1S7MA

Crystal structure of hiabd1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
158
Chain Sequence
GAKTEINKDGLTITPANGAGANNANTISVTKDGISAGGQSVKNVVSGLKKFGDANFDPLTSSADNLTKQNDDAYKGLTNLDEKGTDKQTPVVADNTAATVGDLRGLGWVISADKTTGGSTEYHDQVRNANEVKFKSGNGINVSGKTVNGRREITFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for host recognition by the Haemophilus influenzae Hia autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
molecule keywords Hia
total genus 27
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15403 HiaBD2 HiaBD2_N domain of Trimeric autotransporter adhesin (GIN)
A PF18669 Trp_ring Trimeric autotransporter adhesin Trp ring domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.140 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s7mA03
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1s7mA01
3.90.1780.10 Alpha Beta Alpha-Beta Complex Trimeric adhesin Trimeric adhesin 1s7mA02
3EMIA 3D9XA 3EMFA 1S7MA
chains in the Genus database with same CATH superfamily
5CM2M 3HOWI 2DW7A 2HNEA 3PO3I 3U4FA 3GKQA 2I5QA 3CCVZ 3K1GA 2R6MA 4GISA 4HNLA 2YVFA 2QA41 3DG3A 1Q7Y2 2WOVA 1MO9A 4RVFA 1VQ61 4EQXA 3I4KA 2AAQA 2WOWA 1USPB 2W54A 4K2SA 3U50C 3V3WA 4MGGA 2WP6A 2NVQI 2GGJA 5U25A 2R93I 2E2JI 3IJQA 1NJI2 1N5XA 1VQP1 5ENLA 4E30A 2EGTA 2PP1A 4NBGA 2X99A 3DERA 4GR1A 3GO2A 4GYPA 3D6WA 2QREB 1JOAA 1N8R1 3STPA 2V8KA 3GD4A 1ONFA 1Q1WA 4E4FA 4BV6A 3I6TA 1RQFA 2P8BA 2RDXA 2DE7A 1GXFA 2J6AA 4MXUA 2YVGA 1ZDLA 2W0HA 3EERA 1EC7A 1F8WA 4J3ZA 4ZA0A 1YJ91 1M901 2OX4A 4NBHA 3UJEA 5FJTA 1FEAA 2EQ9A 4E2ZA 3AMZA 1NHRA 1FO4A 1PDYA 1VLAA 3S16I 4X2PA 3RO6A 3SSZA 4EQRA 3D9XA 1RNIA 3J81f 2YU9I 3FKII 3GTKI 2DE5A 4A3BI 3P3BA 1VQ51 2QLVB 1QXFA 4MD7A 2OTL1 1XS2A 3I6EA 3N4EA 3N6JA 4TVYA 2E9HA 3OZMA 3KLJA 2K3RA 1Y1WI 5FMHA 4NH1C 1TYPA 2OFJA 3CYJA 2OKTA 3SQSA 1XPYA 3CCJ1 3PWIA 1EBDA 1KN0A 2PP0A 4IP4A 1GSNA 2MUCA 1SFOI 5D1OB 4MD9A 5T6BA 1V97A 4J1OA 2E5AA 3NFUA 2E2II 3OPSA 5FJPA 3DFHA 5JCIA 3S2HI 1ZXIC 2GSHA 3GTMI 3DG7A 1JPDX 1Q821 3MSYA 1VQMZ 2OOYB 3IX0A 4M52A 4NEVA 2OZ8A 1RO2A 1ZB9A 1YI21 3CGCA 1Q861 3TWBA 3VFCA 4H1ZA 3DJGX 6ENLA 3IJIA 1VQL1 3GTGI 1N63C 2JMOA 4NB8A 4M0XA 2DE6A 1T3QC 2X8CA 3CGBA 5D1PA 3CXCY 1Z02A 2PA6A 1VQ4Z 5A2Qb 3JVAA 2F5ZA 4NBBA 4H83A 4E2WA 3H12A 3DG6A 2PU0A 2PTZA 2FKPA 1MDLA 3DK8A 1VQN1 3NVWB 4Z17A 2QJNA 2JUBA 2VPYA 1VQ6Z 3J7A4 3JZUA 3T6CA 1Z03A 4GYPC 4MKSA 5KVIA 3JAMb 3HW2A 3TJ4A 1KKOA 4E33A 1ELSA 2X8HA 3LADA 1X3ZA 1XHCA 3I07A 1EBHA 1KD12 2WBAA 3ES7A 3CPWY 4BBRI 3UXLA 3IK4A 3SR6B 5AN9F 3SQPA 2GL5A 4H4VA 5JCMA 2J3NA 3ZLFA 4A3FI 4NOZA 4KWSA 2JS4A 2JNYA 2OOXB 1GREA 2W3SA 3RR1A 1N2FA 1KCZA 3NDIA 4LA1A 1XANA 3CCM1 2VPXA 1Z01A 3GRSA 2JR6A 3EEDA 5IP9I 3I551 3CCE1 1WYGA 4DK1A 2OO6A 1JROA 1R0MA 3CB3A 5LL6f 2W3RA 3NVVB 4HCLA 1YI2Z 1EC8A 3S5SA 3FCPA 1LQLA 1K9M1 1VQNZ 3CCSZ 2AL2B 3PG6A 1VQM1 3KIFA 2AYDA 3CQZI 3FVDA 2E7ZA 3QKEA 3D46A 3SBFA 3G4S1 3CGEA 2K5RA 2QAEA 4H4RA 4IL2A 2GR3A 4JDRA 1NUIA 1QVFZ 2VUGA 2P28A 4LIIA 4GMEA 1KC82 4A3CI 3H70A 3Q87A 1AA6A 2TPRA 3Q6JA 1VQKZ 4KEMA 1F9CA 1GRHA 2GQWA 2ZC8A 3KIHA 1Q7Y1 2G2KA 2IV2X 2I3CA 3RNMA 4RS4A 4NBCA 1SJCA 4YWSA 7ENLA 5FS6A 3LB8A 4ZCWA 2E3TA 3BOXA 3S2DI 3NVZB 1N60C 3R1ZA 2PPGA 3NVYB 1YJWZ 4H4UA 3H0GI 5D1OA 2YVJA 1GRBA 3HPFA 2BCPA 4A3EI 2HZGA 3G6EZ 3CXCZ 1GRFA 2W55A 1RO0A 1BQGA 1MRAA 3A7RA 1GESA 1YJ9Z 1ONEA 4IT1A 3B97A 3CMA1 1OEPA 1WZNA 2JIOA 4A3KI 3NXLA 3S15I 4IL0A 3G71Z 2CDUA 3TQPA 1X3WA 2PMQA 4APNA 2QJMA 1TWFI 3B9JB 2BC0A 1K731 1I3QI 5IT9b 1FIQB 1GV4A 3UCCA 1SIWA 3CCU1 1X2GA 2LIYA 3CC41 3CCS1 3SN0A 2AKMA 5IT9f 1SJDA 1RLYA 3GRTA 3BG0B 3VB9A 1FHVA 1MOKA 1DNCA 3MQTA 5ER0A 3AN1A 3VMGA 2VPZA 4H4ZA 2WB1A 3H7VA 2QA4Z 5J04A 1LVLA 3IF8A 1DXLA 2VUMI 3S17I 1WW9A 1XDIA 3UGVA 2KPIA 2QVHA 3M4OI 4GFIA 1K8A1 1TYTA 2HF1A 3FXGA 2PGWA 1FDOA 1TWHI 2QEX1 2GR2A 2X50A 1OJTA 3RZOI 4HCDA 1ML8A 1WIIA 4ENLA 1L1OC 3HKZA 2P3ZA 4JN8A 5JCKA 4EWCA 3CMEZ 1KD0A 1WCMI 3I4NI 3P93A 2OTJZ 3GTMS 3S14I 4MH4A 4MRIA 2XSXA 1BKHA 5JCLA 4KPLA 3IR7A 4QTTA 1Q1RA 1R9TI 1YJNZ 1NPXA 1YIJ1 3DJJA 3CC4Z 3RZDI 2WOIA 1Y1VI 3QWUA 1VQLZ 2R92I 3LUSA 1FHUA 4TNUA 3NDJA 2WPCA 3ES8A 4HCHA 3GTPI 4IHCA 3GD3A 1I50I 1RO4A 3UJ2A 1W6TA 1M6IA 4AYBA 1ZX9A 3R11A 2V3BA 3NH5A 3UCDA 3OC4A 2R9ZA 3QLDA 1GERA 3PWGA 2CHRA 2PP3A 3VC6A 4ADWA 4FDCB 1L8PA 2IZ4A 4EQSA 2JIRA 1NHQA 3VMHA 2GR0A 3CT2A 3FJ4A 1YEYA 3VA8A 5BOFA 3MKCA 4DHGA 2PGEA 2OZTA 1VQK1 3TWAA 1D7YA 4HPNA 2Q51A 1VQ71 3DEQA 4Y52I 3V4BA 3JAMf 5G5HB 2PS2A 3RRAA 3DK9A 2ZZCA 2GRTA 2OPJA 3CCJZ 4FI4A 3ZVHB 1KQSZ 4H19A 3J80f 3EKGA 5FS7A 3BG1B 3ZVHA 5JRBA 5KVHA 4A6GA 4G7FA 1E9IA 2GGIA 2PM9A 2NVKX 3V5CA 1RM6B 5C3EI 4A35A 3RITA 4DQYB 2AL2A 3QFBA 3UJFA 2WPFA 5FLXf 2Q4ZA 2YADA 4X6AI 1FEBA 2AL1A 2HU9A 4NEWA 3TTEA 2PTYA 1K4QA 2QDEA 1YIJZ 1K8A2 3FV9A 2Y0SA 2RHBA 3R0KA 3GTLI 1R6WA 1NHSA 2EQ7A 4K1WA 4H2HA 4E31A 2NVYI 4MMWA 1YHQZ 4EM4A 3S1MI 1VQPZ 4HGYA 1MDRA 3KUMA 4A3II 3CAWA 1FECA 2BC1A 3T8QA 3N6HA 2PK7A 3AM9A 3P5JB 2OQHA 2BJOA 2OQYA 2PODA 4A93I 1Y8CA 1P48A 3IJLA 3CCQZ 4NB9A 1Q862 1P43A 2XH7A 3QN3A 1K732 2PTWA 3GTJI 4K8GA 3CCQ1 3DGBA 3IFUA 2NVTI 4ZOHB 3F3PC 1NU5A 3H8AA 2F4OA 2RIQA 3PFRA 3T9PA 2ZZBA 3BJSA 2LEXA 3QTPA 4YWOA 4BY1I 4J57A 1TFIA 2PSNA 4DWDA 1BWCA 4EM3A 1VQ91 3CCUZ 3IC9A 4E2XA 4HN8A 4HYRA 5BOEA 1VQ41 5C44I 1TZZA 4ROPA 3MZKB 4H4PA 1QVFY 1KQSY 3CD61 2ZADA 3P0WA 5C4JI 4HNCA 2WAQA 2M6NA 3TOYA 4E6MA 1PDZA 3VMIA 5EBKA 4E8GA 4EWJA 3EMFA 3PO2I 2QJJA 4XX2A 2JA6I 3GD6A 1TWAI 3NZGA 4BURA 3DH9A 2KI7B 1ZH1A 2V6OA 3SJNA 4EMWA 2PCEA 4RVGA 1WUEA 4RVDA 4NBDA 3A7UA 3URHA 3VTNA 2VPWA 4A3GI 3LXDA 1PFTA 2OZ3A 3EF6A 2EQ6A 3L5OA 4GGBA 3CMAZ 4DNAA 1K83I 4DGLA 2HXTA 1ZB8A 5FLXb 1VQ81 3ENLA 4EQWA 1GRGA 1ZY8A 3UJSA 3VCCA 3G6E1 3DGZA 3CXOA 1TKKA 3NFZA 4NBAA 5T67A 1Q811 1YUKA 1NP6A 1QVGY 3CXBA 3DESA 4GRTA 1LPFA 4DYEA 1MNSA 4EMIA 5IP7I 3CCR1 4Y7NI 4H4TA 2JIMA 2W04A 1ZMCA 3I56Z 5FJRA 1AOGA 3CPWZ 4G8TA 4BY7I 2R7ZI 3THUA 3D47A 1GEUA 2O53A 4FP1A 4M6UA 2AKLA 3I4MI 1SJBA 1VQ5Z 2OTLZ 2A8XA 2PTXA 1ZKQA 3BSMA 3ZLHA 3VDGA 1GRAA 1Y1VS 3I55Z 3OP2A 5IDZA 4E32A 1TE6A 1NDAA 3N4FA 2RPRA 3I561 3UXKA 3EMIA 3HRDC 2DW6A 2X8GA 4H4QA 5TR3A 3T4NB 2NVXI 3GTOI 4E5TA 2V45A 1VQZA 3PO3S 1YQZA 2QQ6A 1TWGI 3CCEZ 2B63I 3EAOA 3Q4DA 4EMJA 3J81b 3CCMZ 4FX9A 1W2BZ 2XH4A 3OW2Y 5FJOA 1NHPA 2NAPA 1MUCA 1P9NA 3NO1A 1SJAA 4TVWA 2GDQA 2M48A 3R07C 2P3YA 1N62C 3CK5A 1ZMDA 4RVHA 2AKZA 2OZKA 1VDVA 3CC2Z 1S7MA 3GTQI 3MONA 5A2Qf 2ONEA 3OTRA 4JN7A 1N61C 2YAUA 3TE5B 3TDHB 4H50A 4JQ9A 3DFYA 1SB3B 1S721 3VC5A 1NJI1 1WJ2A 4MONA 4HH4A 4E2YA 3EUB3 3CD6Z 2GTIA 1H6VA 2CFYA 4DN1A 1YJN1 4MD8A 4H4XA 3HOZI 3S47A 4NBFA 1STZA 2PMZA 2XH2A 2XH0A 2NQLA 2YQUA 3ZLGA 1WUFA 3ZVIA 2P0IA 4A3MI 2GGGA 5FJUA 4Z1YA 2JK6A 4A3LI 1EC9A 3A7AA 3RGTA 4DXKA 2GGHA 3CME1 4RV9A 4H4YA 2QR1B 2OG9A 1BZLA 4IP5A 1RVKA 3H3VJ 2ZZ0A 5EU9A 3J80b 1S72Z 2RT9A 2NPXA 2W03A 3FQQA 4HGZA 1EBGA 2FYMA 3O0HA 2GTHA 2QEXZ 3GCFA 2RBLA 1JEHA 3QPEA 4K8DA 4A3RA 1F3PA 3DDMA 3UJRA 2H85A 2GGEA 1M1K2 3HOYI 1VQO1 2E2HI 2LFUA 4J56A 2O56A 2JIQA 1YUAA 1QYPA 2OTJ1 3TJIA 3L8KA 3PK7A 3T4WA 3CCL1 4A3DI 1VQ7Z 3FYYA 4BXXI 5T64A 3S1RI 1TWCI 3CC71 2P88A 3QFAA 1KD11 1ECQA 2F4MA 1V59A 3NS1B 4KPRA 2V3VA 1GETA 1JRPA 1ZK7A 4F4RA 2QDDA 2OLAA 3NH8A 1YIT1 1K9M2 3DIPA 4A3JI 1IYXA 4DX3A 1GRTA 1X2HA 3RCYA 2MNRA 1FDIA 1X0TA 4NFRA 1KC81 2JA5I 1NELA 2HQMA 3EEZA 3V5FA 3VCNA 1H2IA 1M1K1 1YHQ1 2GH5A 1M902 3OW1A 5FS9A 1JPMA 1Q16A 2JA7I 3MZNA 3MZLB 3R0UA 4K7ZA 3OW2Z 2QGYA 3ETRB 3TCSA 1YJW1 1YITZ 1QF8A 2JA8I 3CCRZ 1N5WC 1JJ2Y 2C3DA 4CL1A 4IZGA 1JWHC 1DTNA 1FFVC 3R10A 5FS8A 2QRCB 3CCLZ 2GU2A 1N8R2 3SN1A 2V3AA 1Q822 3CCV1 3GC2A 3GY1A 4BBSI 3EANA 3F3FC 4S1TA 1JDFA 5U1OA 3D2LA 2POZA 3U9IA 3MWCA 2IZ3A 2JIPA 1FFUC 3G4SZ 3CC7Z 2WPEA 4H4WA 4GIRA 1VQOZ 1VQ8Z 5C4XI 3NRZB 1DL6A 2QKDA 4KT2A 2HXUA 2P8CA 3Q45A 3CGDA 4H4SA 3S1QI 3II4A 3HOVI 3ESWA 3DK4A 4NBEA 3MUCA 5JCNA 5FLMI 1KKRA 1QVGZ 3NH4A 4QTUA 2C3CA 5GRTA 3K7AI 2QRDB 3HOXI 3OZYA 2V8JA 1JCTA 2RABA 3HOUI 2EQ8A 1KRLA 1USPA 3H4KA 2XGZA 3JW7A 2VF1A 3S1NI 3FG2P 1JJ2Z 3MY9A 3G711 4E4UA 5G5GB 1Q812 3M3YI 3CC21 2GR1A 3DGHA 1W2BY 3FQMA 3R25A 2PU1A 2ZAEB 4JHMA 3SN4A 3TW9A 1VQ9Z 2OVLA 1I6HI 2O4HA 4GGHA 2WP5A 2V8IA
chains in the Genus database with same CATH topology
5CM2M 3HOWI 3PO3I 3GKQA 3CCVZ 2R6MA 2YVFA 2QA41 1Q7Y2 2WOVA 1MO9A 4RVFA 1VQ61 2AAQA 2WOWA 1USPB 3U50C 5U25A 2WP6A 2NVQI 2R93I 2E2JI 1NJI2 1VQP1 4E30A 2EGTA 4GR1A 4NBGA 2X99A 3D6WA 2QREB 1JOAA 1N8R1 2V8KA 3GD4A 1ONFA 1Q1WA 4BV6A 1RQFA 2DE7A 1GXFA 2J6AA 4MXUA 2YVGA 1ZDLA 2W0HA 3EERA 1F8WA 1YJ91 1M901 4NBHA 1FEAA 2EQ9A 4E2ZA 1NHRA 1VLAA 3S16I 4EQRA 3D9XA 1RNIA 3J81f 2YU9I 3FKII 3GTKI 2DE5A 4A3BI 1VQ51 2QLVB 2OTL1 4MD7A 2E9HA 3KLJA 2K3RA 1Y1WI 5FMHA 4NH1C 1TYPA 3CCJ1 1EBDA 1KN0A 1GSNA 1SFOI 5D1OB 4MD9A 5T6BA 2E2II 5JCIA 3S2HI 3GTMI 1Q821 1VQMZ 2OOYB 3IX0A 4M52A 4NEVA 1RO2A 1ZB9A 1YI21 3CGCA 1Q861 3DJGX 1VQL1 3GTGI 2JMOA 4NB8A 2DE6A 2X8CA 3CGBA 5D1PA 3CXCY 1Z02A 1VQ4Z 5A2Qb 2F5ZA 4NBBA 4E2WA 3DK8A 1VQN1 2JUBA 1VQ6Z 3J7A4 1Z03A 5KVIA 3JAMb 4E33A 2X8HA 3LADA 1X3ZA 1XHCA 3I07A 1KD12 2WBAA 3CPWY 4BBRI 5AN9F 3SQPA 4H4VA 5JCMA 2J3NA 4A3FI 4NOZA 2JS4A 2OOXB 2JNYA 1GREA 1N2FA 3NDIA 4LA1A 1XANA 3CCM1 1Z01A 3GRSA 2JR6A 3EEDA 5IP9I 3I551 3CCE1 4DK1A 5LL6f 1YI2Z 1LQLA 1K9M1 1VQNZ 3CCSZ 3PG6A 1VQM1 3KIFA 3CQZI 3G4S1 3CGEA 2K5RA 2QAEA 4H4RA 2GR3A 4JDRA 1NUIA 1QVFZ 2VUGA 2P28A 4LIIA 1KC82 4A3CI 3Q87A 2TPRA 3Q6JA 1VQKZ 1GRHA 2GQWA 3KIHA 1Q7Y1 2G2KA 2I3CA 3RNMA 4RS4A 4NBCA 5FS6A 3LB8A 3S2DI 1YJWZ 4H4UA 3H0GI 5D1OA 2YVJA 1GRBA 2BCPA 4A3EI 3G6EZ 3CXCZ 1GRFA 1RO0A 1GESA 1YJ9Z 3CMA1 4A3KI 3S15I 3G71Z 2CDUA 1X3WA 4APNA 1TWFI 2BC0A 1K731 1I3QI 5IT9b 1GV4A 3CCU1 2LIYA 3CC41 3CCS1 5IT9f 3GRTA 1RLYA 3BG0B 3VB9A 1MOKA 1DNCA 5ER0A 3VMGA 4H4ZA 2WB1A 2QA4Z 1LVLA 3IF8A 1DXLA 2VUMI 3S17I 1WW9A 1XDIA 2KPIA 3M4OI 1K8A1 1TYTA 2HF1A 1TWHI 2QEX1 2GR2A 2X50A 1OJTA 3RZOI 1ML8A 1WIIA 1L1OC 3HKZA 5JCKA 4EWCA 3CMEZ 1WCMI 3I4NI 2OTJZ 3GTMS 3S14I 4MH4A 4MRIA 5JCLA 4QTTA 1Q1RA 1R9TI 1YJNZ 1NPXA 1YIJ1 3DJJA 3CC4Z 3RZDI 2WOIA 1Y1VI 1VQLZ 3QWUA 2R92I 3LUSA 4TNUA 3NDJA 2WPCA 3GTPI 3GD3A 1I50I 1RO4A 1M6IA 4AYBA 1ZX9A 2V3BA 3NH5A 3OC4A 2R9ZA 1GERA 4ADWA 4FDCB 2IZ4A 4EQSA 1NHQA 3VMHA 2GR0A 1VQK1 1D7YA 2Q51A 1VQ71 4Y52I 3JAMf 3DK9A 2ZZCA 2GRTA 3CCJZ 1KQSZ 3J80f 5FS7A 3BG1B 5JRBA 5KVHA 2NVKX 2PM9A 5C3EI 4DQYB 3QFBA 2WPFA 5FLXf 2Q4ZA 2YADA 4X6AI 1FEBA 2HU9A 4NEWA 1K4QA 1YIJZ 1K8A2 2Y0SA 2RHBA 3GTLI 1NHSA 2EQ7A 4E31A 2NVYI 1YHQZ 4EM4A 3S1MI 1VQPZ 4HGYA 4A3II 1FECA 2BC1A 2PK7A 3P5JB 2BJOA 4A93I 3CCQZ 4NB9A 1Q862 1K732 3GTJI 3CCQ1 3IFUA 2NVTI 3F3PC 2F4OA 2RIQA 2ZZBA 4YWOA 4BY1I 4J57A 1TFIA 1BWCA 4EM3A 1VQ91 3CCUZ 3IC9A 4E2XA 1VQ41 5C44I 3MZKB 4H4PA 1QVFY 1KQSY 3CD61 5C4JI 2WAQA 2M6NA 3EMFA 3VMIA 5EBKA 3PO2I 4XX2A 2JA6I 1TWAI 4BURA 3DH9A 2KI7B 1ZH1A 2V6OA 4EMWA 4RVGA 4RVDA 4NBDA 3URHA 3VTNA 4A3GI 3LXDA 1PFTA 3EF6A 2EQ6A 3L5OA 4DNAA 3CMAZ 1K83I 4DGLA 1ZB8A 5FLXb 1VQ81 4EQWA 1GRGA 1ZY8A 3G6E1 3DGZA 3NFZA 4NBAA 5T67A 1Q811 1YUKA 1NP6A 1QVGY 4GRTA 4EMIA 1LPFA 5IP7I 3CCR1 4Y7NI 4H4TA 1AOGA 2W04A 1ZMCA 3I56Z 3CPWZ 4BY7I 2R7ZI 1GEUA 2O53A 2AKLA 3I4MI 2A8XA 1VQ5Z 2OTLZ 1ZKQA 1GRAA 1Y1VS 3I55Z 4E32A 1NDAA 2RPRA 3I561 3EMIA 2X8GA 4H4QA 5TR3A 3T4NB 2NVXI 3GTOI 1YQZA 3PO3S 3EAOA 4EMJA 1TWGI 3CCEZ 2B63I 3J81b 3CCMZ 4FX9A 1W2BZ 3OW2Y 1NHPA 1P9NA 2M48A 2P3YA 1ZMDA 4RVHA 2OZKA 3CC2Z 1S7MA 3GTQI 3MONA 5A2Qf 2YAUA 3TE5B 3TDHB 4H50A 4JQ9A 1S721 1NJI1 4MONA 4HH4A 4E2YA 3CD6Z 2GTIA 1H6VA 2CFYA 1YJN1 4MD8A 4H4XA 3HOZI 4NBFA 2PMZA 2YQUA 4A3MI 2JK6A 4A3LI 3CME1 4RV9A 4H4YA 2QR1B 1BZLA 4EQXA 3H3VJ 2ZZ0A 3J80b 1S72Z 2RT9A 2NPXA 2W03A 3FQQA 4HGZA 3O0HA 2GTHA 2QEXZ 3GCFA 2RBLA 1JEHA 4K8DA 1F3PA 2H85A 1M1K2 3HOYI 1VQO1 2E2HI 2LFUA 4J56A 1YUAA 1QYPA 2OTJ1 3L8KA 3CCL1 4A3DI 1VQ7Z 4BXXI 5T64A 3S1RI 1TWCI 3CC71 3QFAA 1KD11 2F4MA 1V59A 4KPRA 1GETA 1ZK7A 3NH8A 1YIT1 1K9M2 4A3JI 1GRTA 1X0TA 4NFRA 1KC81 2JA5I 2HQMA 1H2IA 1M1K1 1YHQ1 2GH5A 1M902 5FS9A 2JA7I 3MZLB 4K7ZA 3OW2Z 1YJW1 1YITZ 1QF8A 2JA8I 3CCRZ 2C3DA 1JJ2Y 4CL1A 1JWHC 5FS8A 2QRCB 3CCLZ 2GU2A 1N8R2 2V3AA 1Q822 3CCV1 4BBSI 3EANA 3F3FC 4S1TA 5U1OA 2IZ3A 3G4SZ 3CC7Z 2WPEA 4H4WA 1VQOZ 1VQ8Z 5C4XI 1DL6A 2QKDA 3CGDA 4H4SA 3S1QI 3II4A 3HOVI 3ESWA 3DK4A 4NBEA 5JCNA 5FLMI 1QVGZ 3NH4A 4QTUA 2C3CA 5GRTA 3K7AI 2QRDB 3HOXI 2V8JA 2RABA 3HOUI 2EQ8A 1KRLA 1USPA 3H4KA 2VF1A 3S1NI 3FG2P 1JJ2Z 3G711 1Q812 3M3YI 3CC21 2GR1A 3DGHA 1W2BY 3FQMA 2ZAEB 1VQ9Z 1I6HI 2O4HA 2WP5A 2V8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMI A;  3D9X A;  3EMF A;  1S7M A; 
#chains in the Genus database with same CATH topology
 5CM2 M;  3HOW I;  2DW7 A;  2HNE A;  3PO3 I;  3U4F A;  3GKQ A;  2I5Q A;  3CCV Z;  3K1G A;  2R6M A;  4GIS A;  4HNL A;  2YVF A;  2QA4 1;  3DG3 A;  1Q7Y 2;  2WOV A;  1MO9 A;  4RVF A;  1VQ6 1;  4EQX A;  3I4K A;  2AAQ A;  2WOW A;  1USP B;  2W54 A;  4K2S A;  3U50 C;  3V3W A;  4MGG A;  2WP6 A;  2NVQ I;  2GGJ A;  5U25 A;  2R93 I;  2E2J I;  3IJQ A;  1NJI 2;  1N5X A;  1VQP 1;  5ENL A;  4E30 A;  2EGT A;  2PP1 A;  4NBG A;  2X99 A;  3DER A;  4GR1 A;  3GO2 A;  4GYP A;  3D6W A;  2QRE B;  1JOA A;  1N8R 1;  3STP A;  2V8K A;  3GD4 A;  1ONF A;  1Q1W A;  4E4F A;  4BV6 A;  3I6T A;  1RQF A;  2P8B A;  2RDX A;  2DE7 A;  1GXF A;  2J6A A;  4MXU A;  2YVG A;  1ZDL A;  2W0H A;  3EER A;  1EC7 A;  1F8W A;  4J3Z A;  4ZA0 A;  1YJ9 1;  1M90 1;  2OX4 A;  4NBH A;  3UJE A;  5FJT A;  1FEA A;  2EQ9 A;  4E2Z A;  3AMZ A;  1NHR A;  1FO4 A;  1PDY A;  1VLA A;  3S16 I;  4X2P A;  3RO6 A;  3SSZ A;  4EQR A;  3D9X A;  1RNI A;  3J81 f;  2YU9 I;  3FKI I;  3GTK I;  2DE5 A;  4A3B I;  3P3B A;  1VQ5 1;  2QLV B;  1QXF A;  4MD7 A;  2OTL 1;  1XS2 A;  3I6E A;  3N4E A;  3N6J A;  4TVY A;  2E9H A;  3OZM A;  3KLJ A;  2K3R A;  1Y1W I;  5FMH A;  4NH1 C;  1TYP A;  2OFJ A;  3CYJ A;  2OKT A;  3SQS A;  1XPY A;  3CCJ 1;  3PWI A;  1EBD A;  1KN0 A;  2PP0 A;  4IP4 A;  1GSN A;  2MUC A;  1SFO I;  5D1O B;  4MD9 A;  5T6B A;  1V97 A;  4J1O A;  2E5A A;  3NFU A;  2E2I I;  3OPS A;  5FJP A;  3DFH A;  5JCI A;  3S2H I;  1ZXI C;  2GSH A;  3GTM I;  3DG7 A;  1JPD X;  1Q82 1;  3MSY A;  1VQM Z;  2OOY B;  3IX0 A;  4M52 A;  4NEV A;  2OZ8 A;  1RO2 A;  1ZB9 A;  1YI2 1;  3CGC A;  1Q86 1;  3TWB A;  3VFC A;  4H1Z A;  3DJG X;  6ENL A;  3IJI A;  1VQL 1;  3GTG I;  1N63 C;  2JMO A;  4NB8 A;  4M0X A;  2DE6 A;  1T3Q C;  2X8C A;  3CGB A;  5D1P A;  3CXC Y;  1Z02 A;  2PA6 A;  1VQ4 Z;  5A2Q b;  3JVA A;  2F5Z A;  4NBB A;  4H83 A;  4E2W A;  3H12 A;  3DG6 A;  2PU0 A;  2PTZ A;  2FKP A;  1MDL A;  3DK8 A;  1VQN 1;  3NVW B;  4Z17 A;  2QJN A;  2JUB A;  2VPY A;  1VQ6 Z;  3J7A 4;  3JZU A;  3T6C A;  1Z03 A;  4GYP C;  4MKS A;  5KVI A;  3JAM b;  3HW2 A;  3TJ4 A;  1KKO A;  4E33 A;  1ELS A;  2X8H A;  3LAD A;  1X3Z A;  1XHC A;  3I07 A;  1EBH A;  1KD1 2;  2WBA A;  3ES7 A;  3CPW Y;  4BBR I;  3UXL A;  3IK4 A;  3SR6 B;  5AN9 F;  3SQP A;  2GL5 A;  4H4V A;  5JCM A;  2J3N A;  3ZLF A;  4A3F I;  4NOZ A;  4KWS A;  2JS4 A;  2JNY A;  2OOX B;  1GRE A;  2W3S A;  3RR1 A;  1N2F A;  1KCZ A;  3NDI A;  4LA1 A;  1XAN A;  3CCM 1;  2VPX A;  1Z01 A;  3GRS A;  2JR6 A;  3EED A;  5IP9 I;  3I55 1;  3CCE 1;  1WYG A;  4DK1 A;  2OO6 A;  1JRO A;  1R0M A;  3CB3 A;  5LL6 f;  2W3R A;  3NVV B;  4HCL A;  1YI2 Z;  1EC8 A;  3S5S A;  3FCP A;  1LQL A;  1K9M 1;  1VQN Z;  3CCS Z;  2AL2 B;  3PG6 A;  1VQM 1;  3KIF A;  2AYD A;  3CQZ I;  3FVD A;  2E7Z A;  3QKE A;  3D46 A;  3SBF A;  3G4S 1;  3CGE A;  2K5R A;  2QAE A;  4H4R A;  4IL2 A;  2GR3 A;  4JDR A;  1NUI A;  1QVF Z;  2VUG A;  2P28 A;  4LII A;  4GME A;  1KC8 2;  4A3C I;  3H70 A;  3Q87 A;  1AA6 A;  2TPR A;  3Q6J A;  1VQK Z;  4KEM A;  1F9C A;  1GRH A;  2GQW A;  2ZC8 A;  3KIH A;  1Q7Y 1;  2G2K A;  2IV2 X;  2I3C A;  3RNM A;  4RS4 A;  4NBC A;  1SJC A;  4YWS A;  7ENL A;  5FS6 A;  3LB8 A;  4ZCW A;  2E3T A;  3BOX A;  3S2D I;  3NVZ B;  1N60 C;  3R1Z A;  2PPG A;  3NVY B;  1YJW Z;  4H4U A;  3H0G I;  5D1O A;  2YVJ A;  1GRB A;  3HPF A;  2BCP A;  4A3E I;  2HZG A;  3G6E Z;  3CXC Z;  1GRF A;  2W55 A;  1RO0 A;  1BQG A;  1MRA A;  3A7R A;  1GES A;  1YJ9 Z;  1ONE A;  4IT1 A;  3B97 A;  3CMA 1;  1OEP A;  1WZN A;  2JIO A;  4A3K I;  3NXL A;  3S15 I;  4IL0 A;  3G71 Z;  2CDU A;  3TQP A;  1X3W A;  2PMQ A;  4APN A;  2QJM A;  1TWF I;  3B9J B;  2BC0 A;  1K73 1;  1I3Q I;  5IT9 b;  1FIQ B;  1GV4 A;  3UCC A;  1SIW A;  3CCU 1;  1X2G A;  2LIY A;  3CC4 1;  3CCS 1;  3SN0 A;  2AKM A;  5IT9 f;  1SJD A;  1RLY A;  3GRT A;  3BG0 B;  3VB9 A;  1FHV A;  1MOK A;  1DNC A;  3MQT A;  5ER0 A;  3AN1 A;  3VMG A;  2VPZ A;  4H4Z A;  2WB1 A;  3H7V A;  2QA4 Z;  5J04 A;  1LVL A;  3IF8 A;  1DXL A;  2VUM I;  3S17 I;  1WW9 A;  1XDI A;  3UGV A;  2KPI A;  2QVH A;  3M4O I;  4GFI A;  1K8A 1;  1TYT A;  2HF1 A;  3FXG A;  2PGW A;  1FDO A;  1TWH I;  2QEX 1;  2GR2 A;  2X50 A;  1OJT A;  3RZO I;  4HCD A;  1ML8 A;  1WII A;  4ENL A;  1L1O C;  3HKZ A;  2P3Z A;  4JN8 A;  5JCK A;  4EWC A;  3CME Z;  1KD0 A;  1WCM I;  3I4N I;  3P93 A;  2OTJ Z;  3GTM S;  3S14 I;  4MH4 A;  4MRI A;  2XSX A;  1BKH A;  5JCL A;  4KPL A;  3IR7 A;  4QTT A;  1Q1R A;  1R9T I;  1YJN Z;  1NPX A;  1YIJ 1;  3DJJ A;  3CC4 Z;  3RZD I;  2WOI A;  1Y1V I;  3QWU A;  1VQL Z;  2R92 I;  3LUS A;  1FHU A;  4TNU A;  3NDJ A;  2WPC A;  3ES8 A;  4HCH A;  3GTP I;  4IHC A;  3GD3 A;  1I50 I;  1RO4 A;  3UJ2 A;  1W6T A;  1M6I A;  4AYB A;  1ZX9 A;  3R11 A;  2V3B A;  3NH5 A;  3UCD A;  3OC4 A;  2R9Z A;  3QLD A;  1GER A;  3PWG A;  2CHR A;  2PP3 A;  3VC6 A;  4ADW A;  4FDC B;  1L8P A;  2IZ4 A;  4EQS A;  2JIR A;  1NHQ A;  3VMH A;  2GR0 A;  3CT2 A;  3FJ4 A;  1YEY A;  3VA8 A;  5BOF A;  3MKC A;  4DHG A;  2PGE A;  2OZT A;  1VQK 1;  3TWA A;  1D7Y A;  4HPN A;  2Q51 A;  1VQ7 1;  3DEQ A;  4Y52 I;  3V4B A;  3JAM f;  5G5H B;  2PS2 A;  3RRA A;  3DK9 A;  2ZZC A;  2GRT A;  2OPJ A;  3CCJ Z;  4FI4 A;  3ZVH B;  1KQS Z;  4H19 A;  3J80 f;  3EKG A;  5FS7 A;  3BG1 B;  3ZVH A;  5JRB A;  5KVH A;  4A6G A;  4G7F A;  1E9I A;  2GGI A;  2PM9 A;  2NVK X;  3V5C A;  1RM6 B;  5C3E I;  4A35 A;  3RIT A;  4DQY B;  2AL2 A;  3QFB A;  3UJF A;  2WPF A;  5FLX f;  2Q4Z A;  2YAD A;  4X6A I;  1FEB A;  2AL1 A;  2HU9 A;  4NEW A;  3TTE A;  2PTY A;  1K4Q A;  2QDE A;  1YIJ Z;  1K8A 2;  3FV9 A;  2Y0S A;  2RHB A;  3R0K A;  3GTL I;  1R6W A;  1NHS A;  2EQ7 A;  4K1W A;  4H2H A;  4E31 A;  2NVY I;  4MMW A;  1YHQ Z;  4EM4 A;  3S1M I;  1VQP Z;  4HGY A;  1MDR A;  3KUM A;  4A3I I;  3CAW A;  1FEC A;  2BC1 A;  3T8Q A;  3N6H A;  2PK7 A;  3AM9 A;  3P5J B;  2OQH A;  2BJO A;  2OQY A;  2POD A;  4A93 I;  1Y8C A;  1P48 A;  3IJL A;  3CCQ Z;  4NB9 A;  1Q86 2;  1P43 A;  2XH7 A;  3QN3 A;  1K73 2;  2PTW A;  3GTJ I;  4K8G A;  3CCQ 1;  3DGB A;  3IFU A;  2NVT I;  4ZOH B;  3F3P C;  1NU5 A;  3H8A A;  2F4O A;  2RIQ A;  3PFR A;  3T9P A;  2ZZB A;  3BJS A;  2LEX A;  3QTP A;  4YWO A;  4BY1 I;  4J57 A;  1TFI A;  2PSN A;  4DWD A;  1BWC A;  4EM3 A;  1VQ9 1;  3CCU Z;  3IC9 A;  4E2X A;  4HN8 A;  4HYR A;  5BOE A;  1VQ4 1;  5C44 I;  1TZZ A;  4ROP A;  3MZK B;  4H4P A;  1QVF Y;  1KQS Y;  3CD6 1;  2ZAD A;  3P0W A;  5C4J I;  4HNC A;  2WAQ A;  2M6N A;  3TOY A;  4E6M A;  1PDZ A;  3VMI A;  5EBK A;  4E8G A;  4EWJ A;  3EMF A;  3PO2 I;  2QJJ A;  4XX2 A;  2JA6 I;  3GD6 A;  1TWA I;  3NZG A;  4BUR A;  3DH9 A;  2KI7 B;  1ZH1 A;  2V6O A;  3SJN A;  4EMW A;  2PCE A;  4RVG A;  1WUE A;  4RVD A;  4NBD A;  3A7U A;  3URH A;  3VTN A;  2VPW A;  4A3G I;  3LXD A;  1PFT A;  2OZ3 A;  3EF6 A;  2EQ6 A;  3L5O A;  4GGB A;  3CMA Z;  4DNA A;  1K83 I;  4DGL A;  2HXT A;  1ZB8 A;  5FLX b;  1VQ8 1;  3ENL A;  4EQW A;  1GRG A;  1ZY8 A;  3UJS A;  3VCC A;  3G6E 1;  3DGZ A;  3CXO A;  1TKK A;  3NFZ A;  4NBA A;  5T67 A;  1Q81 1;  1YUK A;  1NP6 A;  1QVG Y;  3CXB A;  3DES A;  4GRT A;  1LPF A;  4DYE A;  1MNS A;  4EMI A;  5IP7 I;  3CCR 1;  4Y7N I;  4H4T A;  2JIM A;  2W04 A;  1ZMC A;  3I56 Z;  5FJR A;  1AOG A;  3CPW Z;  4G8T A;  4BY7 I;  2R7Z I;  3THU A;  3D47 A;  1GEU A;  2O53 A;  4FP1 A;  4M6U A;  2AKL A;  3I4M I;  1SJB A;  1VQ5 Z;  2OTL Z;  2A8X A;  2PTX A;  1ZKQ A;  3BSM A;  3ZLH A;  3VDG A;  1GRA A;  1Y1V S;  3I55 Z;  3OP2 A;  5IDZ A;  4E32 A;  1TE6 A;  1NDA A;  3N4F A;  2RPR A;  3I56 1;  3UXK A;  3EMI A;  3HRD C;  2DW6 A;  2X8G A;  4H4Q A;  5TR3 A;  3T4N B;  2NVX I;  3GTO I;  4E5T A;  2V45 A;  1VQZ A;  3PO3 S;  1YQZ A;  2QQ6 A;  1TWG I;  3CCE Z;  2B63 I;  3EAO A;  3Q4D A;  4EMJ A;  3J81 b;  3CCM Z;  4FX9 A;  1W2B Z;  2XH4 A;  3OW2 Y;  5FJO A;  1NHP A;  2NAP A;  1MUC A;  1P9N A;  3NO1 A;  1SJA A;  4TVW A;  2GDQ A;  2M48 A;  3R07 C;  2P3Y A;  1N62 C;  3CK5 A;  1ZMD A;  4RVH A;  2AKZ A;  2OZK A;  1VDV A;  3CC2 Z;  1S7M A;  3GTQ I;  3MON A;  5A2Q f;  2ONE A;  3OTR A;  4JN7 A;  1N61 C;  2YAU A;  3TE5 B;  3TDH B;  4H50 A;  4JQ9 A;  3DFY A;  1SB3 B;  1S72 1;  3VC5 A;  1NJI 1;  1WJ2 A;  4MON A;  4HH4 A;  4E2Y A;  3EUB 3;  3CD6 Z;  2GTI A;  1H6V A;  2CFY A;  4DN1 A;  1YJN 1;  4MD8 A;  4H4X A;  3HOZ I;  3S47 A;  4NBF A;  1STZ A;  2PMZ A;  2XH2 A;  2XH0 A;  2NQL A;  2YQU A;  3ZLG A;  1WUF A;  3ZVI A;  2P0I A;  4A3M I;  2GGG A;  5FJU A;  4Z1Y A;  2JK6 A;  4A3L I;  1EC9 A;  3A7A A;  3RGT A;  4DXK A;  2GGH A;  3CME 1;  4RV9 A;  4H4Y A;  2QR1 B;  2OG9 A;  1BZL A;  4IP5 A;  1RVK A;  3H3V J;  2ZZ0 A;  5EU9 A;  3J80 b;  1S72 Z;  2RT9 A;  2NPX A;  2W03 A;  3FQQ A;  4HGZ A;  1EBG A;  2FYM A;  3O0H A;  2GTH A;  2QEX Z;  3GCF A;  2RBL A;  1JEH A;  3QPE A;  4K8D A;  4A3R A;  1F3P A;  3DDM A;  3UJR A;  2H85 A;  2GGE A;  1M1K 2;  3HOY I;  1VQO 1;  2E2H I;  2LFU A;  4J56 A;  2O56 A;  2JIQ A;  1YUA A;  1QYP A;  2OTJ 1;  3TJI A;  3L8K A;  3PK7 A;  3T4W A;  3CCL 1;  4A3D I;  1VQ7 Z;  3FYY A;  4BXX I;  5T64 A;  3S1R I;  1TWC I;  3CC7 1;  2P88 A;  3QFA A;  1KD1 1;  1ECQ A;  2F4M A;  1V59 A;  3NS1 B;  4KPR A;  2V3V A;  1GET A;  1JRP A;  1ZK7 A;  4F4R A;  2QDD A;  2OLA A;  3NH8 A;  1YIT 1;  1K9M 2;  3DIP A;  4A3J I;  1IYX A;  4DX3 A;  1GRT A;  1X2H A;  3RCY A;  2MNR A;  1FDI A;  1X0T A;  4NFR A;  1KC8 1;  2JA5 I;  1NEL A;  2HQM A;  3EEZ A;  3V5F A;  3VCN A;  1H2I A;  1M1K 1;  1YHQ 1;  2GH5 A;  1M90 2;  3OW1 A;  5FS9 A;  1JPM A;  1Q16 A;  2JA7 I;  3MZN A;  3MZL B;  3R0U A;  4K7Z A;  3OW2 Z;  2QGY A;  3ETR B;  3TCS A;  1YJW 1;  1YIT Z;  1QF8 A;  2JA8 I;  3CCR Z;  1N5W C;  1JJ2 Y;  2C3D A;  4CL1 A;  4IZG A;  1JWH C;  1DTN A;  1FFV C;  3R10 A;  5FS8 A;  2QRC B;  3CCL Z;  2GU2 A;  1N8R 2;  3SN1 A;  2V3A A;  1Q82 2;  3CCV 1;  3GC2 A;  3GY1 A;  4BBS I;  3EAN A;  3F3F C;  4S1T A;  1JDF A;  5U1O A;  3D2L A;  2POZ A;  3U9I A;  3MWC A;  2IZ3 A;  2JIP A;  1FFU C;  3G4S Z;  3CC7 Z;  2WPE A;  4H4W A;  4GIR A;  1VQO Z;  1VQ8 Z;  5C4X I;  3NRZ B;  1DL6 A;  2QKD A;  4KT2 A;  2HXU A;  2P8C A;  3Q45 A;  3CGD A;  4H4S A;  3S1Q I;  3II4 A;  3HOV I;  3ESW A;  3DK4 A;  4NBE A;  3MUC A;  5JCN A;  5FLM I;  1KKR A;  1QVG Z;  3NH4 A;  4QTU A;  2C3C A;  5GRT A;  3K7A I;  2QRD B;  3HOX I;  3OZY A;  2V8J A;  1JCT A;  2RAB A;  3HOU I;  2EQ8 A;  1KRL A;  1USP A;  3H4K A;  2XGZ A;  3JW7 A;  2VF1 A;  3S1N I;  3FG2 P;  1JJ2 Z;  3MY9 A;  3G71 1;  4E4U A;  5G5G B;  1Q81 2;  3M3Y I;  3CC2 1;  2GR1 A;  3DGH A;  1W2B Y;  3FQM A;  3R25 A;  2PU1 A;  2ZAE B;  4JHM A;  3SN4 A;  3TW9 A;  1VQ9 Z;  2OVL A;  1I6H I;  2O4H A;  4GGH A;  2WP5 A;  2V8I A; 
#chains in the Genus database with same CATH homology
 5CM2 M;  3HOW I;  3PO3 I;  3GKQ A;  3CCV Z;  2R6M A;  2YVF A;  2QA4 1;  1Q7Y 2;  2WOV A;  1MO9 A;  4RVF A;  1VQ6 1;  2AAQ A;  2WOW A;  1USP B;  3U50 C;  5U25 A;  2WP6 A;  2NVQ I;  2R93 I;  2E2J I;  1NJI 2;  1VQP 1;  4E30 A;  2EGT A;  4GR1 A;  4NBG A;  2X99 A;  3D6W A;  2QRE B;  1JOA A;  1N8R 1;  2V8K A;  3GD4 A;  1ONF A;  1Q1W A;  4BV6 A;  1RQF A;  2DE7 A;  1GXF A;  2J6A A;  4MXU A;  2YVG A;  1ZDL A;  2W0H A;  3EER A;  1F8W A;  1YJ9 1;  1M90 1;  4NBH A;  1FEA A;  2EQ9 A;  4E2Z A;  1NHR A;  1VLA A;  3S16 I;  4EQR A;  3D9X A;  1RNI A;  3J81 f;  2YU9 I;  3FKI I;  3GTK I;  2DE5 A;  4A3B I;  1VQ5 1;  2QLV B;  2OTL 1;  4MD7 A;  2E9H A;  3KLJ A;  2K3R A;  1Y1W I;  5FMH A;  4NH1 C;  1TYP A;  3CCJ 1;  1EBD A;  1KN0 A;  1GSN A;  1SFO I;  5D1O B;  4MD9 A;  5T6B A;  2E2I I;  5JCI A;  3S2H I;  3GTM I;  1Q82 1;  1VQM Z;  2OOY B;  3IX0 A;  4M52 A;  4NEV A;  1RO2 A;  1ZB9 A;  1YI2 1;  3CGC A;  1Q86 1;  3DJG X;  1VQL 1;  3GTG I;  2JMO A;  4NB8 A;  2DE6 A;  2X8C A;  3CGB A;  5D1P A;  3CXC Y;  1Z02 A;  1VQ4 Z;  5A2Q b;  2F5Z A;  4NBB A;  4E2W A;  3DK8 A;  1VQN 1;  2JUB A;  1VQ6 Z;  3J7A 4;  1Z03 A;  5KVI A;  3JAM b;  4E33 A;  2X8H A;  3LAD A;  1X3Z A;  1XHC A;  3I07 A;  1KD1 2;  2WBA A;  3CPW Y;  4BBR I;  5AN9 F;  3SQP A;  4H4V A;  5JCM A;  2J3N A;  4A3F I;  4NOZ A;  2JS4 A;  2OOX B;  2JNY A;  1GRE A;  1N2F A;  3NDI A;  4LA1 A;  1XAN A;  3CCM 1;  1Z01 A;  3GRS A;  2JR6 A;  3EED A;  5IP9 I;  3I55 1;  3CCE 1;  4DK1 A;  5LL6 f;  1YI2 Z;  1LQL A;  1K9M 1;  1VQN Z;  3CCS Z;  3PG6 A;  1VQM 1;  3KIF A;  3CQZ I;  3G4S 1;  3CGE A;  2K5R A;  2QAE A;  4H4R A;  2GR3 A;  4JDR A;  1NUI A;  1QVF Z;  2VUG A;  2P28 A;  4LII A;  1KC8 2;  4A3C I;  3Q87 A;  2TPR A;  3Q6J A;  1VQK Z;  1GRH A;  2GQW A;  3KIH A;  1Q7Y 1;  2G2K A;  2I3C A;  3RNM A;  4RS4 A;  4NBC A;  5FS6 A;  3LB8 A;  3S2D I;  1YJW Z;  4H4U A;  3H0G I;  5D1O A;  2YVJ A;  1GRB A;  2BCP A;  4A3E I;  3G6E Z;  3CXC Z;  1GRF A;  1RO0 A;  1GES A;  1YJ9 Z;  3CMA 1;  4A3K I;  3S15 I;  3G71 Z;  2CDU A;  1X3W A;  4APN A;  1TWF I;  2BC0 A;  1K73 1;  1I3Q I;  5IT9 b;  1GV4 A;  3CCU 1;  2LIY A;  3CC4 1;  3CCS 1;  5IT9 f;  3GRT A;  1RLY A;  3BG0 B;  3VB9 A;  1MOK A;  1DNC A;  5ER0 A;  3VMG A;  4H4Z A;  2WB1 A;  2QA4 Z;  1LVL A;  3IF8 A;  1DXL A;  2VUM I;  3S17 I;  1WW9 A;  1XDI A;  2KPI A;  3M4O I;  1K8A 1;  1TYT A;  2HF1 A;  1TWH I;  2QEX 1;  2GR2 A;  2X50 A;  1OJT A;  3RZO I;  1ML8 A;  1WII A;  1L1O C;  3HKZ A;  5JCK A;  4EWC A;  3CME Z;  1WCM I;  3I4N I;  2OTJ Z;  3GTM S;  3S14 I;  4MH4 A;  4MRI A;  5JCL A;  4QTT A;  1Q1R A;  1R9T I;  1YJN Z;  1NPX A;  1YIJ 1;  3DJJ A;  3CC4 Z;  3RZD I;  2WOI A;  1Y1V I;  1VQL Z;  3QWU A;  2R92 I;  3LUS A;  4TNU A;  3NDJ A;  2WPC A;  3GTP I;  3GD3 A;  1I50 I;  1RO4 A;  1M6I A;  4AYB A;  1ZX9 A;  2V3B A;  3NH5 A;  3OC4 A;  2R9Z A;  1GER A;  4ADW A;  4FDC B;  2IZ4 A;  4EQS A;  1NHQ A;  3VMH A;  2GR0 A;  1VQK 1;  1D7Y A;  2Q51 A;  1VQ7 1;  4Y52 I;  3JAM f;  3DK9 A;  2ZZC A;  2GRT A;  3CCJ Z;  1KQS Z;  3J80 f;  5FS7 A;  3BG1 B;  5JRB A;  5KVH A;  2NVK X;  2PM9 A;  5C3E I;  4DQY B;  3QFB A;  2WPF A;  5FLX f;  2Q4Z A;  2YAD A;  4X6A I;  1FEB A;  2HU9 A;  4NEW A;  1K4Q A;  1YIJ Z;  1K8A 2;  2Y0S A;  2RHB A;  3GTL I;  1NHS A;  2EQ7 A;  4E31 A;  2NVY I;  1YHQ Z;  4EM4 A;  3S1M I;  1VQP Z;  4HGY A;  4A3I I;  1FEC A;  2BC1 A;  2PK7 A;  3P5J B;  2BJO A;  4A93 I;  3CCQ Z;  4NB9 A;  1Q86 2;  1K73 2;  3GTJ I;  3CCQ 1;  3IFU A;  2NVT I;  3F3P C;  2F4O A;  2RIQ A;  2ZZB A;  4YWO A;  4BY1 I;  4J57 A;  1TFI A;  1BWC A;  4EM3 A;  1VQ9 1;  3CCU Z;  3IC9 A;  4E2X A;  1VQ4 1;  5C44 I;  3MZK B;  4H4P A;  1QVF Y;  1KQS Y;  3CD6 1;  5C4J I;  2WAQ A;  2M6N A;  3EMF A;  3VMI A;  5EBK A;  3PO2 I;  4XX2 A;  2JA6 I;  1TWA I;  4BUR A;  3DH9 A;  2KI7 B;  1ZH1 A;  2V6O A;  4EMW A;  4RVG A;  4RVD A;  4NBD A;  3URH A;  3VTN A;  4A3G I;  3LXD A;  1PFT A;  3EF6 A;  2EQ6 A;  3L5O A;  4DNA A;  3CMA Z;  1K83 I;  4DGL A;  1ZB8 A;  5FLX b;  1VQ8 1;  4EQW A;  1GRG A;  1ZY8 A;  3G6E 1;  3DGZ A;  3NFZ A;  4NBA A;  5T67 A;  1Q81 1;  1YUK A;  1NP6 A;  1QVG Y;  4GRT A;  4EMI A;  1LPF A;  5IP7 I;  3CCR 1;  4Y7N I;  4H4T A;  1AOG A;  2W04 A;  1ZMC A;  3I56 Z;  3CPW Z;  4BY7 I;  2R7Z I;  1GEU A;  2O53 A;  2AKL A;  3I4M I;  2A8X A;  1VQ5 Z;  2OTL Z;  1ZKQ A;  1GRA A;  1Y1V S;  3I55 Z;  4E32 A;  1NDA A;  2RPR A;  3I56 1;  3EMI A;  2X8G A;  4H4Q A;  5TR3 A;  3T4N B;  2NVX I;  3GTO I;  1YQZ A;  3PO3 S;  3EAO A;  4EMJ A;  1TWG I;  3CCE Z;  2B63 I;  3J81 b;  3CCM Z;  4FX9 A;  1W2B Z;  3OW2 Y;  1NHP A;  1P9N A;  2M48 A;  2P3Y A;  1ZMD A;  4RVH A;  2OZK A;  3CC2 Z;  1S7M A;  3GTQ I;  3MON A;  5A2Q f;  2YAU A;  3TE5 B;  3TDH B;  4H50 A;  4JQ9 A;  1S72 1;  1NJI 1;  4MON A;  4HH4 A;  4E2Y A;  3CD6 Z;  2GTI A;  1H6V A;  2CFY A;  1YJN 1;  4MD8 A;  4H4X A;  3HOZ I;  4NBF A;  2PMZ A;  2YQU A;  4A3M I;  2JK6 A;  4A3L I;  3CME 1;  4RV9 A;  4H4Y A;  2QR1 B;  1BZL A;  4EQX A;  3H3V J;  2ZZ0 A;  3J80 b;  1S72 Z;  2RT9 A;  2NPX A;  2W03 A;  3FQQ A;  4HGZ A;  3O0H A;  2GTH A;  2QEX Z;  3GCF A;  2RBL A;  1JEH A;  4K8D A;  1F3P A;  2H85 A;  1M1K 2;  3HOY I;  1VQO 1;  2E2H I;  2LFU A;  4J56 A;  1YUA A;  1QYP A;  2OTJ 1;  3L8K A;  3CCL 1;  4A3D I;  1VQ7 Z;  4BXX I;  5T64 A;  3S1R I;  1TWC I;  3CC7 1;  3QFA A;  1KD1 1;  2F4M A;  1V59 A;  4KPR A;  1GET A;  1ZK7 A;  3NH8 A;  1YIT 1;  1K9M 2;  4A3J I;  1GRT A;  1X0T A;  4NFR A;  1KC8 1;  2JA5 I;  2HQM A;  1H2I A;  1M1K 1;  1YHQ 1;  2GH5 A;  1M90 2;  5FS9 A;  2JA7 I;  3MZL B;  4K7Z A;  3OW2 Z;  1YJW 1;  1YIT Z;  1QF8 A;  2JA8 I;  3CCR Z;  2C3D A;  1JJ2 Y;  4CL1 A;  1JWH C;  5FS8 A;  2QRC B;  3CCL Z;  2GU2 A;  1N8R 2;  2V3A A;  1Q82 2;  3CCV 1;  4BBS I;  3EAN A;  3F3F C;  4S1T A;  5U1O A;  2IZ3 A;  3G4S Z;  3CC7 Z;  2WPE A;  4H4W A;  1VQO Z;  1VQ8 Z;  5C4X I;  1DL6 A;  2QKD A;  3CGD A;  4H4S A;  3S1Q I;  3II4 A;  3HOV I;  3ESW A;  3DK4 A;  4NBE A;  5JCN A;  5FLM I;  1QVG Z;  3NH4 A;  4QTU A;  2C3C A;  5GRT A;  3K7A I;  2QRD B;  3HOX I;  2V8J A;  2RAB A;  3HOU I;  2EQ8 A;  1KRL A;  1USP A;  3H4K A;  2VF1 A;  3S1N I;  3FG2 P;  1JJ2 Z;  3G71 1;  1Q81 2;  3M3Y I;  3CC2 1;  2GR1 A;  3DGH A;  1W2B Y;  3FQM A;  2ZAE B;  1VQ9 Z;  1I6H I;  2O4H A;  2WP5 A;  2V8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...