1S7MA

Crystal structure of hiabd1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
158
Chain Sequence
b'GAKTEINKDGLTITPANGAGANNANTISVTKDGISAGGQSVKNVVSGLKKFGDANFDPLTSSADNLTKQNDDAYKGLTNLDEKGTDKQTPVVADNTAATVGDLRGLGWVISADKTTGGSTEYHDQVRNANEVKFKSGNGINVSGKTVNGRREITFELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hia
publication title Structural basis for host recognition by the Haemophilus influenzae Hia autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
total genus 27
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15403 HiaBD2 HiaBD2_N domain of Trimeric autotransporter adhesin (GIN)
A PF18669 Trp_ring Trimeric autotransporter adhesin Trp ring domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.140 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s7mA03
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1s7mA01
3.90.1780.10 Alpha Beta Alpha-Beta Complex Trimeric adhesin Trimeric adhesin 1s7mA02
3EMFA 3EMIA 1S7MA 3D9XA
chains in the Genus database with same CATH superfamily
1M1K1 1V59A 3STPA 3CC7Z 3CC21 2PPGA 3EMIA 4QTUA 2E2JI 5JCLA 2F4OA 3CCEZ 2NAPA 4JHMA 3GTKI 3SBFA 4GYPA 2P3YA 5IT9f 4HN8A 4EM3A 2OX4A 1JROA 2RT9A 3NO1A 3DG3A 3UJ2A 3V5FA 1TWFI 3KIHA 4HPNA 2JA7I 1Q16A 2OOYB 1AA6A 1MDLA 3PK7A 4F4RA 2QR1B 1YIJ1 2FYMA 3R10A 3TW9A 4IL0A 2HF1A 4EWCA 2POZA 1LQLA 3VC5A 2GRTA 3IFUA 3TCSA 3DJGX 2NVKX 4NEVA 3CC2Z 1ZMDA 2PP3A 3TJIA 2I3CA 4BBRI 2AL2B 4KPRA 3CCQ1 3DG7A 2F5ZA 4A3DI 3DFYA 3FV9A 3MKCA 1XS2A 3RCYA 4EQRA 1USPB 3V5CA 4BXXI 4K8GA 1KC82 1K8A2 2OKTA 2P8BA 3HPFA 1EBHA 4J3ZA 1YUAA 3SJNA 1N60C 4NOZA 1JPDX 3H0GI 3CYJA 1GESA 3TTEA 2LIYA 3HOYI 2M6NA 3KUMA 3MZNA 1BZLA 2OTJ1 3PWGA 3AN1A 1GXFA 1DXLA 3NVZB 4GGBA 3IF8A 3GTJI 2Y0SA 4J57A 3NZGA 1L8PA 1GREA 3UXKA 2DW6A 3FQMA 3J80b 1S721 1W2BY 1GRFA 2PODA 3FYYA 1H6VA 3ES8A 4A3GI 3OPSA 2GR2A 1K9M2 2QKDA 2JIOA 1VQ81 5ER0A 4E2YA 5U1OA 5JCMA 3UJRA 3D47A 2QA41 1N61C 4H2HA 2PK7A 3HOVI 2QJMA 4EQSA 2OLAA 1WJ2A 4E2ZA 1Y8CA 2NVQI 4GGHA 4M52A 3T9PA 2OTJZ 4FDCB 1OJTA 4AYBA 1Q1WA 1ONEA 1NDAA 2X8HA 3QLDA 4X6AI 2NVTI 3LUSA 2GR3A 4A3CI 4CL1A 1FFVC 1GEUA 4ZA0A 4KT2A 3RITA 1VQ4Z 3IC9A 3F3PC 2W03A 3VB9A 1S72Z 3VFCA 3ZLGA 3S2HI 1Q822 1M901 1VQ61 4GMEA 2JMOA 2NPXA 3TDHB 5IT9b 3B9JB 4YWSA 1VQ8Z 4Y52I 2MUCA 2XH0A 4G7FA 4E4UA 2QA4Z 3DEQA 3FVDA 1GV4A 2YADA 3MZKB 3CPWY 1ZKQA 2GGEA 1RO2A 3CMA1 3EMFA 2P88A 2VPZA 1MRAA 4A3BI 1VDVA 2PMZA 4GFIA 5BOFA 3UJEA 3S1NI 4M0XA 1YJW1 1K731 5C4XI 1NU5A 1ONFA 5IP7I 4MGGA 1ZY8A 4H4RA 2ZC8A 4H1ZA 1VQZA 5T6BA 3OZYA 2E5AA 1RNIA 1DL6A 3SQPA 2WBAA 1VQ6Z 4JDRA 4JN7A 1DTNA 2PSNA 4KWSA 2JR6A 3RZOI 3ZVIA 3VMIA 2AKLA 4RVFA 3NS1B 2G2KA 3CCM1 3PFRA 2X50A 5J04A 3CMAZ 1DNCA 3NFZA 1FHUA 3TOYA 2JIPA 2QREB 3NH5A 2GTIA 2V6OA 1NJI1 1YJWZ 5C44I 4GRTA 2YVJA 2PGEA 3M3YI 2V3BA 3DGZA 3O0HA 2GR0A 1VQM1 3TWAA 1EC7A 5FS8A 1VQ71 1LVLA 2GGHA 3CCJ1 3CT2A 4NBAA 4BV6A 3CXBA 3FKII 4HNLA 1FEBA 2R93I 3HOUI 1SJDA 2HXUA 3UXLA 5FMHA 1WZNA 3J80f 3NDIA 3EERA 3KLJA 2YAUA 4A35A 3SSZA 2ZADA 3CCMZ 3ZVHA 3CGBA 2GSHA 3T8QA 3CPWZ 3EUB3 4HCDA 5GRTA 1NPXA 2OZ3A 4YWOA 2V8KA 1YJN1 2QGYA 2M48A 4DXKA 1VQMZ 3MZLB 2VPYA 1R0MA 1WUEA 1VQ7Z 5BOEA 2XSXA 3CCJZ 2NVYI 1TWCI 4E8GA 5G5GB 3NH4A 2O53A 1D7YA 3CCR1 2PTXA 1ZMCA 1QYPA 1FDIA 1NUIA 2NVXI 3OZMA 1ZH1A 1SJAA 2ZZCA 4ADWA 2QDDA 3LB8A 2X8CA 5C3EI 3CCV1 3ESWA 7ENLA 5FS7A 2GGGA 3UJFA 3DERA 1KC81 1K8A1 1P9NA 1YUKA 2JA8I 3S17I 3VCNA 2A8XA 3OC4A 3F3FC 4NBEA 2Q51A 3KIFA 3EKGA 4K1WA 2OG9A 4M6UA 2AYDA 2BJOA 5D1OB 2WPCA 3J7A4 1JEHA 3IR7A 2V3VA 1VLAA 2R7ZI 1EC8A 2W04A 4JN8A 4IP5A 3U50C 2WOIA 1GRHA 2YU9I 2OQYA 2X99A 3CGCA 5ENLA 3CXCZ 3AMZA 3K7AI 4GIRA 4A3II 4A93I 3CCRZ 1WYGA 3MUCA 3T6CA 2YVFA 3CCL1 1KCZA 4J56A 1VQ51 4DQYB 1TZZA 2V45A 4JQ9A 3D46A 2J3NA 1Y1VI 5FLMI 1SFOI 3UCCA 1MUCA 4NBDA 3CCVZ 1K9M1 2PCEA 4FX9A 2JIMA 2P8CA 3DK4A 2AL2A 4ZOHB 2W3SA 3QFBA 3P0WA 4H4QA 1USPA 3H3VJ 3NVWB 5FJPA 5LL6f 1Y1VS 2YQUA 4NEWA 2ZAEB 1YIJZ 1Z02A 3GD3A 2JA5I 1YJ91 2HQMA 2HXTA 3QKEA 2GGJA 1GRTA 4IL2A 3ZLHA 1N62C 3H70A 3P5JB 3IK4A 3CCLZ 2E9HA 2KPIA 4E2XA 1VQ5Z 1Q821 1MOKA 2C3DA 3CCQZ 1F3PA 1TWAI 4ROPA 5FS9A 1X3WA 1Y1WI 3GRTA 3CCU1 5JCKA 3JW7A 2RBLA 3IX0A 2IV2X 1OEPA 4MXUA 4A3FI 3ES7A 3R1ZA 1WCMI 2V8IA 4H50A 2OTL1 1GRGA 1JJ2Z 3SN0A 4K8DA 2QLVB 1YHQ1 3M4OI 3OW1A 4H4TA 4NH1C 3N6JA 4EQXA 3MONA 5A2Qb 5JCIA 2JUBA 2PGWA 3N4EA 5IP9I 2F4MA 3SN1A 3D2LA 3ZLFA 1N8R2 3MY9A 2QDEA 3BG0B 3ENLA 3CME1 2WP6A 3RRAA 1TYTA 2FKPA 2QRCB 2B63I 2OVLA 3CCUZ 2E2II 1EBGA 3P93A 2OZTA 5FS6A 1SJCA 1ELSA 3FXGA 4J1OA 3CD61 3L5OA 3TWBA 4DHGA 1E9IA 2OTLZ 1F9CA 3JAMb 1S7MA 3ETRB 1NP6A 4A3JI 2P0IA 3GY1A 2K5RA 1FDOA 2GU2A 3FCPA 4H4UA 2HU9A 4MD7A 3EEZA 3VCCA 3D9XA 3DK9A 3EF6A 2QAEA 3VDGA 1RO4A 2QEX1 2VPWA 1YIT1 4BY1I 1JDFA 1SJBA 1Q7Y2 4H83A 5JRBA 3CMEZ 1ZB9A 1KKOA 1RLYA 2XH4A 1KD12 4A3MI 3G711 2CDUA 1K4QA 4DNAA 4QTTA 1BKHA 3DIPA 3CAWA 1JRPA 3H8AA 3CD6Z 2VUMI 3GTMI 1VQN1 3GRSA 1P48A 1H2IA 2KI7B 3GTOI 3CC41 2OOXB 4A3LI 1V97A 2WPFA 3IJLA 1Z01A 4NBBA 2WOWA 3T4NB 1I6HI 2DW7A 2EQ9A 1Q812 4HH4A 4A3RA 6ENLA 1MO9A 1ZXIC 3CXCY 5JCNA 1Q1RA 3GTMS 2QEXZ 2GL5A 1YITZ 3CK5A 3GD6A 4RVDA 4H4VA 4E33A 4IT1A 3OW2Z 3G71Z 2I5QA 3HOZI 1K83I 2PMQA 4NB9A 1ZDLA 1JPMA 1VQO1 1TYPA 1FECA 1FO4A 2MNRA 4NB8A 1RO0A 3CCS1 3QN3A 4H4ZA 4DN1A 2JK6A 1VQL1 1GERA 3FG2P 1FFUC 2PU0A 3I561 1XHCA 2BCPA 3OTRA 3I6TA 3CC4Z 1TFIA 3S1MI 1NHQA 1EC9A 4H4YA 3BG1B 1KRLA 1PDYA 3EANA 3NH8A 3S14I 2PTWA 3JZUA 3MQTA 1X0TA 5A2Qf 2C3CA 3HOWI 5G5HB 3SR6B 3CC71 4EM4A 1YI21 3G6E1 3TJ4A 1QF8A 5T67A 1VQOZ 4NBCA 1T3QC 3EEDA 4EMIA 2IZ3A 1NHSA 4NBFA 4GISA 5EU9A 3NXLA 4Z1YA 5U25A 3CCSZ 4TVYA 3DGHA 2W55A 3UGVA 3DJJA 2BC1A 2P3ZA 4HGZA 1BQGA 3NVYB 4DYEA 3D6WA 2GGIA 2PS2A 3I4NI 2JNYA 3MWCA 1N2FA 2K3RA 1JOAA 1JJ2Y 3GTQI 1YJNZ 1XANA 1XDIA 3PWIA 2WP5A 4E4FA 1FEAA 3BOXA 3JAMf 5FLXb 3II4A 4NFRA 1FIQB 5TR3A 2JS4A 2EQ6A 2GH5A 2OO6A 1N63C 5D1OA 3DDMA 3QWUA 2GQWA 4E6MA 5C4JI 2WB1A 3RNMA 3JVAA 4MKSA 5D1PA 4RS4A 4ENLA 2NQLA 3HW2A 4A3EI 3G6EZ 1YI2Z 1Z03A 1NHRA 4Y7NI 3GTGI 1QVFZ 4EMWA 1N5WC 1X2HA 4K2SA 2H85A 2CHRA 4LIIA 2GTHA 2R6MA 2JIQA 4MRIA 3S1QI 1RM6B 3Q45A 1TWGI 1R9TI 3RR1A 3OP2A 3H7VA 1Q862 3Q87A 3Q6JA 3PO2I 4MH4A 2OZ8A 3BSMA 4H4PA 4HCHA 3QPEA 3U9IA 2PTZA 4IZGA 4ZCWA 1LPFA 4DWDA 3R0UA 1W6TA 2PP1A 3FQQA 1N5XA 3VA8A 1ZX9A 1QVGZ 2EQ7A 4EQWA 2RPRA 4K7ZA 4IP4A 1M1K2 2ZZ0A 1N8R1 3TE5B 2AKMA 2BC0A 4NBGA 3SQSA 4HYRA 4RVHA 4IHCA 2EQ8A 2AAQA 2PP0A 1ZB8A 1ECQA 2PU1A 3G4S1 2X8GA 4KPLA 2LEXA 2PA6A 1VQ91 1TKKA 4EMJA 4MD8A 1KN0A 3H12A 3TQPA 1WW9A 4H4WA 1YJ9Z 3UCDA 3VMGA 2JA6I 4NBHA 2RIQA 1I3QI 2O56A 3IJQA 4DGLA 3QFAA 2R92I 2GDQA 3CGDA 3Q4DA 4TVWA 4HCLA 1VQ41 1NELA 3LXDA 4E31A 2HNEA 1I50I 4RV9A 1Q7Y1 2AKZA 2R9ZA 3OW2Y 4MD9A 2QJJA 3V4BA 4A6GA 3A7AA 1XPYA 4MONA 1KD11 2OPJA 1SB3B 3QTPA 3G4SZ 1JWHC 2RHBA 4DK1A 1MNSA 2RDXA 3PO3I 4E2WA 1ML8A 3RZDI 3J81b 1VQK1 3I4MI 3U4FA 1GRBA 3V3WA 1VQ9Z 1X3ZA 2DE5A 1BWCA 3HOXI 3NFUA 3T4WA 3DESA 3THUA 1YHQZ 4A3KI 4DX3A 3DK8A 3A7UA 3AM9A 3GD4A 5IDZA 4XX2A 1MDRA 5KVIA 3PO3S 1FHVA 2J6AA 2JIRA 1EBDA 3NVVB 4H19A 4APNA 4HGYA 2VPXA 5FLXf 1Q811 2WOVA 5FJRA 1WUFA 1RVKA 2CFYA 5FJTA 3DH9A 3I551 5T64A 4FP1A 3GC2A 3K1GA 3CXOA 4GR1A 2V3AA 4H4SA 3RGTA 5CM2M 3GCFA 3I6EA 3R07C 2W3RA 2QQ6A 4GYPC 3GKQA 1VQP1 3VTNA 2WPEA 1KQSY 3S5SA 1GRAA 1VQKZ 2ZZBA 3EAOA 1RQFA 2IZ4A 4H4XA 5KVHA 4E30A 2W54A 3S15I 1GETA 4X2PA 4HNCA 1YQZA 2QJNA 3LADA 3N4FA 1M6IA 4KEMA 2YVGA 1TWHI 2OZKA 5FJOA 1F8WA 2OQHA 3VMHA 2E2HI 2PTYA 3NRZB 3R11A 4E5TA 2GR1A 3CQZI 1R6WA 3BJSA 3S47A 3R0KA 5FJUA 4BBSI 1JCTA 1W2BZ 1M902 3I55Z 3H4KA 3N6HA 2LFUA 3RO6A 1PDZA 1QVFY 5AN9F 1GSNA 3GTLI 1VQPZ 2VF1A 3CGEA 3I4KA 2HZGA 3MSYA 4MMWA 4RVGA 2ONEA 4FI4A 1VQNZ 3IJIA 1L1OC 3FJ4A 3SN4A 3DG6A 4Z17A 1K732 1X2GA 4E32A 2EGTA 3S2DI 1SIWA 4BY7I 2E7ZA 3NDJA 4EWJA 2VUGA 3A7RA 2E3TA 1QVGY 4S1TA 1PFTA 5EBKA 3R25A 1IYXA 1ZK7A 2PM9A 2O4HA 1WIIA 3S1RI 2OFJA 3UJSA 2Q4ZA 1STZA 3ZVHB 3HKZA 3CCE1 2QVHA 4BURA 2W0HA 3PG6A 4G8TA 3GO2A 1KQSZ 3HRDC 1TE6A 3VC6A 1VQLZ 2QRDB 3GTPI 2V8JA 3P3BA 3I56Z 3CB3A 2XH7A 3J81f 3S16I 1Q861 1QXFA 1NJI2 1KKRA 3DGBA 4LA1A 2AL1A 3DFHA 1P43A 2DE7A 2WAQA 2XGZA 3L8KA 2RABA 3B97A 1KD0A 2P28A 2XH2A 1YEYA 1AOGA 4TNUA 2TPRA 3URHA 2DE6A 1NHPA 3I07A
chains in the Genus database with same CATH topology
1M1K1 1V59A 3EMIA 3CC7Z 3CC21 4QTUA 2E2JI 5JCLA 2F4OA 3CCEZ 3GTKI 2P3YA 5IT9f 4EM3A 2RT9A 1TWFI 3KIHA 2JA7I 2OOYB 2QR1B 1YIJ1 2HF1A 4EWCA 1LQLA 2GRTA 3IFUA 3DJGX 2NVKX 4NEVA 3CC2Z 1ZMDA 2I3CA 4BBRI 4KPRA 3CCQ1 2F5ZA 4A3DI 4EQRA 1USPB 4BXXI 1KC82 1K8A2 1YUAA 4NOZA 3H0GI 1GESA 2LIYA 3HOYI 2M6NA 1BZLA 2OTJ1 1GXFA 1DXLA 3IF8A 3GTJI 2Y0SA 4J57A 1GREA 3FQMA 3J80b 1S721 1W2BY 1GRFA 1H6VA 4A3GI 2GR2A 1K9M2 2QKDA 1VQ81 5ER0A 4E2YA 5U1OA 5JCMA 2QA41 4EQSA 2PK7A 3HOVI 4E2ZA 2NVQI 4M52A 2OTJZ 4FDCB 1OJTA 4AYBA 1Q1WA 1NDAA 2X8HA 4X6AI 2NVTI 3LUSA 2GR3A 4A3CI 4CL1A 1GEUA 1VQ4Z 3IC9A 3F3PC 2W03A 3VB9A 1S72Z 3S2HI 1Q822 1M901 1VQ61 2JMOA 2NPXA 3TDHB 5IT9b 1VQ8Z 4Y52I 2QA4Z 1GV4A 2YADA 3MZKB 3CPWY 1ZKQA 3EMFA 1RO2A 3CMA1 4A3BI 2PMZA 3S1NI 1YJW1 1K731 5C4XI 1ONFA 5IP7I 1ZY8A 4H4RA 5T6BA 1RNIA 1DL6A 3SQPA 2WBAA 1VQ6Z 4JDRA 2JR6A 3RZOI 3VMIA 2AKLA 4RVFA 2G2KA 3CCM1 2X50A 3CMAZ 1DNCA 3NFZA 2QREB 3NH5A 2GTIA 2V6OA 1NJI1 1YJWZ 5C44I 4GRTA 2YVJA 2V3BA 3M3YI 3DGZA 3O0HA 2GR0A 1VQM1 5FS8A 1VQ71 1LVLA 4BV6A 3CCJ1 4NBAA 3FKII 1FEBA 2R93I 3HOUI 5FMHA 3J80f 3NDIA 3EERA 3KLJA 2YAUA 3CCMZ 3CGBA 3CPWZ 5GRTA 1NPXA 4YWOA 2V8KA 1YJN1 2M48A 1VQMZ 3MZLB 1VQ7Z 3CCJZ 2NVYI 1TWCI 3NH4A 2O53A 1D7YA 3CCR1 1ZMCA 1QYPA 1NUIA 2NVXI 1ZH1A 2ZZCA 4ADWA 3LB8A 2X8CA 5C3EI 3CCV1 3ESWA 5FS7A 1KC81 1K8A1 1P9NA 1YUKA 2JA8I 3S17I 2A8XA 3OC4A 3F3FC 4NBEA 2Q51A 3KIFA 2BJOA 5D1OB 2WPCA 3J7A4 1JEHA 1VLAA 2R7ZI 2W04A 3U50C 2WOIA 1GRHA 2YU9I 2X99A 3CGCA 3CXCZ 3K7AI 4A3II 4A93I 3CCRZ 2YVFA 3CCL1 4J56A 1VQ51 4DQYB 4JQ9A 2J3NA 1Y1VI 5FLMI 1SFOI 4NBDA 3CCVZ 1K9M1 4FX9A 3DK4A 3QFBA 4H4QA 1USPA 3H3VJ 5LL6f 1Y1VS 2YQUA 4NEWA 2ZAEB 1YIJZ 1Z02A 3GD3A 2JA5I 1YJ91 2HQMA 1GRTA 3P5JB 3CCLZ 2E9HA 2KPIA 4E2XA 1VQ5Z 1Q821 1MOKA 2C3DA 3CCQZ 1F3PA 1TWAI 5FS9A 1X3WA 1Y1WI 3GRTA 3CCU1 5JCKA 2RBLA 3IX0A 4MXUA 4A3FI 1WCMI 2V8IA 4H50A 2OTL1 1GRGA 1JJ2Z 4K8DA 2QLVB 1YHQ1 3M4OI 4H4TA 4NH1C 4EQXA 3MONA 5A2Qb 5JCIA 2JUBA 5IP9I 2F4MA 1N8R2 3BG0B 3CME1 2WP6A 1TYTA 2QRCB 2B63I 3CCUZ 2E2II 5FS6A 3CD61 3L5OA 2OTLZ 3JAMb 1S7MA 1NP6A 4A3JI 2K5RA 2GU2A 4H4UA 2HU9A 4MD7A 3D9XA 3DK9A 3EF6A 2QAEA 1RO4A 2QEX1 5JRBA 1YIT1 4BY1I 1Q7Y2 3CMEZ 1ZB9A 1RLYA 1KD12 4A3MI 3G711 2CDUA 1K4QA 4DNAA 4QTTA 3CD6Z 2VUMI 3GTMI 1VQN1 3GRSA 1H2IA 2KI7B 3GTOI 3CC41 2OOXB 4A3LI 2WPFA 1Z01A 4NBBA 2WOWA 3T4NB 1I6HI 2EQ9A 1Q812 4HH4A 1MO9A 3CXCY 5JCNA 1Q1RA 3GTMS 2QEXZ 1YITZ 4H4VA 4RVDA 4E33A 3OW2Z 3G71Z 3HOZI 1K83I 4NB9A 1ZDLA 1VQO1 1TYPA 1FECA 4NB8A 1RO0A 3CCS1 4H4ZA 2JK6A 1VQL1 1GERA 3FG2P 3I561 1XHCA 2BCPA 3CC4Z 1TFIA 3S1MI 1NHQA 4H4YA 3BG1B 1KRLA 3EANA 3NH8A 3S14I 1X0TA 5A2Qf 2C3CA 3HOWI 3CC71 4EM4A 1YI21 3G6E1 1QF8A 5T67A 1VQOZ 4NBCA 3EEDA 4EMIA 2IZ3A 1NHSA 4NBFA 5U25A 3CCSZ 3DGHA 3DJJA 2BC1A 4HGZA 3D6WA 3I4NI 2JNYA 1N2FA 2K3RA 1JOAA 1JJ2Y 3GTQI 1YJNZ 1XANA 1XDIA 2WP5A 1FEAA 3JAMf 5FLXb 3II4A 4NFRA 5TR3A 2JS4A 2EQ6A 2GH5A 5D1OA 3QWUA 2GQWA 2WB1A 5C4JI 3RNMA 5D1PA 4RS4A 4A3EI 3G6EZ 1YI2Z 1Z03A 1NHRA 4Y7NI 3GTGI 1QVFZ 4EMWA 2H85A 4LIIA 2GTHA 2R6MA 4MRIA 3S1QI 1TWGI 1R9TI 3Q6JA 1Q862 3Q87A 4H4PA 3PO2I 4MH4A 1LPFA 3FQQA 1ZX9A 1QVGZ 2EQ7A 4EQWA 2RPRA 4K7ZA 1M1K2 2ZZ0A 1N8R1 3TE5B 2BC0A 4NBGA 4RVHA 2EQ8A 2AAQA 1ZB8A 3G4S1 2X8GA 1VQ91 4EMJA 4MD8A 1KN0A 1WW9A 4H4WA 1YJ9Z 3VMGA 2JA6I 4NBHA 2RIQA 1I3QI 3QFAA 5EBKA 4DGLA 2R92I 3CGDA 1VQ41 3LXDA 4E31A 1I50I 4RV9A 1Q7Y1 2R9ZA 3OW2Y 4MD9A 4MONA 1KD11 3G4SZ 1JWHC 2RHBA 4DK1A 3PO3I 4E2WA 1ML8A 3RZDI 3J81b 1VQK1 3I4MI 1GRBA 1VQ9Z 1X3ZA 2DE5A 1BWCA 3HOXI 1YHQZ 4A3KI 3DK8A 3GD4A 4XX2A 5KVIA 3PO3S 4APNA 2J6AA 1EBDA 4HGYA 1Q811 5FLXf 2WOVA 2CFYA 3DH9A 3I551 5T64A 4GR1A 4H4SA 2V3AA 5CM2M 3GCFA 3GKQA 1VQP1 3VTNA 2WPEA 1KQSY 1GRAA 1VQKZ 2ZZBA 3EAOA 1RQFA 2IZ4A 4H4XA 5KVHA 4E30A 3S15I 1GETA 1YQZA 3LADA 1M6IA 2YVGA 1TWHI 2OZKA 1F8WA 3VMHA 2E2HI 2GR1A 3CQZI 4BBSI 1W2BZ 1M902 3I55Z 3H4KA 2LFUA 1QVFY 5AN9F 1GSNA 3GTLI 1VQPZ 2VF1A 3CGEA 4RVGA 1VQNZ 1L1OC 1K732 4E32A 2EGTA 3S2DI 4BY7I 3NDJA 2VUGA 1QVGY 4S1TA 1PFTA 1ZK7A 2PM9A 2O4HA 1WIIA 3S1RI 2Q4ZA 3HKZA 3CCE1 4BURA 2W0HA 3PG6A 1KQSZ 1VQLZ 2QRDB 3GTPI 2V8JA 3I56Z 3J81f 3S16I 1Q861 1NJI2 4LA1A 2DE7A 2WAQA 3L8KA 2RABA 2P28A 1AOGA 4TNUA 2TPRA 3URHA 2DE6A 1NHPA 3I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMF A;  3EMI A;  1S7M A;  3D9X A; 
#chains in the Genus database with same CATH topology
 1M1K 1;  1V59 A;  3STP A;  3CC7 Z;  3CC2 1;  2PPG A;  3EMI A;  4QTU A;  2E2J I;  5JCL A;  2F4O A;  3CCE Z;  2NAP A;  4JHM A;  3GTK I;  3SBF A;  4GYP A;  2P3Y A;  5IT9 f;  4HN8 A;  4EM3 A;  2OX4 A;  1JRO A;  2RT9 A;  3NO1 A;  3DG3 A;  3UJ2 A;  3V5F A;  1TWF I;  3KIH A;  4HPN A;  2JA7 I;  1Q16 A;  2OOY B;  1AA6 A;  1MDL A;  3PK7 A;  4F4R A;  2QR1 B;  1YIJ 1;  2FYM A;  3R10 A;  3TW9 A;  4IL0 A;  2HF1 A;  4EWC A;  2POZ A;  1LQL A;  3VC5 A;  2GRT A;  3IFU A;  3TCS A;  3DJG X;  2NVK X;  4NEV A;  3CC2 Z;  1ZMD A;  2PP3 A;  3TJI A;  2I3C A;  4BBR I;  2AL2 B;  4KPR A;  3CCQ 1;  3DG7 A;  2F5Z A;  4A3D I;  3DFY A;  3FV9 A;  3MKC A;  1XS2 A;  3RCY A;  4EQR A;  1USP B;  3V5C A;  4BXX I;  4K8G A;  1KC8 2;  1K8A 2;  2OKT A;  2P8B A;  3HPF A;  1EBH A;  4J3Z A;  1YUA A;  3SJN A;  1N60 C;  4NOZ A;  1JPD X;  3H0G I;  3CYJ A;  1GES A;  3TTE A;  2LIY A;  3HOY I;  2M6N A;  3KUM A;  3MZN A;  1BZL A;  2OTJ 1;  3PWG A;  3AN1 A;  1GXF A;  1DXL A;  3NVZ B;  4GGB A;  3IF8 A;  3GTJ I;  2Y0S A;  4J57 A;  3NZG A;  1L8P A;  1GRE A;  3UXK A;  2DW6 A;  3FQM A;  3J80 b;  1S72 1;  1W2B Y;  1GRF A;  2POD A;  3FYY A;  1H6V A;  3ES8 A;  4A3G I;  3OPS A;  2GR2 A;  1K9M 2;  2QKD A;  2JIO A;  1VQ8 1;  5ER0 A;  4E2Y A;  5U1O A;  5JCM A;  3UJR A;  3D47 A;  2QA4 1;  1N61 C;  4H2H A;  2PK7 A;  3HOV I;  2QJM A;  4EQS A;  2OLA A;  1WJ2 A;  4E2Z A;  1Y8C A;  2NVQ I;  4GGH A;  4M52 A;  3T9P A;  2OTJ Z;  4FDC B;  1OJT A;  4AYB A;  1Q1W A;  1ONE A;  1NDA A;  2X8H A;  3QLD A;  4X6A I;  2NVT I;  3LUS A;  2GR3 A;  4A3C I;  4CL1 A;  1FFV C;  1GEU A;  4ZA0 A;  4KT2 A;  3RIT A;  1VQ4 Z;  3IC9 A;  3F3P C;  2W03 A;  3VB9 A;  1S72 Z;  3VFC A;  3ZLG A;  3S2H I;  1Q82 2;  1M90 1;  1VQ6 1;  4GME A;  2JMO A;  2NPX A;  3TDH B;  5IT9 b;  3B9J B;  4YWS A;  1VQ8 Z;  4Y52 I;  2MUC A;  2XH0 A;  4G7F A;  4E4U A;  2QA4 Z;  3DEQ A;  3FVD A;  1GV4 A;  2YAD A;  3MZK B;  3CPW Y;  1ZKQ A;  2GGE A;  1RO2 A;  3CMA 1;  3EMF A;  2P88 A;  2VPZ A;  1MRA A;  4A3B I;  1VDV A;  2PMZ A;  4GFI A;  5BOF A;  3UJE A;  3S1N I;  4M0X A;  1YJW 1;  1K73 1;  5C4X I;  1NU5 A;  1ONF A;  5IP7 I;  4MGG A;  1ZY8 A;  4H4R A;  2ZC8 A;  4H1Z A;  1VQZ A;  5T6B A;  3OZY A;  2E5A A;  1RNI A;  1DL6 A;  3SQP A;  2WBA A;  1VQ6 Z;  4JDR A;  4JN7 A;  1DTN A;  2PSN A;  4KWS A;  2JR6 A;  3RZO I;  3ZVI A;  3VMI A;  2AKL A;  4RVF A;  3NS1 B;  2G2K A;  3CCM 1;  3PFR A;  2X50 A;  5J04 A;  3CMA Z;  1DNC A;  3NFZ A;  1FHU A;  3TOY A;  2JIP A;  2QRE B;  3NH5 A;  2GTI A;  2V6O A;  1NJI 1;  1YJW Z;  5C44 I;  4GRT A;  2YVJ A;  2PGE A;  3M3Y I;  2V3B A;  3DGZ A;  3O0H A;  2GR0 A;  1VQM 1;  3TWA A;  1EC7 A;  5FS8 A;  1VQ7 1;  1LVL A;  2GGH A;  3CCJ 1;  3CT2 A;  4NBA A;  4BV6 A;  3CXB A;  3FKI I;  4HNL A;  1FEB A;  2R93 I;  3HOU I;  1SJD A;  2HXU A;  3UXL A;  5FMH A;  1WZN A;  3J80 f;  3NDI A;  3EER A;  3KLJ A;  2YAU A;  4A35 A;  3SSZ A;  2ZAD A;  3CCM Z;  3ZVH A;  3CGB A;  2GSH A;  3T8Q A;  3CPW Z;  3EUB 3;  4HCD A;  5GRT A;  1NPX A;  2OZ3 A;  4YWO A;  2V8K A;  1YJN 1;  2QGY A;  2M48 A;  4DXK A;  1VQM Z;  3MZL B;  2VPY A;  1R0M A;  1WUE A;  1VQ7 Z;  5BOE A;  2XSX A;  3CCJ Z;  2NVY I;  1TWC I;  4E8G A;  5G5G B;  3NH4 A;  2O53 A;  1D7Y A;  3CCR 1;  2PTX A;  1ZMC A;  1QYP A;  1FDI A;  1NUI A;  2NVX I;  3OZM A;  1ZH1 A;  1SJA A;  2ZZC A;  4ADW A;  2QDD A;  3LB8 A;  2X8C A;  5C3E I;  3CCV 1;  3ESW A;  7ENL A;  5FS7 A;  2GGG A;  3UJF A;  3DER A;  1KC8 1;  1K8A 1;  1P9N A;  1YUK A;  2JA8 I;  3S17 I;  3VCN A;  2A8X A;  3OC4 A;  3F3F C;  4NBE A;  2Q51 A;  3KIF A;  3EKG A;  4K1W A;  2OG9 A;  4M6U A;  2AYD A;  2BJO A;  5D1O B;  2WPC A;  3J7A 4;  1JEH A;  3IR7 A;  2V3V A;  1VLA A;  2R7Z I;  1EC8 A;  2W04 A;  4JN8 A;  4IP5 A;  3U50 C;  2WOI A;  1GRH A;  2YU9 I;  2OQY A;  2X99 A;  3CGC A;  5ENL A;  3CXC Z;  3AMZ A;  3K7A I;  4GIR A;  4A3I I;  4A93 I;  3CCR Z;  1WYG A;  3MUC A;  3T6C A;  2YVF A;  3CCL 1;  1KCZ A;  4J56 A;  1VQ5 1;  4DQY B;  1TZZ A;  2V45 A;  4JQ9 A;  3D46 A;  2J3N A;  1Y1V I;  5FLM I;  1SFO I;  3UCC A;  1MUC A;  4NBD A;  3CCV Z;  1K9M 1;  2PCE A;  4FX9 A;  2JIM A;  2P8C A;  3DK4 A;  2AL2 A;  4ZOH B;  2W3S A;  3QFB A;  3P0W A;  4H4Q A;  1USP A;  3H3V J;  3NVW B;  5FJP A;  5LL6 f;  1Y1V S;  2YQU A;  4NEW A;  2ZAE B;  1YIJ Z;  1Z02 A;  3GD3 A;  2JA5 I;  1YJ9 1;  2HQM A;  2HXT A;  3QKE A;  2GGJ A;  1GRT A;  4IL2 A;  3ZLH A;  1N62 C;  3H70 A;  3P5J B;  3IK4 A;  3CCL Z;  2E9H A;  2KPI A;  4E2X A;  1VQ5 Z;  1Q82 1;  1MOK A;  2C3D A;  3CCQ Z;  1F3P A;  1TWA I;  4ROP A;  5FS9 A;  1X3W A;  1Y1W I;  3GRT A;  3CCU 1;  5JCK A;  3JW7 A;  2RBL A;  3IX0 A;  2IV2 X;  1OEP A;  4MXU A;  4A3F I;  3ES7 A;  3R1Z A;  1WCM I;  2V8I A;  4H50 A;  2OTL 1;  1GRG A;  1JJ2 Z;  3SN0 A;  4K8D A;  2QLV B;  1YHQ 1;  3M4O I;  3OW1 A;  4H4T A;  4NH1 C;  3N6J A;  4EQX A;  3MON A;  5A2Q b;  5JCI A;  2JUB A;  2PGW A;  3N4E A;  5IP9 I;  2F4M A;  3SN1 A;  3D2L A;  3ZLF A;  1N8R 2;  3MY9 A;  2QDE A;  3BG0 B;  3ENL A;  3CME 1;  2WP6 A;  3RRA A;  1TYT A;  2FKP A;  2QRC B;  2B63 I;  2OVL A;  3CCU Z;  2E2I I;  1EBG A;  3P93 A;  2OZT A;  5FS6 A;  1SJC A;  1ELS A;  3FXG A;  4J1O A;  3CD6 1;  3L5O A;  3TWB A;  4DHG A;  1E9I A;  2OTL Z;  1F9C A;  3JAM b;  1S7M A;  3ETR B;  1NP6 A;  4A3J I;  2P0I A;  3GY1 A;  2K5R A;  1FDO A;  2GU2 A;  3FCP A;  4H4U A;  2HU9 A;  4MD7 A;  3EEZ A;  3VCC A;  3D9X A;  3DK9 A;  3EF6 A;  2QAE A;  3VDG A;  1RO4 A;  2QEX 1;  2VPW A;  1YIT 1;  4BY1 I;  1JDF A;  1SJB A;  1Q7Y 2;  4H83 A;  5JRB A;  3CME Z;  1ZB9 A;  1KKO A;  1RLY A;  2XH4 A;  1KD1 2;  4A3M I;  3G71 1;  2CDU A;  1K4Q A;  4DNA A;  4QTT A;  1BKH A;  3DIP A;  3CAW A;  1JRP A;  3H8A A;  3CD6 Z;  2VUM I;  3GTM I;  1VQN 1;  3GRS A;  1P48 A;  1H2I A;  2KI7 B;  3GTO I;  3CC4 1;  2OOX B;  4A3L I;  1V97 A;  2WPF A;  3IJL A;  1Z01 A;  4NBB A;  2WOW A;  3T4N B;  1I6H I;  2DW7 A;  2EQ9 A;  1Q81 2;  4HH4 A;  4A3R A;  6ENL A;  1MO9 A;  1ZXI C;  3CXC Y;  5JCN A;  1Q1R A;  3GTM S;  2QEX Z;  2GL5 A;  1YIT Z;  3CK5 A;  3GD6 A;  4RVD A;  4H4V A;  4E33 A;  4IT1 A;  3OW2 Z;  3G71 Z;  2I5Q A;  3HOZ I;  1K83 I;  2PMQ A;  4NB9 A;  1ZDL A;  1JPM A;  1VQO 1;  1TYP A;  1FEC A;  1FO4 A;  2MNR A;  4NB8 A;  1RO0 A;  3CCS 1;  3QN3 A;  4H4Z A;  4DN1 A;  2JK6 A;  1VQL 1;  1GER A;  3FG2 P;  1FFU C;  2PU0 A;  3I56 1;  1XHC A;  2BCP A;  3OTR A;  3I6T A;  3CC4 Z;  1TFI A;  3S1M I;  1NHQ A;  1EC9 A;  4H4Y A;  3BG1 B;  1KRL A;  1PDY A;  3EAN A;  3NH8 A;  3S14 I;  2PTW A;  3JZU A;  3MQT A;  1X0T A;  5A2Q f;  2C3C A;  3HOW I;  5G5H B;  3SR6 B;  3CC7 1;  4EM4 A;  1YI2 1;  3G6E 1;  3TJ4 A;  1QF8 A;  5T67 A;  1VQO Z;  4NBC A;  1T3Q C;  3EED A;  4EMI A;  2IZ3 A;  1NHS A;  4NBF A;  4GIS A;  5EU9 A;  3NXL A;  4Z1Y A;  5U25 A;  3CCS Z;  4TVY A;  3DGH A;  2W55 A;  3UGV A;  3DJJ A;  2BC1 A;  2P3Z A;  4HGZ A;  1BQG A;  3NVY B;  4DYE A;  3D6W A;  2GGI A;  2PS2 A;  3I4N I;  2JNY A;  3MWC A;  1N2F A;  2K3R A;  1JOA A;  1JJ2 Y;  3GTQ I;  1YJN Z;  1XAN A;  1XDI A;  3PWI A;  2WP5 A;  4E4F A;  1FEA A;  3BOX A;  3JAM f;  5FLX b;  3II4 A;  4NFR A;  1FIQ B;  5TR3 A;  2JS4 A;  2EQ6 A;  2GH5 A;  2OO6 A;  1N63 C;  5D1O A;  3DDM A;  3QWU A;  2GQW A;  4E6M A;  5C4J I;  2WB1 A;  3RNM A;  3JVA A;  4MKS A;  5D1P A;  4RS4 A;  4ENL A;  2NQL A;  3HW2 A;  4A3E I;  3G6E Z;  1YI2 Z;  1Z03 A;  1NHR A;  4Y7N I;  3GTG I;  1QVF Z;  4EMW A;  1N5W C;  1X2H A;  4K2S A;  2H85 A;  2CHR A;  4LII A;  2GTH A;  2R6M A;  2JIQ A;  4MRI A;  3S1Q I;  1RM6 B;  3Q45 A;  1TWG I;  1R9T I;  3RR1 A;  3OP2 A;  3H7V A;  1Q86 2;  3Q87 A;  3Q6J A;  3PO2 I;  4MH4 A;  2OZ8 A;  3BSM A;  4H4P A;  4HCH A;  3QPE A;  3U9I A;  2PTZ A;  4IZG A;  4ZCW A;  1LPF A;  4DWD A;  3R0U A;  1W6T A;  2PP1 A;  3FQQ A;  1N5X A;  3VA8 A;  1ZX9 A;  1QVG Z;  2EQ7 A;  4EQW A;  2RPR A;  4K7Z A;  4IP4 A;  1M1K 2;  2ZZ0 A;  1N8R 1;  3TE5 B;  2AKM A;  2BC0 A;  4NBG A;  3SQS A;  4HYR A;  4RVH A;  4IHC A;  2EQ8 A;  2AAQ A;  2PP0 A;  1ZB8 A;  1ECQ A;  2PU1 A;  3G4S 1;  2X8G A;  4KPL A;  2LEX A;  2PA6 A;  1VQ9 1;  1TKK A;  4EMJ A;  4MD8 A;  1KN0 A;  3H12 A;  3TQP A;  1WW9 A;  4H4W A;  1YJ9 Z;  3UCD A;  3VMG A;  2JA6 I;  4NBH A;  2RIQ A;  1I3Q I;  2O56 A;  3IJQ A;  4DGL A;  3QFA A;  2R92 I;  2GDQ A;  3CGD A;  3Q4D A;  4TVW A;  4HCL A;  1VQ4 1;  1NEL A;  3LXD A;  4E31 A;  2HNE A;  1I50 I;  4RV9 A;  1Q7Y 1;  2AKZ A;  2R9Z A;  3OW2 Y;  4MD9 A;  2QJJ A;  3V4B A;  4A6G A;  3A7A A;  1XPY A;  4MON A;  1KD1 1;  2OPJ A;  1SB3 B;  3QTP A;  3G4S Z;  1JWH C;  2RHB A;  4DK1 A;  1MNS A;  2RDX A;  3PO3 I;  4E2W A;  1ML8 A;  3RZD I;  3J81 b;  1VQK 1;  3I4M I;  3U4F A;  1GRB A;  3V3W A;  1VQ9 Z;  1X3Z A;  2DE5 A;  1BWC A;  3HOX I;  3NFU A;  3T4W A;  3DES A;  3THU A;  1YHQ Z;  4A3K I;  4DX3 A;  3DK8 A;  3A7U A;  3AM9 A;  3GD4 A;  5IDZ A;  4XX2 A;  1MDR A;  5KVI A;  3PO3 S;  1FHV A;  2J6A A;  2JIR A;  1EBD A;  3NVV B;  4H19 A;  4APN A;  4HGY A;  2VPX A;  5FLX f;  1Q81 1;  2WOV A;  5FJR A;  1WUF A;  1RVK A;  2CFY A;  5FJT A;  3DH9 A;  3I55 1;  5T64 A;  4FP1 A;  3GC2 A;  3K1G A;  3CXO A;  4GR1 A;  2V3A A;  4H4S A;  3RGT A;  5CM2 M;  3GCF A;  3I6E A;  3R07 C;  2W3R A;  2QQ6 A;  4GYP C;  3GKQ A;  1VQP 1;  3VTN A;  2WPE A;  1KQS Y;  3S5S A;  1GRA A;  1VQK Z;  2ZZB A;  3EAO A;  1RQF A;  2IZ4 A;  4H4X A;  5KVH A;  4E30 A;  2W54 A;  3S15 I;  1GET A;  4X2P A;  4HNC A;  1YQZ A;  2QJN A;  3LAD A;  3N4F A;  1M6I A;  4KEM A;  2YVG A;  1TWH I;  2OZK A;  5FJO A;  1F8W A;  2OQH A;  3VMH A;  2E2H I;  2PTY A;  3NRZ B;  3R11 A;  4E5T A;  2GR1 A;  3CQZ I;  1R6W A;  3BJS A;  3S47 A;  3R0K A;  5FJU A;  4BBS I;  1JCT A;  1W2B Z;  1M90 2;  3I55 Z;  3H4K A;  3N6H A;  2LFU A;  3RO6 A;  1PDZ A;  1QVF Y;  5AN9 F;  1GSN A;  3GTL I;  1VQP Z;  2VF1 A;  3CGE A;  3I4K A;  2HZG A;  3MSY A;  4MMW A;  4RVG A;  2ONE A;  4FI4 A;  1VQN Z;  3IJI A;  1L1O C;  3FJ4 A;  3SN4 A;  3DG6 A;  4Z17 A;  1K73 2;  1X2G A;  4E32 A;  2EGT A;  3S2D I;  1SIW A;  4BY7 I;  2E7Z A;  3NDJ A;  4EWJ A;  2VUG A;  3A7R A;  2E3T A;  1QVG Y;  4S1T A;  1PFT A;  5EBK A;  3R25 A;  1IYX A;  1ZK7 A;  2PM9 A;  2O4H A;  1WII A;  3S1R I;  2OFJ A;  3UJS A;  2Q4Z A;  1STZ A;  3ZVH B;  3HKZ A;  3CCE 1;  2QVH A;  4BUR A;  2W0H A;  3PG6 A;  4G8T A;  3GO2 A;  1KQS Z;  3HRD C;  1TE6 A;  3VC6 A;  1VQL Z;  2QRD B;  3GTP I;  2V8J A;  3P3B A;  3I56 Z;  3CB3 A;  2XH7 A;  3J81 f;  3S16 I;  1Q86 1;  1QXF A;  1NJI 2;  1KKR A;  3DGB A;  4LA1 A;  2AL1 A;  3DFH A;  1P43 A;  2DE7 A;  2WAQ A;  2XGZ A;  3L8K A;  2RAB A;  3B97 A;  1KD0 A;  2P28 A;  2XH2 A;  1YEY A;  1AOG A;  4TNU A;  2TPR A;  3URH A;  2DE6 A;  1NHP A;  3I07 A; 
#chains in the Genus database with same CATH homology
 1M1K 1;  1V59 A;  3EMI A;  3CC7 Z;  3CC2 1;  4QTU A;  2E2J I;  5JCL A;  2F4O A;  3CCE Z;  3GTK I;  2P3Y A;  5IT9 f;  4EM3 A;  2RT9 A;  1TWF I;  3KIH A;  2JA7 I;  2OOY B;  2QR1 B;  1YIJ 1;  2HF1 A;  4EWC A;  1LQL A;  2GRT A;  3IFU A;  3DJG X;  2NVK X;  4NEV A;  3CC2 Z;  1ZMD A;  2I3C A;  4BBR I;  4KPR A;  3CCQ 1;  2F5Z A;  4A3D I;  4EQR A;  1USP B;  4BXX I;  1KC8 2;  1K8A 2;  1YUA A;  4NOZ A;  3H0G I;  1GES A;  2LIY A;  3HOY I;  2M6N A;  1BZL A;  2OTJ 1;  1GXF A;  1DXL A;  3IF8 A;  3GTJ I;  2Y0S A;  4J57 A;  1GRE A;  3FQM A;  3J80 b;  1S72 1;  1W2B Y;  1GRF A;  1H6V A;  4A3G I;  2GR2 A;  1K9M 2;  2QKD A;  1VQ8 1;  5ER0 A;  4E2Y A;  5U1O A;  5JCM A;  2QA4 1;  4EQS A;  2PK7 A;  3HOV I;  4E2Z A;  2NVQ I;  4M52 A;  2OTJ Z;  4FDC B;  1OJT A;  4AYB A;  1Q1W A;  1NDA A;  2X8H A;  4X6A I;  2NVT I;  3LUS A;  2GR3 A;  4A3C I;  4CL1 A;  1GEU A;  1VQ4 Z;  3IC9 A;  3F3P C;  2W03 A;  3VB9 A;  1S72 Z;  3S2H I;  1Q82 2;  1M90 1;  1VQ6 1;  2JMO A;  2NPX A;  3TDH B;  5IT9 b;  1VQ8 Z;  4Y52 I;  2QA4 Z;  1GV4 A;  2YAD A;  3MZK B;  3CPW Y;  1ZKQ A;  3EMF A;  1RO2 A;  3CMA 1;  4A3B I;  2PMZ A;  3S1N I;  1YJW 1;  1K73 1;  5C4X I;  1ONF A;  5IP7 I;  1ZY8 A;  4H4R A;  5T6B A;  1RNI A;  1DL6 A;  3SQP A;  2WBA A;  1VQ6 Z;  4JDR A;  2JR6 A;  3RZO I;  3VMI A;  2AKL A;  4RVF A;  2G2K A;  3CCM 1;  2X50 A;  3CMA Z;  1DNC A;  3NFZ A;  2QRE B;  3NH5 A;  2GTI A;  2V6O A;  1NJI 1;  1YJW Z;  5C44 I;  4GRT A;  2YVJ A;  2V3B A;  3M3Y I;  3DGZ A;  3O0H A;  2GR0 A;  1VQM 1;  5FS8 A;  1VQ7 1;  1LVL A;  4BV6 A;  3CCJ 1;  4NBA A;  3FKI I;  1FEB A;  2R93 I;  3HOU I;  5FMH A;  3J80 f;  3NDI A;  3EER A;  3KLJ A;  2YAU A;  3CCM Z;  3CGB A;  3CPW Z;  5GRT A;  1NPX A;  4YWO A;  2V8K A;  1YJN 1;  2M48 A;  1VQM Z;  3MZL B;  1VQ7 Z;  3CCJ Z;  2NVY I;  1TWC I;  3NH4 A;  2O53 A;  1D7Y A;  3CCR 1;  1ZMC A;  1QYP A;  1NUI A;  2NVX I;  1ZH1 A;  2ZZC A;  4ADW A;  3LB8 A;  2X8C A;  5C3E I;  3CCV 1;  3ESW A;  5FS7 A;  1KC8 1;  1K8A 1;  1P9N A;  1YUK A;  2JA8 I;  3S17 I;  2A8X A;  3OC4 A;  3F3F C;  4NBE A;  2Q51 A;  3KIF A;  2BJO A;  5D1O B;  2WPC A;  3J7A 4;  1JEH A;  1VLA A;  2R7Z I;  2W04 A;  3U50 C;  2WOI A;  1GRH A;  2YU9 I;  2X99 A;  3CGC A;  3CXC Z;  3K7A I;  4A3I I;  4A93 I;  3CCR Z;  2YVF A;  3CCL 1;  4J56 A;  1VQ5 1;  4DQY B;  4JQ9 A;  2J3N A;  1Y1V I;  5FLM I;  1SFO I;  4NBD A;  3CCV Z;  1K9M 1;  4FX9 A;  3DK4 A;  3QFB A;  4H4Q A;  1USP A;  3H3V J;  5LL6 f;  1Y1V S;  2YQU A;  4NEW A;  2ZAE B;  1YIJ Z;  1Z02 A;  3GD3 A;  2JA5 I;  1YJ9 1;  2HQM A;  1GRT A;  3P5J B;  3CCL Z;  2E9H A;  2KPI A;  4E2X A;  1VQ5 Z;  1Q82 1;  1MOK A;  2C3D A;  3CCQ Z;  1F3P A;  1TWA I;  5FS9 A;  1X3W A;  1Y1W I;  3GRT A;  3CCU 1;  5JCK A;  2RBL A;  3IX0 A;  4MXU A;  4A3F I;  1WCM I;  2V8I A;  4H50 A;  2OTL 1;  1GRG A;  1JJ2 Z;  4K8D A;  2QLV B;  1YHQ 1;  3M4O I;  4H4T A;  4NH1 C;  4EQX A;  3MON A;  5A2Q b;  5JCI A;  2JUB A;  5IP9 I;  2F4M A;  1N8R 2;  3BG0 B;  3CME 1;  2WP6 A;  1TYT A;  2QRC B;  2B63 I;  3CCU Z;  2E2I I;  5FS6 A;  3CD6 1;  3L5O A;  2OTL Z;  3JAM b;  1S7M A;  1NP6 A;  4A3J I;  2K5R A;  2GU2 A;  4H4U A;  2HU9 A;  4MD7 A;  3D9X A;  3DK9 A;  3EF6 A;  2QAE A;  1RO4 A;  2QEX 1;  5JRB A;  1YIT 1;  4BY1 I;  1Q7Y 2;  3CME Z;  1ZB9 A;  1RLY A;  1KD1 2;  4A3M I;  3G71 1;  2CDU A;  1K4Q A;  4DNA A;  4QTT A;  3CD6 Z;  2VUM I;  3GTM I;  1VQN 1;  3GRS A;  1H2I A;  2KI7 B;  3GTO I;  3CC4 1;  2OOX B;  4A3L I;  2WPF A;  1Z01 A;  4NBB A;  2WOW A;  3T4N B;  1I6H I;  2EQ9 A;  1Q81 2;  4HH4 A;  1MO9 A;  3CXC Y;  5JCN A;  1Q1R A;  3GTM S;  2QEX Z;  1YIT Z;  4H4V A;  4RVD A;  4E33 A;  3OW2 Z;  3G71 Z;  3HOZ I;  1K83 I;  4NB9 A;  1ZDL A;  1VQO 1;  1TYP A;  1FEC A;  4NB8 A;  1RO0 A;  3CCS 1;  4H4Z A;  2JK6 A;  1VQL 1;  1GER A;  3FG2 P;  3I56 1;  1XHC A;  2BCP A;  3CC4 Z;  1TFI A;  3S1M I;  1NHQ A;  4H4Y A;  3BG1 B;  1KRL A;  3EAN A;  3NH8 A;  3S14 I;  1X0T A;  5A2Q f;  2C3C A;  3HOW I;  3CC7 1;  4EM4 A;  1YI2 1;  3G6E 1;  1QF8 A;  5T67 A;  1VQO Z;  4NBC A;  3EED A;  4EMI A;  2IZ3 A;  1NHS A;  4NBF A;  5U25 A;  3CCS Z;  3DGH A;  3DJJ A;  2BC1 A;  4HGZ A;  3D6W A;  3I4N I;  2JNY A;  1N2F A;  2K3R A;  1JOA A;  1JJ2 Y;  3GTQ I;  1YJN Z;  1XAN A;  1XDI A;  2WP5 A;  1FEA A;  3JAM f;  5FLX b;  3II4 A;  4NFR A;  5TR3 A;  2JS4 A;  2EQ6 A;  2GH5 A;  5D1O A;  3QWU A;  2GQW A;  2WB1 A;  5C4J I;  3RNM A;  5D1P A;  4RS4 A;  4A3E I;  3G6E Z;  1YI2 Z;  1Z03 A;  1NHR A;  4Y7N I;  3GTG I;  1QVF Z;  4EMW A;  2H85 A;  4LII A;  2GTH A;  2R6M A;  4MRI A;  3S1Q I;  1TWG I;  1R9T I;  3Q6J A;  1Q86 2;  3Q87 A;  4H4P A;  3PO2 I;  4MH4 A;  1LPF A;  3FQQ A;  1ZX9 A;  1QVG Z;  2EQ7 A;  4EQW A;  2RPR A;  4K7Z A;  1M1K 2;  2ZZ0 A;  1N8R 1;  3TE5 B;  2BC0 A;  4NBG A;  4RVH A;  2EQ8 A;  2AAQ A;  1ZB8 A;  3G4S 1;  2X8G A;  1VQ9 1;  4EMJ A;  4MD8 A;  1KN0 A;  1WW9 A;  4H4W A;  1YJ9 Z;  3VMG A;  2JA6 I;  4NBH A;  2RIQ A;  1I3Q I;  3QFA A;  5EBK A;  4DGL A;  2R92 I;  3CGD A;  1VQ4 1;  3LXD A;  4E31 A;  1I50 I;  4RV9 A;  1Q7Y 1;  2R9Z A;  3OW2 Y;  4MD9 A;  4MON A;  1KD1 1;  3G4S Z;  1JWH C;  2RHB A;  4DK1 A;  3PO3 I;  4E2W A;  1ML8 A;  3RZD I;  3J81 b;  1VQK 1;  3I4M I;  1GRB A;  1VQ9 Z;  1X3Z A;  2DE5 A;  1BWC A;  3HOX I;  1YHQ Z;  4A3K I;  3DK8 A;  3GD4 A;  4XX2 A;  5KVI A;  3PO3 S;  4APN A;  2J6A A;  1EBD A;  4HGY A;  1Q81 1;  5FLX f;  2WOV A;  2CFY A;  3DH9 A;  3I55 1;  5T64 A;  4GR1 A;  4H4S A;  2V3A A;  5CM2 M;  3GCF A;  3GKQ A;  1VQP 1;  3VTN A;  2WPE A;  1KQS Y;  1GRA A;  1VQK Z;  2ZZB A;  3EAO A;  1RQF A;  2IZ4 A;  4H4X A;  5KVH A;  4E30 A;  3S15 I;  1GET A;  1YQZ A;  3LAD A;  1M6I A;  2YVG A;  1TWH I;  2OZK A;  1F8W A;  3VMH A;  2E2H I;  2GR1 A;  3CQZ I;  4BBS I;  1W2B Z;  1M90 2;  3I55 Z;  3H4K A;  2LFU A;  1QVF Y;  5AN9 F;  1GSN A;  3GTL I;  1VQP Z;  2VF1 A;  3CGE A;  4RVG A;  1VQN Z;  1L1O C;  1K73 2;  4E32 A;  2EGT A;  3S2D I;  4BY7 I;  3NDJ A;  2VUG A;  1QVG Y;  4S1T A;  1PFT A;  1ZK7 A;  2PM9 A;  2O4H A;  1WII A;  3S1R I;  2Q4Z A;  3HKZ A;  3CCE 1;  4BUR A;  2W0H A;  3PG6 A;  1KQS Z;  1VQL Z;  2QRD B;  3GTP I;  2V8J A;  3I56 Z;  3J81 f;  3S16 I;  1Q86 1;  1NJI 2;  4LA1 A;  2DE7 A;  2WAQ A;  3L8K A;  2RAB A;  2P28 A;  1AOG A;  4TNU A;  2TPR A;  3URH A;  2DE6 A;  1NHP A;  3I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...