The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
110
|
structure length |
110
|
Chain Sequence |
TEVKIGAKTSVMKEKDGKLFTGKANKETNKVDGANATEDADEGKGLVTAKDVIDAVNKTGWRIKTTDANGQNGDFATVASGTNVTFASGNGTTATVTNGTDGITVKYDAK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Cell adhesion
|
| molecule keywords |
Hia (Adhesin)
|
| publication title |
Repetitive Architecture of the Haemophilus influenzae Hia Trimeric Autotransporter
pubmed doi rcsb |
| source organism |
Haemophilus influenzae
|
| total genus |
16
|
| structure length |
110
|
| sequence length |
110
|
| ec nomenclature | |
| pdb deposition date | 2008-09-24 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Trimeric adhesin | Trimeric adhesin |
#chains in the Genus database with same CATH superfamily 3EMI A; 3EMF A; 1S7M A; #chains in the Genus database with same CATH topology 3EMI A; 3EMF A; 1S7M A; #chains in the Genus database with same CATH homology 3EMI A; 3EMF A; 1S7M A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
