The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
43
|
structure length |
42
|
Chain Sequence |
RVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
pubmed doi rcsb |
| molecule keywords |
Pyruvate dehydrogenase E1 component subunit alpha
|
| molecule tags |
Oxidoreductase/transferase
|
| source organism |
Bacillus stearothermophilus
|
| total genus |
10
|
| structure length |
42
|
| sequence length |
43
|
| chains with identical sequence |
J
|
| ec nomenclature |
ec
2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase. |
| pdb deposition date | 2008-07-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| I | PF00198 | 2-oxoacid_dh | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
| I | PF00364 | Biotin_lipoyl | Biotin-requiring enzyme |
| I | PF02817 | E3_binding | e3 binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Dihydrolipoamide Transferase | E3-binding domain |
#chains in the Genus database with same CATH superfamily 1W88 I; 1W85 I; 2EQ9 C; 2BTH A; 1EBD C; 2F60 K; 1ZY8 K; 1ZWV A; 2BTG A; 3DVA I; 2F5Z K; 2PDE A; 1W4J A; 4QOY E; 1BAL A; 2PDD A; 1W3D A; 1W4G A; 2WXC A; 3DV0 I; 1W4H A; 1W4E A; 1W4I A; 1W4K A; 3RNM E; 1W4F A; #chains in the Genus database with same CATH topology 1W88 I; 1W85 I; 2EQ9 C; 2BTH A; 1EBD C; 2F60 K; 1ZY8 K; 1ZWV A; 2BTG A; 3DVA I; 2F5Z K; 2PDE A; 1W4J A; 4QOY E; 1BAL A; 2PDD A; 1W3D A; 1W4G A; 2WXC A; 3DV0 I; 1W4H A; 1W4E A; 1W4I A; 1W4K A; 3RNM E; 1W4F A; #chains in the Genus database with same CATH homology 1W88 I; 1W85 I; 2EQ9 C; 2BTH A; 1EBD C; 2F60 K; 1ZY8 K; 1ZWV A; 2BTG A; 3DVA I; 2F5Z K; 2PDE A; 1W4J A; 4QOY E; 1BAL A; 2PDD A; 1W3D A; 1W4G A; 2WXC A; 3DV0 I; 1W4H A; 1W4E A; 1W4I A; 1W4K A; 3RNM E; 1W4F A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
