3EMFA

Crystal structure of haemophilus influenzae hiabd2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
113
Chain Sequence
TPVTNKLKAYGDANFNFTNNSIADAEKQVQEAYKGLLNLNEKNASDKLLVEDNTAATVGNLRKLGWVLSSKNGTRNEKSQQVKHADEVLFEGKGGVQVTSTSENGKHTITFAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Repetitive Architecture of the Haemophilus influenzae Hia Trimeric Autotransporter
pubmed doi rcsb
molecule keywords Hia (Adhesin)
molecule tags Cell adhesion
source organism Haemophilus influenzae
total genus 15
structure length 113
sequence length 113
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15403 HiaBD2 HiaBD2_N domain of Trimeric autotransporter adhesin (GIN)
A PF18669 Trp_ring Trimeric autotransporter adhesin Trp ring domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1780.10 Alpha Beta Alpha-Beta Complex Trimeric adhesin Trimeric adhesin 3emfA00
3EMIA 1S7MA 3EMFA
chains in the Genus database with same CATH superfamily
3EMIA 1S7MA 3EMFA
chains in the Genus database with same CATH topology
3EMIA 1S7MA 3EMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMI A;  1S7M A;  3EMF A; 
#chains in the Genus database with same CATH topology
 3EMI A;  1S7M A;  3EMF A; 
#chains in the Genus database with same CATH homology
 3EMI A;  1S7M A;  3EMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...