZ 1VQ91 2Q51A 3CC71 3EERA 2K5RA 1M901 2NVTI 2ZAEB 4RVDA 4NBFA 5IT9b 2RIQA 1Q822 3CD61 2JUBA 3GTGI 4XX2A 3TE5B 1VQLZ 3CXCZ 3S17I 4A3BI 3G4S1 3CCRZ 1VQ7Z 1VQPZ 2E2HI 1X3WA 1YJW1 3G71Z 3J81f 4U65E 5C44I 2OOXB 2I3CA 1VLAA 4NBEA 2IV2X 3CME1 1I50I 1QVFY 4NBGA 3PO3I 1K83I 2NAPA 3Q87A 2EGTA 2R7ZI 4A3LI 2R92I 1USPB 3NH8A 1QVGZ 3CCEZ 4A3KI 3CCM1 2P28A 4E32A 4MD7A 4RVFA 3CMAZ 1YHQZ 3FQQA 1YIJ1 2ZK9X 2JIPA 3CCJZ 2BJOA 2GTIA 3NDIA 2Y0SA 1VQ9Z 1Q862 3CC7Z 1VQKZ 4MXUA 2VUMI 1YJ91 4FGQA 2R6MA 1SIWA 3JAMb 2V45A 2KPIA 1K9M2 1JJ2Y 4TNUA 2JA8I 2RHBA 3G6E1 3I07A 3OW2Y 4X6AI 3G4SZ 2RT9A 2OTJ1 1Y1VS 1TWGI 2NVQI 4NB8A 2Q4ZA 2QRCB 2JNYA 2QREB 1K8A2 2KI7B 1L1OC 1AA6A 1FDOA 2YADA 5FLXf 1Q7Y1 1YIT1 1VQ81 3U50C 2WB1A 2AYDA 3CCS1 1RO0A 1Y1WI 1I3QI 3CCMZ 2W04A 3CPWZ 1YIJZ 2IZ4A 3J81b 1YUAA 4A3DI 3HOZI 1S7MA 2HU9A 1RO2A 3A55A 1X0TA 1YI21 2VPXA 3QWUA 4NFRA 1KQSY 2LFUA 1VQ61 1VQN1 3HOYI 1ZB8A 1QVFZ 2DE7A 5IP7I 2RBLA 2VPYA 5A2Qb 3ESWA 2E2II 2B63I 3S14I 3CC41 4RV9A 3GTOI 1WIIA 1VQM1 2OTJZ 1K731 4E2YA 2H85A 4HH4A 1KC82 3GTJI 4QTUA 3J80b 4E2WA 2V3VA 4RS4A 1VQO1 1KRLA 4Y7NI 2W03A 3T4NB 1NP6A 3TDHB 1P9NA 1M1K2 1YITZ 3CCSZ 1SFOI 1Q16A 2O53A 2V8JA 2JA6I 1WJ2A 3D6WA 3KIHA 1Q821 4FGPA 3HOUI 4BBSI 3GTLI 3C9QA 1Z02A 2JIQA 3CCU1 2JMOA 2P3YA 2VUGA 4MD8A 1QXFA 2GU2A 1USPA 3IF8A 2GTHA 4RVHA 5FLXb 2NVYI 1YI2Z 1VQ6Z 4HGZA 4BBRI 2QKDA 1VQNZ 3CCQ1 1X3ZA 1W2BY 4NBBA 3GTMI 2VF1A 3D9XA 3KD4A 1N2FA 3KIFA 4S1TA 4HGYA 2HF1A 3NDJA 3ISRA 2DE6A 3FQMA 4FGOA 3CC4Z 3I4MI 1VQMZ 3F3FC 3M4OI 1Y8CA 1TWHI 3CD6Z 3BG1B 3P5JB 1VQOZ 4QTTA 2QA41 3BG0B 2M6NA 3CXCY 3I551 4E30A 2V8KA 1Q861 3IFUA 5IT9f 4MD9A 1N8R2 1YJWZ 2K3RA 2JIOA 3H0GI 2QRDB 3CC21 3FKII 3CMEZ 3VB9A 3MONA 2R93I 2KSVA 1QF8A 4A3FI 1K9M1 3CCUZ 4BY7I 3CCL1 1LQLA 3S1QI 3J7A4 4W79A 1QVGY 2E2JI 1KD12 3GTKI 3S16I 3VTNA 3CCQZ 1TWFI 1K8A1 3VMGA 3PO2I 1Q812 5C3EI 1VQ41 1ZH1A 1YUKA 3S1RI 2OOYB 3EEDA 2JS4A 4DK1A 1VQP1 2PMZA 3HOWI 3IX0A 1YJ9Z 4A3II 2RPRA 5D1OA 2E7ZA 1QYPA 4NBDA 2E9HA 1JWHC 3G6EZ 1TFIA 3I55Z 3RZDI 3HOVI 3IR7A 1M902 4BY1I 2WAQA 2AKLA 2IZ3A 5AN9F 3JAMf 4NBHA 4EWCA 1Z01A 3CC2Z 1W2BZ 1YHQ1 1DL6A 3VMIA 3CCJ1 5T64A 5C4JI 5LL6f 2QEX1 4RVGA 1VQ8Z 1TWCI 1VQK1 5T67A 1WW9A 4A3GI 1KC81 1YJN1 4DQYB 4CL1A 3A56A 5FLMI 1JJ2Z 3CPWY 1S721 4NB9A 1VQ4Z 1ML8A 3OW2Z 1WCMI
chains in the Genus database with same CATH topology
3PO3S 1M1K1 2M48A 2V8IA 2O4HA 4NH1C 2F4MA 3F3PC 4MH4A 3S2DI 3GTMS 3NFZA 5IP9I 4E31A 3NH5A 4A3MI 1R9TI 3LUSA 1NJI2 2JA7I 3I561 2YU9I 5CM2M 4E33A 5A2Qf 2PK7A 1RO4A 3GCFA 2QEXZ 3S15I 4Y52I 4DGLA 3MZKB 1KQSZ 2J6AA 1VQ51 3MZLB 2OTL1 3GTPI 3J80f 4E2ZA 4A3CI 1NJI1 1YJNZ 3S1MI 3GKQA 4E2XA 3CCV1 4A93I 1NUIA 2LIYA 1S72Z 3RZOI 1Y1VI 2F4OA 5T6BA 1Q7Y2 4BXXI 4A3JI 4NOZA 1RQFA 3S2HI 2DE5A 4MONA 3VMHA 5D1PA 4A3EI 1I6HI 1N8R1 3HKZA 2G2KA 4NBAA 2OZKA 3A54A 3GTQI 3NH4A 4AYBA 1VQL1 1RLYA 3I4NI 3CCR1 1VQ71 3HOXI 3G711 3S1NI 1PFTA 5C4XI 3I56Z 1KD11 3K7AI 4NBCA 2QA4Z 3CQZI 1Q811 1K732 2JR6A 3CCE1 1VQ5Z 3M3YI 2OTLZ 1Z03A 1RNIA 3CMA1 2NVXI 3CCVZ 1TWAI 2QR1B 4MRIA 5D1OB 2QLVB 3H3VJ 2JA5I 1ZB9A 2PM9A 3CCLZ 1VQ91 2Q51A 3CC71 3EERA 2K5RA 1M901 2NVTI 2ZAEB 4RVDA 4NBFA 5IT9b 2RIQA 1Q822 3CD61 2JUBA 3GTGI 4XX2A 3TE5B 1VQLZ 3CXCZ 3S17I 4A3BI 3G4S1 3CCRZ 1VQ7Z 1VQPZ 2E2HI 1X3WA 1YJW1 3G71Z 3J81f 4U65E 5C44I 2OOXB 2I3CA 1VLAA 4NBEA 3CME1 1I50I 1QVFY 4NBGA 3PO3I 1K83I 3Q87A 2EGTA 2R7ZI 4A3LI 2R92I 1USPB 3NH8A 1QVGZ 3CCEZ 4A3KI 3CCM1 2P28A 4E32A 4MD7A 4RVFA 3CMAZ 1YHQZ 3FQQA 1YIJ1 2ZK9X 3CCJZ 2BJOA 2GTIA 3NDIA 2Y0SA 1VQ9Z 1Q862 3CC7Z 1VQKZ 4MXUA 2VUMI 1YJ91 4FGQA 2R6MA 3JAMb 2KPIA 1K9M2 1JJ2Y 4TNUA 2JA8I 2RHBA 3G6E1 3I07A 3OW2Y 4X6AI 3G4SZ 2RT9A 2OTJ1 1Y1VS 1TWGI 2NVQI 4NB8A 2Q4ZA 2QRCB 2JNYA 2QREB 1K8A2 2KI7B 1L1OC 2YADA 5FLXf 1Q7Y1 1YIT1 1VQ81 3U50C 2WB1A 3CCS1 1RO0A 1Y1WI 1I3QI 3CCMZ 2W04A 3CPWZ 1YIJZ 2IZ4A 3J81b 1YUAA 4A3DI 3HOZI 1S7MA 2HU9A 1RO2A 3A55A 1X0TA 1YI21 3QWUA 4NFRA 1KQSY 2LFUA 1VQ61 1VQN1 3HOYI 1ZB8A 1QVFZ 2DE7A 5IP7I 2RBLA 5A2Qb 3ESWA 2E2II 2B63I 3S14I 3CC41 4RV9A 3GTOI 1WIIA 1VQM1 2OTJZ 1K731 4E2YA 2H85A 4HH4A 1KC82 3GTJI 4QTUA 3J80b 4E2WA 4RS4A 1VQO1 1KRLA 4Y7NI 2W03A 3T4NB 1NP6A 3TDHB 1P9NA 1M1K2 1YITZ 3CCSZ 1SFOI 2O53A 2V8JA 2JA6I 3D6WA 3KIHA 1Q821 4FGPA 3HOUI 4BBSI 3GTLI 1Z02A 3CCU1 2JMOA 2P3YA 2VUGA 4MD8A 2GU2A 1USPA 3IF8A 2GTHA 4RVHA 5FLXb 2NVYI 1YI2Z 1VQ6Z 4HGZA 4BBRI 2QKDA 1VQNZ 3CCQ1 1X3ZA 1W2BY 4NBBA 3GTMI 2VF1A 3D9XA 3KD4A 1N2FA 3KIFA 4S1TA 4HGYA 2HF1A 3NDJA 3ISRA 2DE6A 3FQMA 4FGOA 3CC4Z 3I4MI 1VQMZ 3F3FC 3M4OI 1TWHI 3CD6Z 3BG1B 3P5JB 1VQOZ 4QTTA 2QA41 3BG0B 2M6NA 3CXCY 3I551 4E30A 2V8KA 1Q861 3IFUA 5IT9f 4MD9A 1N8R2 1YJWZ 2K3RA 3H0GI 2QRDB 3CC21 3FKII 3CMEZ 3VB9A 3MONA 2R93I 2KSVA 1QF8A 4A3FI 1K9M1 3CCUZ 4BY7I 3CCL1 1LQLA 3S1QI 3J7A4 1QVGY 2E2JI 1KD12 3GTKI 3S16I 3VTNA 3CCQZ 1TWFI 1K8A1 3VMGA 3PO2I 1Q812 5C3EI 1VQ41 1ZH1A 1YUKA 3S1RI 2OOYB 3EEDA 2JS4A 4DK1A 1VQP1 2PMZA 3HOWI 3IX0A 1YJ9Z 4A3II 2RPRA 5D1OA 1QYPA 4NBDA 2E9HA 1JWHC 3G6EZ 1TFIA 3I55Z 3RZDI 3HOVI 1M902 4BY1I 2WAQA 2AKLA 2IZ3A 5AN9F 3JAMf 4NBHA 4EWCA 1Z01A 3CC2Z 1W2BZ 1YHQ1 1DL6A 3VMIA 3CCJ1 5T64A 5C4JI 5LL6f 2QEX1 4RVGA 1VQ8Z 1TWCI 1VQK1 5T67A 1WW9A 4A3GI 1KC81 1YJN1 4DQYB 4CL1A 3A56A 5FLMI 1JJ2Z 3CPWY 1S721 4NB9A 1VQ4Z 1ML8A 3OW2Z 1WCMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH I;  3PO3 S;  2NVX I;  1TWA I;  3U50 C;  4QTT A;  1Y1W I;  1I3Q I;  3H3V J;  2JA5 I;  1ZB9 A;  2F4M A;  4MH4 A;  1YUA A;  3S2D I;  3EER A;  4A3D I;  2K5R A;  2NVT I;  3HOZ I;  4NBF A;  3H0G I;  3GTM S;  3FKI I;  3GTG I;  4XX2 A;  3VB9 A;  2R93 I;  3A55 A;  5IP9 I;  4A3M I;  1R9T I;  2KSV A;  3LUS A;  4A3F I;  2JA7 I;  3HOY I;  3S17 I;  4A3B I;  4BY7 I;  2YU9 I;  1ZB8 A;  1LQL A;  5CM2 M;  3S1Q I;  2E2H I;  2DE7 A;  5IP7 I;  2E2J I;  1X3W A;  2RBL A;  3GTK I;  3S16 I;  2PK7 A;  3ESW A;  2E2I I;  2B63 I;  1RO4 A;  3GCF A;  5C44 I;  3S14 I;  3S15 I;  4U65 E;  1TWF I;  4Y52 I;  3GTO I;  4NBE A;  1VLA A;  3VMG A;  2J6A A;  3PO2 I;  1I50 I;  4NBG A;  5C3E I;  3PO3 I;  3GTP I;  3GTJ I;  3S1R I;  1K83 I;  4QTU A;  3Q87 A;  4A3C I;  2JS4 A;  2R7Z I;  4A3L I;  3S1M I;  3GKQ A;  2R92 I;  1USP B;  4A93 I;  4A3K I;  1NUI A;  3RZO I;  4Y7N I;  1Y1V I;  3HOW I;  2F4O A;  4BXX I;  4A3I I;  4A3J I;  4NOZ A;  2ZK9 X;  1QYP A;  2DE5 A;  3S2H I;  4NBD A;  1SFO I;  3VMH A;  2BJO A;  4A3E I;  1I6H I;  1TFI A;  2JA6 I;  4NBA A;  3RZD I;  3D6W A;  3HOV I;  4FGP A;  3HOU I;  3A54 A;  4BY1 I;  3GTQ I;  4BBS I;  2AKL A;  3GTL I;  1RLY A;  4NBH A;  2VUM I;  3I4N I;  2P3Y A;  4FGQ A;  1DL6 A;  1USP A;  3HOX I;  2KPI A;  2NVY I;  3VMI A;  4BBR I;  3S1N I;  2JA8 I;  5C4J I;  1PFT A;  5C4X I;  3I07 A;  3K7A I;  1X3Z A;  4NBC A;  4X6A I;  1TWC I;  1Y1V S;  4NBB A;  3GTM I;  1TWG I;  2NVQ I;  3KD4 A;  1N2F A;  4NB8 A;  2HF1 A;  3ISR A;  3CQZ I;  1WW9 A;  2DE6 A;  4A3G I;  4FGO A;  2JNY A;  3A56 A;  3I4M I;  5FLM I;  2JR6 A;  3M3Y I;  1L1O C;  4NB9 A;  3M4O I;  1ML8 A;  1WCM I; 
#chains in the Genus database with same CATH topology
 3PO3 S;  1M1K 1;  2M48 A;  2V8I A;  2O4H A;  2VPZ A;  4NH1 C;  3D2L A;  2F4M A;  3F3P C;  4MH4 A;  3S2D I;  2JIR A;  3GTM S;  3NFZ A;  5IP9 I;  4E31 A;  3NH5 A;  4A3M I;  1R9T I;  3LUS A;  1NJI 2;  2JA7 I;  3I56 1;  2YU9 I;  1WZN A;  5CM2 M;  4E33 A;  5A2Q f;  2PK7 A;  1RO4 A;  3GCF A;  2QEX Z;  3S15 I;  4Y52 I;  4DGL A;  3MZK B;  1KQS Z;  2J6A A;  1VQ5 1;  3MZL B;  2OTL 1;  3GTP I;  3J80 f;  4E2Z A;  2VPW A;  2LEX A;  4A3C I;  1NJI 1;  1YJN Z;  3S1M I;  3GKQ A;  4E2X A;  3CCV 1;  4A93 I;  1NUI A;  2LIY A;  1S72 Z;  3RZO I;  1Y1V I;  2F4O A;  5T6B A;  1Q7Y 2;  4BXX I;  4A3J I;  4NOZ A;  1RQF A;  3S2H I;  2DE5 A;  4MON A;  3VMH A;  5D1P A;  4A3E I;  1I6H I;  1N8R 1;  3HKZ A;  2G2K A;  4NBA A;  2OZK A;  3A54 A;  3GTQ I;  3NH4 A;  4AYB A;  1VQL 1;  1RLY A;  3I4N I;  2JIM A;  3CCR 1;  1VQ7 1;  3HOX I;  1FDI A;  3G71 1;  3S1N I;  1PFT A;  5C4X I;  3I56 Z;  1KD1 1;  3K7A I;  4NBC A;  2QA4 Z;  3CQZ I;  1Q81 1;  1K73 2;  2JR6 A;  3CCE 1;  1VQ5 Z;  3M3Y I;  2OTL Z;  1Z03 A;  1RNI A;  3CMA 1;  2NVX I;  3CCV Z;  1TWA I;  2QR1 B;  4MRI A;  5D1O B;  2QLV B;  3H3V J;  2JA5 I;  1ZB9 A;  2PM9 A;  3CCL Z;  1VQ9 1;  2Q51 A;  3CC7 1;  3EER A;  2K5R A;  1M90 1;  2NVT I;  2ZAE B;  4RVD A;  4NBF A;  5IT9 b;  2RIQ A;  1Q82 2;  3CD6 1;  2JUB A;  3GTG I;  4XX2 A;  3TE5 B;  1VQL Z;  3CXC Z;  3S17 I;  4A3B I;  3G4S 1;  3CCR Z;  1VQ7 Z;  1VQP Z;  2E2H I;  1X3W A;  1YJW 1;  3G71 Z;  3J81 f;  4U65 E;  5C44 I;  2OOX B;  2I3C A;  1VLA A;  4NBE A;  2IV2 X;  3CME 1;  1I50 I;  1QVF Y;  4NBG A;  3PO3 I;  1K83 I;  2NAP A;  3Q87 A;  2EGT A;  2R7Z I;  4A3L I;  2R92 I;  1USP B;  3NH8 A;  1QVG Z;  3CCE Z;  4A3K I;  3CCM 1;  2P28 A;  4E32 A;  4MD7 A;  4RVF A;  3CMA Z;  1YHQ Z;  3FQQ A;  1YIJ 1;  2ZK9 X;  2JIP A;  3CCJ Z;  2BJO A;  2GTI A;  3NDI A;  2Y0S A;  1VQ9 Z;  1Q86 2;  3CC7 Z;  1VQK Z;  4MXU A;  2VUM I;  1YJ9 1;  4FGQ A;  2R6M A;  1SIW A;  3JAM b;  2V45 A;  2KPI A;  1K9M 2;  1JJ2 Y;  4TNU A;  2JA8 I;  2RHB A;  3G6E 1;  3I07 A;  3OW2 Y;  4X6A I;  3G4S Z;  2RT9 A;  2OTJ 1;  1Y1V S;  1TWG I;  2NVQ I;  4NB8 A;  2Q4Z A;  2QRC B;  2JNY A;  2QRE B;  1K8A 2;  2KI7 B;  1L1O C;  1AA6 A;  1FDO A;  2YAD A;  5FLX f;  1Q7Y 1;  1YIT 1;  1VQ8 1;  3U50 C;  2WB1 A;  2AYD A;  3CCS 1;  1RO0 A;  1Y1W I;  1I3Q I;  3CCM Z;  2W04 A;  3CPW Z;  1YIJ Z;  2IZ4 A;  3J81 b;  1YUA A;  4A3D I;  3HOZ I;  1S7M A;  2HU9 A;  1RO2 A;  3A55 A;  1X0T A;  1YI2 1;  2VPX A;  3QWU A;  4NFR A;  1KQS Y;  2LFU A;  1VQ6 1;  1VQN 1;  3HOY I;  1ZB8 A;  1QVF Z;  2DE7 A;  5IP7 I;  2RBL A;  2VPY A;  5A2Q b;  3ESW A;  2E2I I;  2B63 I;  3S14 I;  3CC4 1;  4RV9 A;  3GTO I;  1WII A;  1VQM 1;  2OTJ Z;  1K73 1;  4E2Y A;  2H85 A;  4HH4 A;  1KC8 2;  3GTJ I;  4QTU A;  3J80 b;  4E2W A;  2V3V A;  4RS4 A;  1VQO 1;  1KRL A;  4Y7N I;  2W03 A;  3T4N B;  1NP6 A;  3TDH B;  1P9N A;  1M1K 2;  1YIT Z;  3CCS Z;  1SFO I;  1Q16 A;  2O53 A;  2V8J A;  2JA6 I;  1WJ2 A;  3D6W A;  3KIH A;  1Q82 1;  4FGP A;  3HOU I;  4BBS I;  3GTL I;  3C9Q A;  1Z02 A;  2JIQ A;  3CCU 1;  2JMO A;  2P3Y A;  2VUG A;  4MD8 A;  1QXF A;  2GU2 A;  1USP A;  3IF8 A;  2GTH A;  4RVH A;  5FLX b;  2NVY I;  1YI2 Z;  1VQ6 Z;  4HGZ A;  4BBR I;  2QKD A;  1VQN Z;  3CCQ 1;  1X3Z A;  1W2B Y;  4NBB A;  3GTM I;  2VF1 A;  3D9X A;  3KD4 A;  1N2F A;  3KIF A;  4S1T A;  4HGY A;  2HF1 A;  3NDJ A;  3ISR A;  2DE6 A;  3FQM A;  4FGO A;  3CC4 Z;  3I4M I;  1VQM Z;  3F3F C;  3M4O I;  1Y8C A;  1TWH I;  3CD6 Z;  3BG1 B;  3P5J B;  1VQO Z;  4QTT A;  2QA4 1;  3BG0 B;  2M6N A;  3CXC Y;  3I55 1;  4E30 A;  2V8K A;  1Q86 1;  3IFU A;  5IT9 f;  4MD9 A;  1N8R 2;  1YJW Z;  2K3R A;  2JIO A;  3H0G I;  2QRD B;  3CC2 1;  3FKI I;  3CME Z;  3VB9 A;  3MON A;  2R93 I;  2KSV A;  1QF8 A;  4A3F I;  1K9M 1;  3CCU Z;  4BY7 I;  3CCL 1;  1LQL A;  3S1Q I;  3J7A 4;  4W79 A;  1QVG Y;  2E2J I;  1KD1 2;  3GTK I;  3S16 I;  3VTN A;  3CCQ Z;  1TWF I;  1K8A 1;  3VMG A;  3PO2 I;  1Q81 2;  5C3E I;  1VQ4 1;  1ZH1 A;  1YUK A;  3S1R I;  2OOY B;  3EED A;  2JS4 A;  4DK1 A;  1VQP 1;  2PMZ A;  3HOW I;  3IX0 A;  1YJ9 Z;  4A3I I;  2RPR A;  5D1O A;  2E7Z A;  1QYP A;  4NBD A;  2E9H A;  1JWH C;  3G6E Z;  1TFI A;  3I55 Z;  3RZD I;  3HOV I;  3IR7 A;  1M90 2;  4BY1 I;  2WAQ A;  2AKL A;  2IZ3 A;  5AN9 F;  3JAM f;  4NBH A;  4EWC A;  1Z01 A;  3CC2 Z;  1W2B Z;  1YHQ 1;  1DL6 A;  3VMI A;  3CCJ 1;  5T64 A;  5C4J I;  5LL6 f;  2QEX 1;  4RVG A;  1VQ8 Z;  1TWC I;  1VQK 1;  5T67 A;  1WW9 A;  4A3G I;  1KC8 1;  1YJN 1;  4DQY B;  4CL1 A;  3A56 A;  5FLM I;  1JJ2 Z;  3CPW Y;  1S72 1;  4NB9 A;  1VQ4 Z;  1ML8 A;  3OW2 Z;  1WCM I; 
#chains in the Genus database with same CATH homology
 3PO3 S;  1M1K 1;  2M48 A;  2V8I A;  2O4H A;  4NH1 C;  2F4M A;  3F3P C;  4MH4 A;  3S2D I;  3GTM S;  3NFZ A;  5IP9 I;  4E31 A;  3NH5 A;  4A3M I;  1R9T I;  3LUS A;  1NJI 2;  2JA7 I;  3I56 1;  2YU9 I;  5CM2 M;  4E33 A;  5A2Q f;  2PK7 A;  1RO4 A;  3GCF A;  2QEX Z;  3S15 I;  4Y52 I;  4DGL A;  3MZK B;  1KQS Z;  2J6A A;  1VQ5 1;  3MZL B;  2OTL 1;  3GTP I;  3J80 f;  4E2Z A;  4A3C I;  1NJI 1;  1YJN Z;  3S1M I;  3GKQ A;  4E2X A;  3CCV 1;  4A93 I;  1NUI A;  2LIY A;  1S72 Z;  3RZO I;  1Y1V I;  2F4O A;  5T6B A;  1Q7Y 2;  4BXX I;  4A3J I;  4NOZ A;  1RQF A;  3S2H I;  2DE5 A;  4MON A;  3VMH A;  5D1P A;  4A3E I;  1I6H I;  1N8R 1;  3HKZ A;  2G2K A;  4NBA A;  2OZK A;  3A54 A;  3GTQ I;  3NH4 A;  4AYB A;  1VQL 1;  1RLY A;  3I4N I;  3CCR 1;  1VQ7 1;  3HOX I;  3G71 1;  3S1N I;  1PFT A;  5C4X I;  3I56 Z;  1KD1 1;  3K7A I;  4NBC A;  2QA4 Z;  3CQZ I;  1Q81 1;  1K73 2;  2JR6 A;  3CCE 1;  1VQ5 Z;  3M3Y I;  2OTL Z;  1Z03 A;  1RNI A;  3CMA 1;  2NVX I;  3CCV Z;  1TWA I;  2QR1 B;  4MRI A;  5D1O B;  2QLV B;  3H3V J;  2JA5 I;  1ZB9 A;  2PM9 A;  3CCL Z;  1VQ9 1;  2Q51 A;  3CC7 1;  3EER A;  2K5R A;  1M90 1;  2NVT I;  2ZAE B;  4RVD A;  4NBF A;  5IT9 b;  2RIQ A;  1Q82 2;  3CD6 1;  2JUB A;  3GTG I;  4XX2 A;  3TE5 B;  1VQL Z;  3CXC Z;  3S17 I;  4A3B I;  3G4S 1;  3CCR Z;  1VQ7 Z;  1VQP Z;  2E2H I;  1X3W A;  1YJW 1;  3G71 Z;  3J81 f;  4U65 E;  5C44 I;  2OOX B;  2I3C A;  1VLA A;  4NBE A;  3CME 1;  1I50 I;  1QVF Y;  4NBG A;  3PO3 I;  1K83 I;  3Q87 A;  2EGT A;  2R7Z I;  4A3L I;  2R92 I;  1USP B;  3NH8 A;  1QVG Z;  3CCE Z;  4A3K I;  3CCM 1;  2P28 A;  4E32 A;  4MD7 A;  4RVF A;  3CMA Z;  1YHQ Z;  3FQQ A;  1YIJ 1;  2ZK9 X;  3CCJ Z;  2BJO A;  2GTI A;  3NDI A;  2Y0S A;  1VQ9 Z;  1Q86 2;  3CC7 Z;  1VQK Z;  4MXU A;  2VUM I;  1YJ9 1;  4FGQ A;  2R6M A;  3JAM b;  2KPI A;  1K9M 2;  1JJ2 Y;  4TNU A;  2JA8 I;  2RHB A;  3G6E 1;  3I07 A;  3OW2 Y;  4X6A I;  3G4S Z;  2RT9 A;  2OTJ 1;  1Y1V S;  1TWG I;  2NVQ I;  4NB8 A;  2Q4Z A;  2QRC B;  2JNY A;  2QRE B;  1K8A 2;  2KI7 B;  1L1O C;  2YAD A;  5FLX f;  1Q7Y 1;  1YIT 1;  1VQ8 1;  3U50 C;  2WB1 A;  3CCS 1;  1RO0 A;  1Y1W I;  1I3Q I;  3CCM Z;  2W04 A;  3CPW Z;  1YIJ Z;  2IZ4 A;  3J81 b;  1YUA A;  4A3D I;  3HOZ I;  1S7M A;  2HU9 A;  1RO2 A;  3A55 A;  1X0T A;  1YI2 1;  3QWU A;  4NFR A;  1KQS Y;  2LFU A;  1VQ6 1;  1VQN 1;  3HOY I;  1ZB8 A;  1QVF Z;  2DE7 A;  5IP7 I;  2RBL A;  5A2Q b;  3ESW A;  2E2I I;  2B63 I;  3S14 I;  3CC4 1;  4RV9 A;  3GTO I;  1WII A;  1VQM 1;  2OTJ Z;  1K73 1;  4E2Y A;  2H85 A;  4HH4 A;  1KC8 2;  3GTJ I;  4QTU A;  3J80 b;  4E2W A;  4RS4 A;  1VQO 1;  1KRL A;  4Y7N I;  2W03 A;  3T4N B;  1NP6 A;  3TDH B;  1P9N A;  1M1K 2;  1YIT Z;  3CCS Z;  1SFO I;  2O53 A;  2V8J A;  2JA6 I;  3D6W A;  3KIH A;  1Q82 1;  4FGP A;  3HOU I;  4BBS I;  3GTL I;  1Z02 A;  3CCU 1;  2JMO A;  2P3Y A;  2VUG A;  4MD8 A;  2GU2 A;  1USP A;  3IF8 A;  2GTH A;  4RVH A;  5FLX b;  2NVY I;  1YI2 Z;  1VQ6 Z;  4HGZ A;  4BBR I;  2QKD A;  1VQN Z;  3CCQ 1;  1X3Z A;  1W2B Y;  4NBB A;  3GTM I;  2VF1 A;  3D9X A;  3KD4 A;  1N2F A;  3KIF A;  4S1T A;  4HGY A;  2HF1 A;  3NDJ A;  3ISR A;  2DE6 A;  3FQM A;  4FGO A;  3CC4 Z;  3I4M I;  1VQM Z;  3F3F C;  3M4O I;  1TWH I;  3CD6 Z;  3BG1 B;  3P5J B;  1VQO Z;  4QTT A;  2QA4 1;  3BG0 B;  2M6N A;  3CXC Y;  3I55 1;  4E30 A;  2V8K A;  1Q86 1;  3IFU A;  5IT9 f;  4MD9 A;  1N8R 2;  1YJW Z;  2K3R A;  3H0G I;  2QRD B;  3CC2 1;  3FKI I;  3CME Z;  3VB9 A;  3MON A;  2R93 I;  2KSV A;  1QF8 A;  4A3F I;  1K9M 1;  3CCU Z;  4BY7 I;  3CCL 1;  1LQL A;  3S1Q I;  3J7A 4;  1QVG Y;  2E2J I;  1KD1 2;  3GTK I;  3S16 I;  3VTN A;  3CCQ Z;  1TWF I;  1K8A 1;  3VMG A;  3PO2 I;  1Q81 2;  5C3E I;  1VQ4 1;  1ZH1 A;  1YUK A;  3S1R I;  2OOY B;  3EED A;  2JS4 A;  4DK1 A;  1VQP 1;  2PMZ A;  3HOW I;  3IX0 A;  1YJ9 Z;  4A3I I;  2RPR A;  5D1O A;  1QYP A;  4NBD A;  2E9H A;  1JWH C;  3G6E Z;  1TFI A;  3I55 Z;  3RZD I;  3HOV I;  1M90 2;  4BY1 I;  2WAQ A;  2AKL A;  2IZ3 A;  5AN9 F;  3JAM f;  4NBH A;  4EWC A;  1Z01 A;  3CC2 Z;  1W2B Z;  1YHQ 1;  1DL6 A;  3VMI A;  3CCJ 1;  5T64 A;  5C4J I;  5LL6 f;  2QEX 1;  4RVG A;  1VQ8 Z;  1TWC I;  1VQK 1;  5T67 A;  1WW9 A;  4A3G I;  1KC8 1;  1YJN 1;  4DQY B;  4CL1 A;  3A56 A;  5FLM I;  1JJ2 Z;  3CPW Y;  1S72 1;  4NB9 A;  1VQ4 Z;  1ML8 A;  3OW2 Z;  1WCM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...