3ESWA

Complex of yeast pngase with glcnac2-iac.
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
333
structure length
332
Chain Sequence
SSGLVPRGSHMNNIDFDSIAKMLLIKYKDFILSKFKKAAPVENIRFQNLVHTNQFAQGVLGQSQHLCTVYDNPSWHSIVLETLDLDLIYKNVDKEFAKDGHAEGENIYTDYLVKELLRYFKQDFFKWCNKPDCNHCGQNTSENMTPLGSQGPNGEESKFNCGTVEIYKCNRCGNITRFPRYNDPIKLLETRKGRGEWCNLFTLILKSFGLDVRYVWNREDHVWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNKKMSYCIAFGKDGVVDVSKRYILQNELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQIELIRGKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
publication title Structural and mutational studies on the importance of oligosaccharide binding for the activity of yeast PNGase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 111
structure length 332
sequence length 333
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03835 Rad4 Rad4 transglutaminase-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3eswA02
3.10.620.30 Alpha Beta Roll C8orf32 fold C8orf32 fold 3eswA01
1Y1VI 1TWGI 4A3LI 3GCFA 3GTJI 1TWFI 2JNYA 3HOVI 4A3MI 2JA7I 2PK7A 3GTQI 4FGOA 3S16I 3S15I 5IP9I 4A3BI 1WCMI 3S1QI 2B63I 3S1RI 3A55A 3A54A 3S2HI 1NUIA 5C4XI 2JA8I 3GTKI 3U50C 4X6AI 3GTPI 1RO4A 2RBLA 4Y7NI 4NBDA 1RLYA 3H3VJ 2F4MA 3CQZI 2YU9I 3GTLI 3I4MI 3GTMI 1I6HI 5IP7I 1R9TI 1SFOI 2R7ZI 3ESWA 3S1NI 4NBCA 2E2HI 4NBBA 2R93I 1I50I 4A3KI 1TWAI 1TWCI 1X3ZA 1ZB8A 3HOXI 2P3YA 1WW9A 2R92I 4XX2A 4A93I 3S14I 5C3EI 4A3JI 1USPB 3GTGI 1I3QI 5FLMI 4A3II 2DE6A 2NVYI 2E2JI 3S17I 5C44I 4MH4A 3S2DI 3ISRA 3VMHA 4A3DI 1ML8A 4BY7I 1PFTA 2F4OA 3VB9A 4FGPA 1LQLA 4NOZA 2VUMI 2DE7A 1ZB9A 4NBEA 2K5RA 2JR6A 2JS4A 3RZOI 3GTOI 2DE5A 4Y52I 4NBAA 4BXXI 1N2FA 4A3FI 1QYPA 3PO3S 4NBFA 1USPA 1TFIA 4QTUA 3KD4A 3HOUI 1VLAA 3I07A 4NBGA 3HOZI 1TWHI 4A3CI 3EERA 4NBHA 3PO3I 3Q87A 1L1OC 4U65E 3VMGA 2ZK9X 3VMIA 3PO2I 3LUSA 2NVTI 1DL6A 2KSVA 3D6WA 3H0GI 3FKII 4BBRI 4A3EI 3S1MI 3K7AI 2E2II 2JA5I 4BY1I 2HF1A 3GKQA 3RZDI 1Y1WI 3M3YI 2BJOA 5CM2M 4NB8A 1K83I 3HOWI 2NVQI 1X3WA 3A56A 3HOYI 5C4JI 2NVXI 3GTMS 3M4OI 1Y1VS 2JA6I 2KPIA 4FGQA 4QTTA 1YUAA 4NB9A 4BBSI 4A3GI 2AKLA 3I4NI 2J6AA
chains in the Genus database with same CATH superfamily
4A3LI 3GCFA 2M48A 1VQO1 1Y8CA 3NDIA 1VQMZ 2PK7A 3GTQI 3I551 1VQ7Z 4A3BI 1WCMI 1VQNZ 4E2XA 1KC81 1NUIA 3CC2Z 3CCMZ 3EEDA 3CCE1 3U50C 1YJN1 4X6AI 4MD8A 5LL6f 4Y7NI 3CCV1 1S7MA 4NBDA 5T6BA 3CQZI 5IP7I 1R9TI 1SFOI 4DK1A 2GU2A 4NBCA 1YJ9Z 3S1NI 1I50I 2QEX1 1X3ZA 2OTL1 2IV2X 3T4NB 5C3EI 4RVHA 4E2WA 5AN9F 3GTGI 2GTIA 2V3VA 3S17I 2V45A 5T64A 3ISRA 4BY7I 4MRIA 1PFTA 2F4OA 2LFUA 3CPWZ 3CCS1 1QVGZ 3CMAZ 3CD61 2YADA 1Q861 3CME1 2OTJZ 3RZOI 1QXFA 2QA41 4Y52I 3OW2Y 4BXXI 1N2FA 4A3FI 2PM9A 3PO3S 4NBFA 1Q821 1YIJ1 3HOUI 3HOZI 3NH4A 3D2LA 1VQP1 3PO3I 4CL1A 1RO0A 2RPRA 2O53A 2IZ4A 5D1OA 3FKII 3CCRZ 3CCQZ 1VQL1 3VTNA 2Q51A 1Q7Y2 1RQFA 1VQ4Z 3F3PC 2JA5I 2HF1A 4MD7A 1YHQ1 3RZDI 3M3YI 1S72Z 1N8R2 3HOWI 2WB1A 3NH8A 1JWHC 3GTMS 2JA6I 2QREB 3MZLB 4QTTA 1YUAA 2LEXA 3I4NI 4E30A 4RVFA 4E2YA 4E31A 3IX0A 1WIIA 2WAQA 5IP9I 3I55Z 1P9NA 3S1QI 1QVFZ 2B63I 3KIHA 1JJ2Z 1VQ51 2JA8I 3MONA 4DGLA 3CCEZ 1YJNZ 1RO4A 3J7A4 1RLYA 2V8JA 2YU9I 3QWUA 3CC4Z 4E33A 3CCU1 2R93I 3TE5B 2VPYA 4A3KI 1TWCI 3HOXI 2QEXZ 2R92I 4XX2A 3G6E1 4A93I 4NFRA 1K732 2OTLZ 3S14I 5D1PA 2VPXA 5FLMI 2JIPA 5C44I 1WJ2A 4MH4A 2JIOA 1Q812 4FGPA 2E9HA 4NOZA 2VUMI 2DE7A 3CCSZ 1ZB9A 1NJI2 1M902 1KQSZ 3CD6Z 2JR6A 2JS4A 3CMEZ 2JUBA 4NBAA 2QA4Z 3NFZA 3J80b 1TFIA 4QTUA 3KD4A 1VLAA 4EWCA 1YIJZ 2OOXB 1TWHI 1YI2Z 4A3CI 1VQ61 1VQPZ 4HGYA 3VMIA 2NVTI 2VPZA 2KSVA 3D6WA 1W2BY 4BBRI 1Z03A 5IT9b 1VQLZ 3S1MI 3G711 1KD11 1VQK1 3JAMb 3F3FC 1YHQZ 2BJOA 5CM2M 4NB8A 3J81b 3OW2Z 3J80f 3A56A 1Q7Y1 2VPWA 3M4OI 4FGQA 1Z01A 1M1K1 1QVGY 3IR7A 3C9QA 3CCL1 2K3RA 1TWGI 3D9XA 1YJW1 1TWFI 2JNYA 3HOVI 4A3MI 2JA7I 5A2Qb 2OZKA 3G4S1 3CC71 1KRLA 4FGOA 3S16I 3S15I 3CCJ1 3S1RI 3S2HI 5C4XI 3TDHB 1Q862 1VQ5Z 3GTKI 2V8IA 3GTPI 2RBLA 2PMZA 1X0TA 3I4MI 2JIQA 3GTMI 1ZH1A 2R7ZI 1VQOZ 3ESWA 2RHBA 5A2Qf 2E2HI 4NBBA 3IF8A 3NDJA 3G6EZ 2H85A 1USPB 1I3QI 1K8A2 2JMOA 2NVYI 2Y0SA 2OOYB 3I561 3VMHA 3NH5A 3CCVZ 2IZ3A 3VB9A 1K731 3CXCZ 2K5RA 1QVFY 2QLVB 1JJ2Y 1VQ81 2AYDA 4MD9A 1QYPA 4NH1C 1Q811 1K9M2 1USPA 2VF1A 2M6NA 3FQMA 1NJI1 3FQQA 3BG0B 2VUGA 2W04A 4NBHA 4U65E 1VQ6Z 3LUSA 4S1TA 1RO2A 3H0GI 4W79A 2E7ZA 4MXUA 2RIQA 3G71Z 3K7AI 2E2II 1VQ91 2QKDA 3GKQA 1Y1WI 1VQKZ 1K83I 2NVQI 1FDOA 2LIYA 2ZAEB 3HOYI 1YUKA 2NVXI 1Y1VS 1YIT1 4BBSI 4A3GI 2AKLA 3CC41 3CCLZ 1Y1VI 2QR1B 1KQSY 4RS4A 3GTJI 1KC82 1VQM1 1YJWZ 1W2BZ 2G2KA 3KIFA 2QRDB 1VQ71 3G4SZ 3CC7Z 2EGTA 2GTHA 1VQN1 1WZNA 3A55A 3A54A 3CCJZ 3CC21 4RVDA 3CCM1 3CPWY 2QRCB 4AYBA 2J6AA 3H3VJ 2F4MA 3GTLI 1I6HI 3P5JB 2JIMA 2P28A 1N8R1 5D1OB 2JIRA 1YJ91 5IT9f 2I3CA 1TWAI 2KI7B 2O4HA 5FLXb 1ZB8A 2P3YA 1WW9A 2V8KA 4RV9A 1Q16A 1YI21 3JAMf 4TNUA 5T67A 3J81f 4A3JI 1RNIA 4A3II 2DE6A 3BG1B 2E2JI 1KD12 1QF8A 3S2DI 3I56Z 4A3DI 1ML8A 1FDIA 1Q822 3CMA1 1LQLA 4NBEA 3CCUZ 2OTJ1 1Z02A 1M1K2 4HH4A 1K8A1 3GTOI 2DE5A 4E2ZA 1VQ8Z 5FLXf 3IFUA 3MZKB 3I07A 4NBGA 3EERA 2NAPA 3Q87A 1L1OC 3HKZA 3VMGA 2ZK9X 1SIWA 3PO2I 1DL6A 1K9M1 3CCR1 3CCQ1 4MONA 2R6MA 2Q4ZA 1VQ41 4A3EI 4BY1I 1VQ9Z 1S721 4RVGA 4E32A 2W03A 1X3WA 5C4JI 1M901 2KPIA 1AA6A 2RT9A 1YITZ 4NB9A 1NP6A 4HGZA 3CXCY 4DQYB 2HU9A
chains in the Genus database with same CATH topology
4A3LI 3GCFA 2M48A 1VQO1 3NDIA 1VQMZ 2PK7A 3GTQI 3I551 1VQ7Z 4A3BI 1WCMI 1VQNZ 4E2XA 1KC81 1NUIA 3CC2Z 3CCMZ 3EEDA 3CCE1 3U50C 1YJN1 4X6AI 4MD8A 5LL6f 4Y7NI 3CCV1 1S7MA 4NBDA 5T6BA 3CQZI 5IP7I 1R9TI 1SFOI 4DK1A 2GU2A 4NBCA 1YJ9Z 3S1NI 1I50I 2QEX1 1X3ZA 2OTL1 3T4NB 5C3EI 4RVHA 4E2WA 5AN9F 3GTGI 2GTIA 3S17I 5T64A 3ISRA 4BY7I 4MRIA 1PFTA 2F4OA 2LFUA 3CPWZ 3CCS1 1QVGZ 3CMAZ 3CD61 2YADA 1Q861 3CME1 2OTJZ 3RZOI 2QA41 4Y52I 3OW2Y 4BXXI 1N2FA 4A3FI 2PM9A 3PO3S 4NBFA 1Q821 1YIJ1 3HOUI 3HOZI 3NH4A 1VQP1 3PO3I 4CL1A 1RO0A 2RPRA 2O53A 2IZ4A 5D1OA 3FKII 3CCRZ 3CCQZ 1VQL1 3VTNA 2Q51A 1Q7Y2 1RQFA 1VQ4Z 3F3PC 2JA5I 2HF1A 4MD7A 1YHQ1 3RZDI 3M3YI 1S72Z 1N8R2 3HOWI 2WB1A 3NH8A 1JWHC 3GTMS 2JA6I 2QREB 3MZLB 4QTTA 1YUAA 3I4NI 4E30A 4RVFA 4E2YA 4E31A 3IX0A 1WIIA 2WAQA 5IP9I 3I55Z 1P9NA 3S1QI 1QVFZ 2B63I 3KIHA 1JJ2Z 1VQ51 2JA8I 3MONA 4DGLA 3CCEZ 1YJNZ 1RO4A 3J7A4 1RLYA 2V8JA 2YU9I 3QWUA 3CC4Z 4E33A 3CCU1 2R93I 3TE5B 4A3KI 1TWCI 3HOXI 2QEXZ 2R92I 4XX2A 3G6E1 4A93I 4NFRA 1K732 2OTLZ 3S14I 5D1PA 5FLMI 5C44I 4MH4A 1Q812 4FGPA 2E9HA 4NOZA 2VUMI 2DE7A 3CCSZ 1ZB9A 1NJI2 1M902 1KQSZ 3CD6Z 2JR6A 2JS4A 3CMEZ 2JUBA 4NBAA 2QA4Z 3NFZA 3J80b 1TFIA 4QTUA 3KD4A 1VLAA 4EWCA 1YIJZ 2OOXB 1TWHI 1YI2Z 4A3CI 1VQ61 1VQPZ 4HGYA 3VMIA 2NVTI 2KSVA 3D6WA 1W2BY 4BBRI 1Z03A 5IT9b 1VQLZ 3S1MI 3G711 1KD11 1VQK1 3JAMb 3F3FC 1YHQZ 2BJOA 5CM2M 4NB8A 3J81b 3OW2Z 3J80f 3A56A 1Q7Y1 3M4OI 4FGQA 1Z01A 1M1K1 1QVGY 3CCL1 2K3RA 1TWGI 3D9XA 1YJW1 1TWFI 2JNYA 3HOVI 4A3MI 2JA7I 5A2Qb 2OZKA 3G4S1 3CC71 1KRLA 4FGOA 3S16I 3S15I 3CCJ1 3S1RI 3S2HI 5C4XI 3TDHB 1Q862 1VQ5Z 3GTKI 2V8IA 3GTPI 2RBLA 2PMZA 1X0TA 3I4MI 3GTMI 1ZH1A 2R7ZI 1VQOZ 3ESWA 2RHBA 5A2Qf 2E2HI 4NBBA 3IF8A 3NDJA 3G6EZ 2H85A 1USPB 1I3QI 1K8A2 2JMOA 2NVYI 2Y0SA 2OOYB 3I561 3VMHA 3NH5A 3CCVZ 2IZ3A 3VB9A 1K731 3CXCZ 2K5RA 1QVFY 2QLVB 1JJ2Y 1VQ81 4MD9A 1QYPA 4NH1C 1Q811 1K9M2 1USPA 2VF1A 2M6NA 3FQMA 1NJI1 3FQQA 3BG0B 2VUGA 2W04A 4NBHA 4U65E 1VQ6Z 3LUSA 4S1TA 1RO2A 3H0GI 4MXUA 2RIQA 3G71Z 3K7AI 2E2II 1VQ91 2QKDA 3GKQA 1Y1WI 1VQKZ 1K83I 2NVQI 2ZAEB 2LIYA 3HOYI 1YUKA 2NVXI 1Y1VS 1YIT1 4BBSI 4A3GI 2AKLA 3CC41 3CCLZ 1Y1VI 2QR1B 1KQSY 4RS4A 3GTJI 1KC82 1VQM1 1YJWZ 1W2BZ 2G2KA 3KIFA 2QRDB 1VQ71 3G4SZ 3CC7Z 2EGTA 2GTHA 1VQN1 3A55A 3A54A 3CCJZ 3CC21 4RVDA 3CCM1 3CPWY 2QRCB 4AYBA 2J6AA 3H3VJ 2F4MA 3GTLI 1I6HI 3P5JB 2P28A 1N8R1 5D1OB 1YJ91 5IT9f 2I3CA 1TWAI 2KI7B 2O4HA 5FLXb 1ZB8A 2P3YA 1WW9A 2V8KA 4RV9A 1YI21 3JAMf 4TNUA 5T67A 3J81f 4A3JI 1RNIA 4A3II 2DE6A 3BG1B 2E2JI 1KD12 1QF8A 3S2DI 3I56Z 4A3DI 1ML8A 1Q822 3CMA1 1LQLA 4NBEA 3CCUZ 2OTJ1 1Z02A 1M1K2 4HH4A 1K8A1 3GTOI 2DE5A 4E2ZA 1VQ8Z 5FLXf 3IFUA 3MZKB 3I07A 4NBGA 3EERA 3Q87A 1L1OC 3HKZA 3VMGA 2ZK9X 3PO2I 1DL6A 1K9M1 3CCR1 3CCQ1 4MONA 2R6MA 2Q4ZA 1VQ41 4A3EI 4BY1I 1VQ9Z 1S721 4RVGA 4E32A 2W03A 1X3WA 5C4JI 1M901 2KPIA 2RT9A 1YITZ 4NB9A 1NP6A 4HGZA 3CXCY 4DQYB 2HU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V I;  1TWG I;  4A3L I;  3GCF A;  3GTJ I;  1TWF I;  2JNY A;  3HOV I;  4A3M I;  2JA7 I;  2PK7 A;  3GTQ I;  4FGO A;  3S16 I;  3S15 I;  5IP9 I;  4A3B I;  1WCM I;  3S1Q I;  2B63 I;  3S1R I;  3A55 A;  3A54 A;  3S2H I;  1NUI A;  5C4X I;  2JA8 I;  3GTK I;  3U50 C;  4X6A I;  3GTP I;  1RO4 A;  2RBL A;  4Y7N I;  4NBD A;  1RLY A;  3H3V J;  2F4M A;  3CQZ I;  2YU9 I;  3GTL I;  3I4M I;  3GTM I;  1I6H I;  5IP7 I;  1R9T I;  1SFO I;  2R7Z I;  3ESW A;  3S1N I;  4NBC A;  2E2H I;  4NBB A;  2R93 I;  1I50 I;  4A3K I;  1TWA I;  1TWC I;  1X3Z A;  1ZB8 A;  3HOX I;  2P3Y A;  1WW9 A;  2R92 I;  4XX2 A;  4A93 I;  3S14 I;  5C3E I;  4A3J I;  1USP B;  3GTG I;  1I3Q I;  5FLM I;  4A3I I;  2DE6 A;  2NVY I;  2E2J I;  3S17 I;  5C44 I;  4MH4 A;  3S2D I;  3ISR A;  3VMH A;  4A3D I;  1ML8 A;  4BY7 I;  1PFT A;  2F4O A;  3VB9 A;  4FGP A;  1LQL A;  4NOZ A;  2VUM I;  2DE7 A;  1ZB9 A;  4NBE A;  2K5R A;  2JR6 A;  2JS4 A;  3RZO I;  3GTO I;  2DE5 A;  4Y52 I;  4NBA A;  4BXX I;  1N2F A;  4A3F I;  1QYP A;  3PO3 S;  4NBF A;  1USP A;  1TFI A;  4QTU A;  3KD4 A;  3HOU I;  1VLA A;  3I07 A;  4NBG A;  3HOZ I;  1TWH I;  4A3C I;  3EER A;  4NBH A;  3PO3 I;  3Q87 A;  1L1O C;  4U65 E;  3VMG A;  2ZK9 X;  3VMI A;  3PO2 I;  3LUS A;  2NVT I;  1DL6 A;  2KSV A;  3D6W A;  3H0G I;  3FKI I;  4BBR I;  4A3E I;  3S1M I;  3K7A I;  2E2I I;  2JA5 I;  4BY1 I;  2HF1 A;  3GKQ A;  3RZD I;  1Y1W I;  3M3Y I;  2BJO A;  5CM2 M;  4NB8 A;  1K83 I;  3HOW I;  2NVQ I;  1X3W A;  3A56 A;  3HOY I;  5C4J I;  2NVX I;  3GTM S;  3M4O I;  1Y1V S;  2JA6 I;  2KPI A;  4FGQ A;  4QTT A;  1YUA A;  4NB9 A;  4BBS I;  4A3G I;  2AKL A;  3I4N I;  2J6A A; 
#chains in the Genus database with same CATH topology
 4A3L I;  3GCF A;  2M48 A;  1VQO 1;  1Y8C A;  3NDI A;  1VQM Z;  2PK7 A;  3GTQ I;  3I55 1;  1VQ7 Z;  4A3B I;  1WCM I;  1VQN Z;  4E2X A;  1KC8 1;  1NUI A;  3CC2 Z;  3CCM Z;  3EED A;  3CCE 1;  3U50 C;  1YJN 1;  4X6A I;  4MD8 A;  5LL6 f;  4Y7N I;  3CCV 1;  1S7M A;  4NBD A;  5T6B A;  3CQZ I;  5IP7 I;  1R9T I;  1SFO I;  4DK1 A;  2GU2 A;  4NBC A;  1YJ9 Z;  3S1N I;  1I50 I;  2QEX 1;  1X3Z A;  2OTL 1;  2IV2 X;  3T4N B;  5C3E I;  4RVH A;  4E2W A;  5AN9 F;  3GTG I;  2GTI A;  2V3V A;  3S17 I;  2V45 A;  5T64 A;  3ISR A;  4BY7 I;  4MRI A;  1PFT A;  2F4O A;  2LFU A;  3CPW Z;  3CCS 1;  1QVG Z;  3CMA Z;  3CD6 1;  2YAD A;  1Q86 1;  3CME 1;  2OTJ Z;  3RZO I;  1QXF A;  2QA4 1;  4Y52 I;  3OW2 Y;  4BXX I;  1N2F A;  4A3F I;  2PM9 A;  3PO3 S;  4NBF A;  1Q82 1;  1YIJ 1;  3HOU I;  3HOZ I;  3NH4 A;  3D2L A;  1VQP 1;  3PO3 I;  4CL1 A;  1RO0 A;  2RPR A;  2O53 A;  2IZ4 A;  5D1O A;  3FKI I;  3CCR Z;  3CCQ Z;  1VQL 1;  3VTN A;  2Q51 A;  1Q7Y 2;  1RQF A;  1VQ4 Z;  3F3P C;  2JA5 I;  2HF1 A;  4MD7 A;  1YHQ 1;  3RZD I;  3M3Y I;  1S72 Z;  1N8R 2;  3HOW I;  2WB1 A;  3NH8 A;  1JWH C;  3GTM S;  2JA6 I;  2QRE B;  3MZL B;  4QTT A;  1YUA A;  2LEX A;  3I4N I;  4E30 A;  4RVF A;  4E2Y A;  4E31 A;  3IX0 A;  1WII A;  2WAQ A;  5IP9 I;  3I55 Z;  1P9N A;  3S1Q I;  1QVF Z;  2B63 I;  3KIH A;  1JJ2 Z;  1VQ5 1;  2JA8 I;  3MON A;  4DGL A;  3CCE Z;  1YJN Z;  1RO4 A;  3J7A 4;  1RLY A;  2V8J A;  2YU9 I;  3QWU A;  3CC4 Z;  4E33 A;  3CCU 1;  2R93 I;  3TE5 B;  2VPY A;  4A3K I;  1TWC I;  3HOX I;  2QEX Z;  2R92 I;  4XX2 A;  3G6E 1;  4A93 I;  4NFR A;  1K73 2;  2OTL Z;  3S14 I;  5D1P A;  2VPX A;  5FLM I;  2JIP A;  5C44 I;  1WJ2 A;  4MH4 A;  2JIO A;  1Q81 2;  4FGP A;  2E9H A;  4NOZ A;  2VUM I;  2DE7 A;  3CCS Z;  1ZB9 A;  1NJI 2;  1M90 2;  1KQS Z;  3CD6 Z;  2JR6 A;  2JS4 A;  3CME Z;  2JUB A;  4NBA A;  2QA4 Z;  3NFZ A;  3J80 b;  1TFI A;  4QTU A;  3KD4 A;  1VLA A;  4EWC A;  1YIJ Z;  2OOX B;  1TWH I;  1YI2 Z;  4A3C I;  1VQ6 1;  1VQP Z;  4HGY A;  3VMI A;  2NVT I;  2VPZ A;  2KSV A;  3D6W A;  1W2B Y;  4BBR I;  1Z03 A;  5IT9 b;  1VQL Z;  3S1M I;  3G71 1;  1KD1 1;  1VQK 1;  3JAM b;  3F3F C;  1YHQ Z;  2BJO A;  5CM2 M;  4NB8 A;  3J81 b;  3OW2 Z;  3J80 f;  3A56 A;  1Q7Y 1;  2VPW A;  3M4O I;  4FGQ A;  1Z01 A;  1M1K 1;  1QVG Y;  3IR7 A;  3C9Q A;  3CCL 1;  2K3R A;  1TWG I;  3D9X A;  1YJW 1;  1TWF I;  2JNY A;  3HOV I;  4A3M I;  2JA7 I;  5A2Q b;  2OZK A;  3G4S 1;  3CC7 1;  1KRL A;  4FGO A;  3S16 I;  3S15 I;  3CCJ 1;  3S1R I;  3S2H I;  5C4X I;  3TDH B;  1Q86 2;  1VQ5 Z;  3GTK I;  2V8I A;  3GTP I;  2RBL A;  2PMZ A;  1X0T A;  3I4M I;  2JIQ A;  3GTM I;  1ZH1 A;  2R7Z I;  1VQO Z;  3ESW A;  2RHB A;  5A2Q f;  2E2H I;  4NBB A;  3IF8 A;  3NDJ A;  3G6E Z;  2H85 A;  1USP B;  1I3Q I;  1K8A 2;  2JMO A;  2NVY I;  2Y0S A;  2OOY B;  3I56 1;  3VMH A;  3NH5 A;  3CCV Z;  2IZ3 A;  3VB9 A;  1K73 1;  3CXC Z;  2K5R A;  1QVF Y;  2QLV B;  1JJ2 Y;  1VQ8 1;  2AYD A;  4MD9 A;  1QYP A;  4NH1 C;  1Q81 1;  1K9M 2;  1USP A;  2VF1 A;  2M6N A;  3FQM A;  1NJI 1;  3FQQ A;  3BG0 B;  2VUG A;  2W04 A;  4NBH A;  4U65 E;  1VQ6 Z;  3LUS A;  4S1T A;  1RO2 A;  3H0G I;  4W79 A;  2E7Z A;  4MXU A;  2RIQ A;  3G71 Z;  3K7A I;  2E2I I;  1VQ9 1;  2QKD A;  3GKQ A;  1Y1W I;  1VQK Z;  1K83 I;  2NVQ I;  1FDO A;  2LIY A;  2ZAE B;  3HOY I;  1YUK A;  2NVX I;  1Y1V S;  1YIT 1;  4BBS I;  4A3G I;  2AKL A;  3CC4 1;  3CCL Z;  1Y1V I;  2QR1 B;  1KQS Y;  4RS4 A;  3GTJ I;  1KC8 2;  1VQM 1;  1YJW Z;  1W2B Z;  2G2K A;  3KIF A;  2QRD B;  1VQ7 1;  3G4S Z;  3CC7 Z;  2EGT A;  2GTH A;  1VQN 1;  1WZN A;  3A55 A;  3A54 A;  3CCJ Z;  3CC2 1;  4RVD A;  3CCM 1;  3CPW Y;  2QRC B;  4AYB A;  2J6A A;  3H3V J;  2F4M A;  3GTL I;  1I6H I;  3P5J B;  2JIM A;  2P28 A;  1N8R 1;  5D1O B;  2JIR A;  1YJ9 1;  5IT9 f;  2I3C A;  1TWA I;  2KI7 B;  2O4H A;  5FLX b;  1ZB8 A;  2P3Y A;  1WW9 A;  2V8K A;  4RV9 A;  1Q16 A;  1YI2 1;  3JAM f;  4TNU A;  5T67 A;  3J81 f;  4A3J I;  1RNI A;  4A3I I;  2DE6 A;  3BG1 B;  2E2J I;  1KD1 2;  1QF8 A;  3S2D I;  3I56 Z;  4A3D I;  1ML8 A;  1FDI A;  1Q82 2;  3CMA 1;  1LQL A;  4NBE A;  3CCU Z;  2OTJ 1;  1Z02 A;  1M1K 2;  4HH4 A;  1K8A 1;  3GTO I;  2DE5 A;  4E2Z A;  1VQ8 Z;  5FLX f;  3IFU A;  3MZK B;  3I07 A;  4NBG A;  3EER A;  2NAP A;  3Q87 A;  1L1O C;  3HKZ A;  3VMG A;  2ZK9 X;  1SIW A;  3PO2 I;  1DL6 A;  1K9M 1;  3CCR 1;  3CCQ 1;  4MON A;  2R6M A;  2Q4Z A;  1VQ4 1;  4A3E I;  4BY1 I;  1VQ9 Z;  1S72 1;  4RVG A;  4E32 A;  2W03 A;  1X3W A;  5C4J I;  1M90 1;  2KPI A;  1AA6 A;  2RT9 A;  1YIT Z;  4NB9 A;  1NP6 A;  4HGZ A;  3CXC Y;  4DQY B;  2HU9 A; 
#chains in the Genus database with same CATH homology
 4A3L I;  3GCF A;  2M48 A;  1VQO 1;  3NDI A;  1VQM Z;  2PK7 A;  3GTQ I;  3I55 1;  1VQ7 Z;  4A3B I;  1WCM I;  1VQN Z;  4E2X A;  1KC8 1;  1NUI A;  3CC2 Z;  3CCM Z;  3EED A;  3CCE 1;  3U50 C;  1YJN 1;  4X6A I;  4MD8 A;  5LL6 f;  4Y7N I;  3CCV 1;  1S7M A;  4NBD A;  5T6B A;  3CQZ I;  5IP7 I;  1R9T I;  1SFO I;  4DK1 A;  2GU2 A;  4NBC A;  1YJ9 Z;  3S1N I;  1I50 I;  2QEX 1;  1X3Z A;  2OTL 1;  3T4N B;  5C3E I;  4RVH A;  4E2W A;  5AN9 F;  3GTG I;  2GTI A;  3S17 I;  5T64 A;  3ISR A;  4BY7 I;  4MRI A;  1PFT A;  2F4O A;  2LFU A;  3CPW Z;  3CCS 1;  1QVG Z;  3CMA Z;  3CD6 1;  2YAD A;  1Q86 1;  3CME 1;  2OTJ Z;  3RZO I;  2QA4 1;  4Y52 I;  3OW2 Y;  4BXX I;  1N2F A;  4A3F I;  2PM9 A;  3PO3 S;  4NBF A;  1Q82 1;  1YIJ 1;  3HOU I;  3HOZ I;  3NH4 A;  1VQP 1;  3PO3 I;  4CL1 A;  1RO0 A;  2RPR A;  2O53 A;  2IZ4 A;  5D1O A;  3FKI I;  3CCR Z;  3CCQ Z;  1VQL 1;  3VTN A;  2Q51 A;  1Q7Y 2;  1RQF A;  1VQ4 Z;  3F3P C;  2JA5 I;  2HF1 A;  4MD7 A;  1YHQ 1;  3RZD I;  3M3Y I;  1S72 Z;  1N8R 2;  3HOW I;  2WB1 A;  3NH8 A;  1JWH C;  3GTM S;  2JA6 I;  2QRE B;  3MZL B;  4QTT A;  1YUA A;  3I4N I;  4E30 A;  4RVF A;  4E2Y A;  4E31 A;  3IX0 A;  1WII A;  2WAQ A;  5IP9 I;  3I55 Z;  1P9N A;  3S1Q I;  1QVF Z;  2B63 I;  3KIH A;  1JJ2 Z;  1VQ5 1;  2JA8 I;  3MON A;  4DGL A;  3CCE Z;  1YJN Z;  1RO4 A;  3J7A 4;  1RLY A;  2V8J A;  2YU9 I;  3QWU A;  3CC4 Z;  4E33 A;  3CCU 1;  2R93 I;  3TE5 B;  4A3K I;  1TWC I;  3HOX I;  2QEX Z;  2R92 I;  4XX2 A;  3G6E 1;  4A93 I;  4NFR A;  1K73 2;  2OTL Z;  3S14 I;  5D1P A;  5FLM I;  5C44 I;  4MH4 A;  1Q81 2;  4FGP A;  2E9H A;  4NOZ A;  2VUM I;  2DE7 A;  3CCS Z;  1ZB9 A;  1NJI 2;  1M90 2;  1KQS Z;  3CD6 Z;  2JR6 A;  2JS4 A;  3CME Z;  2JUB A;  4NBA A;  2QA4 Z;  3NFZ A;  3J80 b;  1TFI A;  4QTU A;  3KD4 A;  1VLA A;  4EWC A;  1YIJ Z;  2OOX B;  1TWH I;  1YI2 Z;  4A3C I;  1VQ6 1;  1VQP Z;  4HGY A;  3VMI A;  2NVT I;  2KSV A;  3D6W A;  1W2B Y;  4BBR I;  1Z03 A;  5IT9 b;  1VQL Z;  3S1M I;  3G71 1;  1KD1 1;  1VQK 1;  3JAM b;  3F3F C;  1YHQ Z;  2BJO A;  5CM2 M;  4NB8 A;  3J81 b;  3OW2 Z;  3J80 f;  3A56 A;  1Q7Y 1;  3M4O I;  4FGQ A;  1Z01 A;  1M1K 1;  1QVG Y;  3CCL 1;  2K3R A;  1TWG I;  3D9X A;  1YJW 1;  1TWF I;  2JNY A;  3HOV I;  4A3M I;  2JA7 I;  5A2Q b;  2OZK A;  3G4S 1;  3CC7 1;  1KRL A;  4FGO A;  3S16 I;  3S15 I;  3CCJ 1;  3S1R I;  3S2H I;  5C4X I;  3TDH B;  1Q86 2;  1VQ5 Z;  3GTK I;  2V8I A;  3GTP I;  2RBL A;  2PMZ A;  1X0T A;  3I4M I;  3GTM I;  1ZH1 A;  2R7Z I;  1VQO Z;  3ESW A;  2RHB A;  5A2Q f;  2E2H I;  4NBB A;  3IF8 A;  3NDJ A;  3G6E Z;  2H85 A;  1USP B;  1I3Q I;  1K8A 2;  2JMO A;  2NVY I;  2Y0S A;  2OOY B;  3I56 1;  3VMH A;  3NH5 A;  3CCV Z;  2IZ3 A;  3VB9 A;  1K73 1;  3CXC Z;  2K5R A;  1QVF Y;  2QLV B;  1JJ2 Y;  1VQ8 1;  4MD9 A;  1QYP A;  4NH1 C;  1Q81 1;  1K9M 2;  1USP A;  2VF1 A;  2M6N A;  3FQM A;  1NJI 1;  3FQQ A;  3BG0 B;  2VUG A;  2W04 A;  4NBH A;  4U65 E;  1VQ6 Z;  3LUS A;  4S1T A;  1RO2 A;  3H0G I;  4MXU A;  2RIQ A;  3G71 Z;  3K7A I;  2E2I I;  1VQ9 1;  2QKD A;  3GKQ A;  1Y1W I;  1VQK Z;  1K83 I;  2NVQ I;  2ZAE B;  2LIY A;  3HOY I;  1YUK A;  2NVX I;  1Y1V S;  1YIT 1;  4BBS I;  4A3G I;  2AKL A;  3CC4 1;  3CCL Z;  1Y1V I;  2QR1 B;  1KQS Y;  4RS4 A;  3GTJ I;  1KC8 2;  1VQM 1;  1YJW Z;  1W2B Z;  2G2K A;  3KIF A;  2QRD B;  1VQ7 1;  3G4S Z;  3CC7 Z;  2EGT A;  2GTH A;  1VQN 1;  3A55 A;  3A54 A;  3CCJ Z;  3CC2 1;  4RVD A;  3CCM 1;  3CPW Y;  2QRC B;  4AYB A;  2J6A A;  3H3V J;  2F4M A;  3GTL I;  1I6H I;  3P5J B;  2P28 A;  1N8R 1;  5D1O B;  1YJ9 1;  5IT9 f;  2I3C A;  1TWA I;  2KI7 B;  2O4H A;  5FLX b;  1ZB8 A;  2P3Y A;  1WW9 A;  2V8K A;  4RV9 A;  1YI2 1;  3JAM f;  4TNU A;  5T67 A;  3J81 f;  4A3J I;  1RNI A;  4A3I I;  2DE6 A;  3BG1 B;  2E2J I;  1KD1 2;  1QF8 A;  3S2D I;  3I56 Z;  4A3D I;  1ML8 A;  1Q82 2;  3CMA 1;  1LQL A;  4NBE A;  3CCU Z;  2OTJ 1;  1Z02 A;  1M1K 2;  4HH4 A;  1K8A 1;  3GTO I;  2DE5 A;  4E2Z A;  1VQ8 Z;  5FLX f;  3IFU A;  3MZK B;  3I07 A;  4NBG A;  3EER A;  3Q87 A;  1L1O C;  3HKZ A;  3VMG A;  2ZK9 X;  3PO2 I;  1DL6 A;  1K9M 1;  3CCR 1;  3CCQ 1;  4MON A;  2R6M A;  2Q4Z A;  1VQ4 1;  4A3E I;  4BY1 I;  1VQ9 Z;  1S72 1;  4RVG A;  4E32 A;  2W03 A;  1X3W A;  5C4J I;  1M90 1;  2KPI A;  2RT9 A;  1YIT Z;  4NB9 A;  1NP6 A;  4HGZ A;  3CXC Y;  4DQY B;  2HU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...