1S7MA

Crystal structure of hiabd1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
158
Chain Sequence
GAKTEINKDGLTITPANGAGANNANTISVTKDGISAGGQSVKNVVSGLKKFGDANFDPLTSSADNLTKQNDDAYKGLTNLDEKGTDKQTPVVADNTAATVGDLRGLGWVISADKTTGGSTEYHDQVRNANEVKFKSGNGINVSGKTVNGRREITFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hia
publication title Structural basis for host recognition by the Haemophilus influenzae Hia autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
total genus 27
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15403 HiaBD2 HiaBD2_N domain of Trimeric autotransporter adhesin (GIN)
A PF18669 Trp_ring Trimeric autotransporter adhesin Trp ring domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.140 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s7mA03
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1s7mA01
3.90.1780.10 Alpha Beta Alpha-Beta Complex Trimeric adhesin Trimeric adhesin 1s7mA02
1S7MA 3EMIA 3D9XA 3EMFA
chains in the Genus database with same CATH superfamily
2YVJA 5D1OB 1W2BZ 2VF1A 3TTEA 3I561 3THUA 1TE6A 3H8AA 1QVFZ 4IZGA 2I5QA 3CAWA 4E5TA 3PO3S 4S1TA 2WBAA 3T9PA 2ZZ0A 4Y7NI 1JRPA 4H4XA 3G711 1K8A1 3SR6B 2NVQI 2JIRA 1BQGA 1E9IA 1ZKQA 3ESWA 3CCM1 3K1GA 2F5ZA 3NVVB 3FCPA 1TFIA 1NJI2 1FDOA 3CCL1 1VQPZ 2NQLA 4HCLA 3DJGX 3CXBA 3I4NI 3N4EA 3NDIA 4TVYA 3RRAA 1WCMI 2Y0SA 4EMWA 2V3VA 1GREA 3Q45A 1BWCA 3S1QI 4A35A 3I551 1YEYA 3J80f 1MO9A 1N5XA 5FJPA 4QTUA 4GYPA 3GTOI 2VUMI 3DK9A 3JVAA 3CXOA 2HZGA 2OFJA 2ZADA 3GKQA 4MXUA 4E2ZA 4EWCA 3PWGA 1Q16A 1ZMDA 4EMJA 4NBBA 4NOZA 3QLDA 2K3RA 3NH8A 5T64A 4E2WA 1ZX9A 3IC9A 2OOXB 1VQM1 1JEHA 2QEXZ 2M6NA 4H83A 3LB8A 3CD61 5IT9b 2BC0A 4LIIA 3T8QA 3TDHB 1Z02A 3TWBA 4E2YA 2W54A 4BBRI 4IP5A 3CK5A 4J57A 3VCNA 5EU9A 1JJ2Z 3EMIA 1RNIA 4ROPA 4HCDA 2OZTA 5FS6A 3I56Z 3EKGA 2QRDB 3DG3A 5G5GB 2M48A 3FG2P 1W6TA 3NRZB 1Q861 1N63C 2X8CA 3D2LA 1YJNZ 3I4KA 2PP0A 4IT1A 4BY1I 1JPMA 4JDRA 4MRIA 4KT2A 1USPB 1Y8CA 3CCMZ 3VMGA 2OPJA 2GQWA 1NHPA 2E3TA 3N6HA 3TCSA 5FJRA 4MONA 4RVFA 4BY7I 2OZ8A 3TW9A 3U4FA 2CHRA 4RS4A 3HOYI 4M6UA 1I3QI 4E33A 1VQ4Z 5FLXb 3LXDA 4BBSI 4Y52I 3S1MI 2FYMA 4FDCB 3IFUA 2X99A 1FFUC 3TQPA 4HYRA 2GU2A 2PU0A 3I55Z 3L5OA 4FP1A 1RQFA 5T67A 3CCQ1 5AN9F 3BOXA 2OZKA 4GRTA 4APNA 1GRAA 3CGBA 1WJ2A 1VQ81 1GSNA 3PK7A 2F4OA 5IT9f 4HN8A 3NXLA 5C44I 4A3JI 4DXKA 3UCDA 4H4SA 1ML8A 3SN0A 1KD11 3IJIA 3AMZA 3GRTA 1VQMZ 1Q1RA 2WPCA 3SN1A 2P88A 3I07A 3CD6Z 3BG1B 1YITZ 2W04A 2G2KA 2X50A 2PGEA 4NBEA 3NDJA 1M6IA 3D46A 3M3YI 4K8DA 3H7VA 1KC82 3HW2A 1KKRA 3MKCA 3IJLA 3EANA 3MONA 2RDXA 4XX2A 1VQ5Z 1XANA 1Y1VS 3H70A 3ETRB 1NJI1 2PP3A 3RGTA 3QWUA 3GTLI 1WW9A 3V5CA 3HKZA 4H4ZA 1W2BY 2JIOA 3TE5B 5FLXf 4NB8A 2QA41 1VQ91 1M1K2 2WP6A 3MZNA 1SFOI 4IL0A 1FHVA 1FDIA 3URHA 5FLMI 1ZXIC 3A7UA 3K7AI 5EBKA 1GERA 4BURA 3HOVI 3CGEA 5IP9I 4G7FA 1MOKA 4DQYB 2NVXI 5FS8A 3DIPA 3T4WA 2PODA 3GC2A 3RITA 4X2PA 2P8CA 1IYXA 3UCCA 4EQSA 4GIRA 1FO4A 2Q4ZA 3VA8A 1N61C 1YIJZ 4GISA 3FV9A 1DXLA 3OP2A 2MNRA 2P0IA 4A3FI 3DESA 1S7MA 1WYGA 3OZMA 4IHCA 2GH5A 3SSZA 3H4KA 2KI7B 3D9XA 4EMIA 1YI2Z 3EF6A 3OW2Z 5BOEA 4NEWA 3MZLB 2HXUA 2JNYA 4DN1A 3BG0B 4H4TA 1SJCA 1Q7Y2 2AKZA 5GRTA 1USPA 1K83I 2VUGA 4NBAA 2OX4A 2DE7A 4E2XA 3L8KA 3ES7A 5ENLA 3U50C 3ENLA 1V97A 2WPEA 2QEX1 2RT9A 2OQHA 1YHQZ 3I6EA 4DYEA 2W3SA 3QFBA 1R6WA 3DG7A 1QXFA 3FXGA 3UJEA 2VPXA 4NBCA 2E2HI 1Z03A 3JAMb 2QGYA 4K7ZA 5A2Qb 1VQ9Z 2QA4Z 1VDVA 2JS4A 1YJN1 1ZH1A 4IL2A 4JHMA 1X3WA 3M4OI 2QVHA 1Y1VI 2RABA 4MGGA 2VPZA 3CC71 3O0HA 1QYPA 2JA5I 3PWIA 2OLAA 2O53A 1K4QA 3R10A 3J81b 3V3WA 2H85A 2PU1A 2GR0A 1MRAA 3N6JA 1RO0A 2GTIA 1F9CA 4EQWA 1VQ41 2V8KA 1VQK1 3GY1A 3S17I 4E4FA 3I4MI 2JA6I 2R9ZA 3D47A 2V8IA 1NDAA 1BKHA 3JW7A 1XHCA 3SQPA 2YQUA 3UXKA 4Z1YA 1NHRA 2RHBA 3IK4A 1XS2A 1TWAI 1Q822 1WUEA 1EBHA 3NS1B 3TWAA 2RIQA 4GMEA 3OW1A 3HOXI 1GRHA 3UJSA 4BV6A 4QTTA 5T6BA 2OKTA 3CXCZ 1NELA 2AAQA 4E32A 3S2DI 1I50I 2JIQA 3CC4Z 3JAMf 1RM6B 2LFUA 4KWSA 2PTZA 3CPWZ 1YIT1 1NU5A 1X3ZA 5A2Qf 2AL1A 2QQ6A 2W3RA 4JN8A 3ZVIA 1WUFA 1M1K1 3II4A 4HGYA 2JK6A 3VMIA 3FJ4A 3N4FA 3V5FA 2PA6A 3P3BA 4DHGA 5CM2M 1VQ51 1RVKA 1TYTA 1YJ91 1VQ7Z 2IZ4A 1I6HI 2GR3A 1ZB9A 1Q812 1M902 3GRSA 1K9M2 3CC7Z 3CCSZ 3ES8A 4LA1A 4ZA0A 3TJIA 4EM3A 3U9IA 3MQTA 4EM4A 3RO6A 2QLVB 3GTPI 2C3CA 1RLYA 1KN0A 2P3ZA 2IV2X 4NB9A 2P3YA 1GETA 1ZY8A 2NVYI 4RVHA 1VQKZ 1SJDA 3QKEA 2WAQA 3UJ2A 1Q7Y1 1DL6A 4H4RA 1XDIA 1YIJ1 2JMOA 4A3BI 2QJNA 1YJWZ 1YQZA 5J04A 4TNUA 4HH4A 5D1OA 2DW7A 3R25A 2E2JI 2W03A 4ENLA 1K731 4DWDA 1YI21 4E4UA 3ZLGA 4E31A 3RZDI 1Q1WA 3Q6JA 2X8HA 3CQZI 5FS7A 2JR6A 2ZAEB 2J3NA 1MNSA 5JCLA 4NBGA 3VTNA 2E9HA 1SJBA 3R07C 2HNEA 2QAEA 3FKII 3S47A 4HNCA 5KVIA 2V3AA 3STPA 1AA6A 2NVKX 1TYPA 4MD8A 1GV4A 3EEZA 4E6MA 1YHQ1 1K8A2 3G4S1 3S16I 4GGBA 1N2FA 4GR1A 1Y1WI 3EUB3 2V3BA 1YJ9Z 1MUCA 4GGHA 5U25A 2LEXA 3GCFA 5C4XI 3CMAZ 2GR2A 2P8BA 3CCVZ 4MMWA 5ER0A 2PMQA 1QVFY 1NPXA 1YUAA 1FEBA 2GTHA 5FS9A 3MWCA 1TWGI 3DGBA 3H3VJ 3IF8A 4MD7A 1FHUA 1JWHC 1JPDX 2PK7A 1EBGA 2DW6A 1KD0A 1DNCA 3KUMA 2PCEA 2ZZCA 2AL2B 1H6VA 4A3KI 1OEPA 5JCNA 2C3DA 1VQ61 2HXTA 2XH2A 3PFRA 2JIMA 4BXXI 3P5JB 3SJNA 3DFYA 1ONEA 2WB1A 4JQ9A 4KPRA 1GEUA 4J1OA 3FQQA 1FIQB 5C4JI 1SB3B 3CT2A 3VCCA 2YVGA 5JCIA 1N60C 3OZYA 2RBLA 3CCRZ 4A3II 1XPYA 2CFYA 2WP5A 3DK8A 2JIPA 1YUKA 3NVZB 2XH4A 4YWSA 5TR3A 1D7YA 1MDLA 1Z01A 1BZLA 1GRGA 1Q862 3CC41 3CCJZ 3GTJI 2BJOA 1FFVC 2J6AA 3G4SZ 1Q811 3I6TA 3CB3A 4YWOA 2K5RA 1K9M1 3TOYA 1GESA 4HNLA 4IP4A 4F4RA 2DE5A 3MZKB 2EQ9A 3SQSA 2MUCA 1F3PA 3PO2I 1JJ2Y 1X2HA 3OC4A 3UJRA 3QPEA 3QFAA 4MKSA 1ECQA 3DGHA 1LQLA 3Q87A 4RVGA 4HPNA 1VQ71 4EWJA 1GRFA 4GFIA 1TWFI 1LVLA 2CDUA 1PDYA 1KKOA 2NVTI 3CCS1 4DNAA 3A7RA 4K8GA 2PGWA 2DE6A 5U1OA 2JA7I 3GTMI 3F3PC 2GGJA 1TWCI 3HOWI 2POZA 6ENLA 2EGTA 1P48A 2PTWA 2OTLZ 1VQ6Z 2PTXA 5C3EI 2AYDA 3G6EZ 1KD12 2GGEA 3V4BA 2PM9A 2PS2A 3NH5A 3S14I 2QJMA 1NP6A 4H4QA 2P28A 3EERA 4MH4A 1GRBA 2EQ8A 1TWHI 1GRTA 1YJW1 1EBDA 3DERA 3NO1A 3SN4A 4A3GI 3S2HI 2ZC8A 1KC81 1QVGZ 3Q4DA 3CCU1 5JRBA 4HCHA 2HQMA 1N8R2 5LL6f 3DGZA 1S721 3DK4A 2QKDA 4AYBA 2Q51A 1VQOZ 2QR1B 1KQSZ 3J7A4 2QJJA 3IX0A 3BSMA 2IZ3A 1P9NA 4A3CI 3NVYB 3P93A 1TZZA 4JN7A 4KPLA 3S1RI 2OVLA 3CMEZ 1EC8A 1TKKA 3KIFA 2WOWA 2ZZBA 3LADA 4H1ZA 4ADWA 3T4NB 4HGZA 2AL2A 1VQN1 4RV9A 3IR7A 4M0XA 3RCYA 3J81f 3SBFA 3F3FC 2WPFA 1V59A 2R6MA 3BJSA 2XGZA 3R1ZA 2QRCB 1WIIA 1JDFA 3CMA1 5JCMA 2YADA 3CCV1 2V6OA 3AM9A 3IJQA 3JZUA 3CGCA 2XH7A 3CYJA 2E2II 3ZLFA 3DG6A 1VQLZ 4NBFA 3S5SA 4MD9A 2QDEA 2YAUA 4H50A 3ZVHB 2OO6A 4A6GA 2HU9A 2O4HA 4A3LI 2FKPA 1MDRA 1R9TI 1FECA 3VFCA 1P43A 2GL5A 2JUBA 2E5AA 2EQ7A 3VMHA 3S15I 1L1OC 3RZOI 3OPSA 2QREB 3MY9A 3KLJA 3VB9A 1FEAA 4A93I 1NUIA 5G5HB 2OTJ1 3NFUA 2F4MA 3CCUZ 3CGDA 2GRTA 5JCKA 3G71Z 1N62C 3R0UA 4DK1A 1JOAA 3OTRA 3PG6A 3OW2Y 1ZB8A 4NBDA 1S72Z 3FVDA 1NHQA 2W0HA 2GSHA 3HPFA 2PTYA 3CCR1 3NH4A 3GTGI 3CCLZ 4TVWA 5FMHA 3PO3I 3FQMA 3TJ4A 3KIHA 3NZGA 4H4YA 4K2SA 3S1NI 2LIYA 3CCJ1 4X6AI 1PDZA 5BOFA 1AOGA 1ELSA 4EQRA 1VQNZ 3CCE1 3HOZI 3EEDA 4ZOHB 3EMFA 1T3QC 2XH0A 2AKMA 2GGGA 3R11A 4FI4A 2YVFA 1F8WA 4A3RA 4EQXA 2PSNA 2AKLA 1RO4A 1X0TA 3VC6A 2PMZA 2QDDA 4NH1C 3VC5A 1OJTA 3GTMS 3DH9A 3UXLA 3UJFA 2PPGA 1EC7A 3RR1A 3VDGA 2YU9I 2XSXA 2B63I 1LPFA 3AN1A 2BC1A 4KEMA 3QN3A 3QTPA 1RO2A 1Q821 2JA8I 3H12A 4RVDA 5IP7I 3RNMA 4E30A 2KPIA 1EC9A 1VLAA 2X8GA 4DX3A 1N8R1 1STZA 1ZMCA 2A8XA 2OTL1 4J56A 1KCZA 3G6E1 2OZ3A 2PP1A 3CC21 4G8TA 4H19A 1X2GA 3H0GI 2GDQA 2OTJZ 3NFZA 1L8PA 4DGLA 4H4VA 4A3EI 2EQ6A 3GO2A 4CL1A 2NPXA 1ONFA 2TPRA 1QVGY 2R7ZI 1DTNA 4H4PA 5FJUA 2BCPA 3GTQI 2E7ZA 2R92I 3ZLHA 3ZVHA 5FJOA 1VQO1 4H4WA 1NHSA 1VQP1 2I3CA 3CXCY 1KQSY 3GD4A 4NFRA 2V8JA 3CCEZ 1R0MA 1M901 2OG9A 3CPWY 2GR1A 7ENLA 3MSYA 2HF1A 3A7AA 3CME1 2VPWA 2W55A 3P0WA 3GTKI 3CCQZ 3DFHA 3FYYA 2GGIA 3MUCA 3B9JB 3EAOA 1PFTA 2GGHA 3LUSA 4NBHA 1VQ8Z 5KVHA 1SJAA 3D6WA 1VQZA 3HRDC 4J3ZA 3DEQA 4K1WA 2V45A 2RPRA 1N5WC 1H2IA 4ZCWA 1SIWA 3DJJA 4M52A 4Z17A 1KRLA 4H2HA 2WOVA 3GD3A 3T6CA 3NVWB 5IDZA 4A3DI 2NAPA 2VPYA 5D1PA 1WZNA 1ZDLA 1QF8A 3J80b 4GYPC 1VQL1 2O56A 3B97A 4FX9A 2OOYB 3GD6A 3UGVA 1K732 5FJTA 2ONEA 4E8GA 4H4UA 4NEVA 2R93I 3R0KA 3HOUI 3CC2Z 1ZK7A 1GXFA 1JROA 1JCTA 2OQYA 3DDMA 4A3MI 2WOIA
chains in the Genus database with same CATH topology
2YVJA 5D1OB 1W2BZ 2VF1A 3I561 1QVFZ 3PO3S 4S1TA 2WBAA 2ZZ0A 4Y7NI 4H4XA 3G711 1K8A1 2NVQI 1ZKQA 3ESWA 3CCM1 2F5ZA 1TFIA 1NJI2 3CCL1 1VQPZ 3DJGX 3I4NI 3NDIA 1WCMI 2Y0SA 4EMWA 1GREA 1BWCA 3S1QI 3I551 3J80f 1MO9A 4QTUA 3GTOI 2VUMI 3DK9A 3GKQA 4MXUA 4E2ZA 4EWCA 1ZMDA 4EMJA 4NBBA 4NOZA 2K3RA 3NH8A 5T64A 4E2WA 1ZX9A 3IC9A 2OOXB 1VQM1 1JEHA 2QEXZ 2M6NA 3LB8A 3CD61 5IT9b 2BC0A 4LIIA 3TDHB 1Z02A 4E2YA 4BBRI 4J57A 1JJ2Z 3EMIA 1RNIA 5FS6A 3I56Z 2QRDB 2M48A 3FG2P 1Q861 2X8CA 1YJNZ 4BY1I 4JDRA 4MRIA 1USPB 3CCMZ 3VMGA 2GQWA 1NHPA 4MONA 4RVFA 4BY7I 4RS4A 3HOYI 1I3QI 4E33A 1VQ4Z 5FLXb 3LXDA 4BBSI 4Y52I 3S1MI 4FDCB 3IFUA 2X99A 2GU2A 3I55Z 3L5OA 1RQFA 5T67A 3CCQ1 5AN9F 2OZKA 4GRTA 4APNA 1GRAA 3CGBA 1VQ81 1GSNA 2F4OA 5IT9f 5C44I 4A3JI 4H4SA 1ML8A 1KD11 3GRTA 1VQMZ 1Q1RA 2WPCA 3I07A 3CD6Z 3BG1B 1YITZ 2W04A 2G2KA 2X50A 4K8DA 4NBEA 3NDJA 1M6IA 3M3YI 1KC82 3EANA 3MONA 4XX2A 1VQ5Z 1XANA 1Y1VS 1NJI1 3QWUA 3GTLI 1WW9A 3HKZA 4H4ZA 1W2BY 3TE5B 5FLXf 4NB8A 2QA41 1VQ91 1M1K2 2WP6A 1SFOI 3URHA 5FLMI 3K7AI 5EBKA 1GERA 4BURA 3HOVI 3CGEA 5IP9I 1MOKA 4DQYB 2NVXI 5FS8A 4EQSA 2Q4ZA 1YIJZ 1DXLA 4A3FI 1S7MA 2GH5A 3H4KA 2KI7B 3D9XA 4EMIA 1YI2Z 3EF6A 3OW2Z 4NEWA 3MZLB 2JNYA 3BG0B 4H4TA 1Q7Y2 5GRTA 1USPA 1K83I 2VUGA 4NBAA 2DE7A 4E2XA 3L8KA 3U50C 2WPEA 2QEX1 2RT9A 1YHQZ 3QFBA 4NBCA 2E2HI 1Z03A 3JAMb 4K7ZA 5A2Qb 1VQ9Z 2QA4Z 2JS4A 1YJN1 1ZH1A 1X3WA 3M4OI 2RABA 1Y1VI 3CC71 3O0HA 1QYPA 2JA5I 2O53A 1K4QA 3J81b 2H85A 2GR0A 1RO0A 2GTIA 4EQWA 1VQ41 2V8KA 1VQK1 3S17I 3I4MI 2JA6I 2R9ZA 2V8IA 1NDAA 3SQPA 1XHCA 2YQUA 1NHRA 2RHBA 1TWAI 1Q822 2RIQA 3HOXI 1GRHA 4BV6A 4QTTA 5T6BA 3CXCZ 2AAQA 4E32A 3S2DI 1I50I 3CC4Z 3JAMf 2LFUA 3CPWZ 1YIT1 1X3ZA 5A2Qf 1M1K1 3II4A 4HGYA 2JK6A 3VMIA 5CM2M 1VQ51 1TYTA 1YJ91 1VQ7Z 2IZ4A 1I6HI 2GR3A 1ZB9A 1Q812 1M902 3GRSA 1K9M2 3CC7Z 3CCSZ 4LA1A 4EM3A 4EM4A 2QLVB 3GTPI 2C3CA 1RLYA 1KN0A 4NB9A 2P3YA 1GETA 1ZY8A 2NVYI 4RVHA 1VQKZ 2WAQA 1Q7Y1 1DL6A 4H4RA 1XDIA 1YIJ1 2JMOA 4A3BI 1YJWZ 1YQZA 4TNUA 4HH4A 5D1OA 2E2JI 2W03A 1K731 1YI21 4E31A 3RZDI 1Q1WA 3Q6JA 2X8HA 3CQZI 5FS7A 2JR6A 2ZAEB 2J3NA 5JCLA 4NBGA 3VTNA 2E9HA 2QAEA 3FKII 5KVIA 2V3AA 2NVKX 1TYPA 4MD8A 1GV4A 1YHQ1 1K8A2 3G4S1 3S16I 1N2FA 4GR1A 1Y1WI 2V3BA 1YJ9Z 5U25A 3GCFA 5C4XI 3CMAZ 2GR2A 3CCVZ 5ER0A 1QVFY 1NPXA 1YUAA 1FEBA 2GTHA 5FS9A 1TWGI 3H3VJ 3IF8A 4MD7A 1JWHC 2PK7A 1DNCA 2ZZCA 1H6VA 4A3KI 5JCNA 2C3DA 1VQ61 4BXXI 3P5JB 4JQ9A 2WB1A 4KPRA 1GEUA 3FQQA 5C4JI 5JCIA 2YVGA 2RBLA 3CCRZ 4A3II 2CFYA 2WP5A 3DK8A 5TR3A 1YUKA 1D7YA 1Z01A 1BZLA 1GRGA 1Q862 3CC41 3CCJZ 3GTJI 2BJOA 2J6AA 3G4SZ 1Q811 4YWOA 2K5RA 1K9M1 1GESA 2DE5A 3MZKB 2EQ9A 1F3PA 3PO2I 1JJ2Y 3OC4A 3QFAA 3DGHA 1LQLA 3Q87A 4RVGA 1VQ71 1GRFA 1TWFI 1LVLA 2CDUA 2NVTI 3CCS1 4DNAA 2DE6A 5U1OA 2JA7I 3GTMI 3F3PC 1TWCI 3HOWI 2EGTA 2OTLZ 1VQ6Z 5C3EI 3G6EZ 1KD12 2PM9A 3NH5A 3S14I 4H4QA 1NP6A 2P28A 3EERA 4MH4A 1GRBA 2EQ8A 1TWHI 1GRTA 1YJW1 1EBDA 4A3GI 3S2HI 1KC81 1QVGZ 3CCU1 5JRBA 2HQMA 1N8R2 5LL6f 3DGZA 1S721 3DK4A 2QKDA 4AYBA 2Q51A 1VQOZ 2QR1B 1KQSZ 3J7A4 3IX0A 2IZ3A 1P9NA 4A3CI 3S1RI 2WOWA 3CMEZ 3LADA 4ADWA 3KIFA 2ZZBA 3T4NB 4HGZA 1VQN1 4RV9A 3J81f 3F3FC 2WPFA 1V59A 2R6MA 2QRCB 1WIIA 3CMA1 5JCMA 2YADA 3CCV1 2V6OA 3CGCA 2E2II 1VQLZ 4NBFA 4MD9A 2YAUA 4H50A 2HU9A 2O4HA 4A3LI 1R9TI 1FECA 2JUBA 2EQ7A 3VMHA 3S15I 1L1OC 3RZOI 2QREB 3KLJA 3VB9A 1FEAA 4A93I 1NUIA 2OTJ1 2F4MA 3CCUZ 3CGDA 2GRTA 5JCKA 3G71Z 4DK1A 1JOAA 3PG6A 3OW2Y 1ZB8A 4NBDA 1S72Z 1NHQA 2W0HA 3CCR1 3NH4A 3GTGI 3CCLZ 5FMHA 3PO3I 3FQMA 3KIHA 4H4YA 3S1NI 2LIYA 3CCJ1 4X6AI 1AOGA 4EQRA 1VQNZ 3CCE1 3HOZI 3EEDA 3EMFA 2YVFA 1F8WA 4EQXA 2AKLA 1RO4A 1X0TA 2PMZA 4NH1C 1OJTA 3GTMS 3DH9A 2YU9I 2B63I 1LPFA 2BC1A 1RO2A 1Q821 2JA8I 4RVDA 5IP7I 3RNMA 4E30A 2KPIA 2X8GA 1VLAA 1N8R1 1ZMCA 2A8XA 2OTL1 4J56A 3G6E1 3CC21 3H0GI 2OTJZ 3NFZA 4DGLA 4H4VA 4A3EI 2EQ6A 4CL1A 2NPXA 1ONFA 2TPRA 1QVGY 2R7ZI 4H4PA 2BCPA 3GTQI 2R92I 1VQO1 4H4WA 1NHSA 1VQP1 2I3CA 3CXCY 1KQSY 3GD4A 4NFRA 2V8JA 3CCEZ 1M901 3CPWY 2GR1A 2HF1A 3CME1 3GTKI 3CCQZ 3EAOA 1PFTA 3LUSA 4NBHA 1VQ8Z 5KVHA 3D6WA 2RPRA 1H2IA 3DJJA 4M52A 1KRLA 2WOVA 3GD3A 4A3DI 5D1PA 1ZDLA 1QF8A 3J80b 1VQL1 4FX9A 2OOYB 1K732 4H4UA 4NEVA 2R93I 3HOUI 3CC2Z 1ZK7A 1GXFA 4A3MI 2WOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7M A;  3EMI A;  3D9X A;  3EMF A; 
#chains in the Genus database with same CATH topology
 2YVJ A;  5D1O B;  1W2B Z;  2VF1 A;  3TTE A;  3I56 1;  3THU A;  1TE6 A;  3H8A A;  1QVF Z;  4IZG A;  2I5Q A;  3CAW A;  4E5T A;  3PO3 S;  4S1T A;  2WBA A;  3T9P A;  2ZZ0 A;  4Y7N I;  1JRP A;  4H4X A;  3G71 1;  1K8A 1;  3SR6 B;  2NVQ I;  2JIR A;  1BQG A;  1E9I A;  1ZKQ A;  3ESW A;  3CCM 1;  3K1G A;  2F5Z A;  3NVV B;  3FCP A;  1TFI A;  1NJI 2;  1FDO A;  3CCL 1;  1VQP Z;  2NQL A;  4HCL A;  3DJG X;  3CXB A;  3I4N I;  3N4E A;  3NDI A;  4TVY A;  3RRA A;  1WCM I;  2Y0S A;  4EMW A;  2V3V A;  1GRE A;  3Q45 A;  1BWC A;  3S1Q I;  4A35 A;  3I55 1;  1YEY A;  3J80 f;  1MO9 A;  1N5X A;  5FJP A;  4QTU A;  4GYP A;  3GTO I;  2VUM I;  3DK9 A;  3JVA A;  3CXO A;  2HZG A;  2OFJ A;  2ZAD A;  3GKQ A;  4MXU A;  4E2Z A;  4EWC A;  3PWG A;  1Q16 A;  1ZMD A;  4EMJ A;  4NBB A;  4NOZ A;  3QLD A;  2K3R A;  3NH8 A;  5T64 A;  4E2W A;  1ZX9 A;  3IC9 A;  2OOX B;  1VQM 1;  1JEH A;  2QEX Z;  2M6N A;  4H83 A;  3LB8 A;  3CD6 1;  5IT9 b;  2BC0 A;  4LII A;  3T8Q A;  3TDH B;  1Z02 A;  3TWB A;  4E2Y A;  2W54 A;  4BBR I;  4IP5 A;  3CK5 A;  4J57 A;  3VCN A;  5EU9 A;  1JJ2 Z;  3EMI A;  1RNI A;  4ROP A;  4HCD A;  2OZT A;  5FS6 A;  3I56 Z;  3EKG A;  2QRD B;  3DG3 A;  5G5G B;  2M48 A;  3FG2 P;  1W6T A;  3NRZ B;  1Q86 1;  1N63 C;  2X8C A;  3D2L A;  1YJN Z;  3I4K A;  2PP0 A;  4IT1 A;  4BY1 I;  1JPM A;  4JDR A;  4MRI A;  4KT2 A;  1USP B;  1Y8C A;  3CCM Z;  3VMG A;  2OPJ A;  2GQW A;  1NHP A;  2E3T A;  3N6H A;  3TCS A;  5FJR A;  4MON A;  4RVF A;  4BY7 I;  2OZ8 A;  3TW9 A;  3U4F A;  2CHR A;  4RS4 A;  3HOY I;  4M6U A;  1I3Q I;  4E33 A;  1VQ4 Z;  5FLX b;  3LXD A;  4BBS I;  4Y52 I;  3S1M I;  2FYM A;  4FDC B;  3IFU A;  2X99 A;  1FFU C;  3TQP A;  4HYR A;  2GU2 A;  2PU0 A;  3I55 Z;  3L5O A;  4FP1 A;  1RQF A;  5T67 A;  3CCQ 1;  5AN9 F;  3BOX A;  2OZK A;  4GRT A;  4APN A;  1GRA A;  3CGB A;  1WJ2 A;  1VQ8 1;  1GSN A;  3PK7 A;  2F4O A;  5IT9 f;  4HN8 A;  3NXL A;  5C44 I;  4A3J I;  4DXK A;  3UCD A;  4H4S A;  1ML8 A;  3SN0 A;  1KD1 1;  3IJI A;  3AMZ A;  3GRT A;  1VQM Z;  1Q1R A;  2WPC A;  3SN1 A;  2P88 A;  3I07 A;  3CD6 Z;  3BG1 B;  1YIT Z;  2W04 A;  2G2K A;  2X50 A;  2PGE A;  4NBE A;  3NDJ A;  1M6I A;  3D46 A;  3M3Y I;  4K8D A;  3H7V A;  1KC8 2;  3HW2 A;  1KKR A;  3MKC A;  3IJL A;  3EAN A;  3MON A;  2RDX A;  4XX2 A;  1VQ5 Z;  1XAN A;  1Y1V S;  3H70 A;  3ETR B;  1NJI 1;  2PP3 A;  3RGT A;  3QWU A;  3GTL I;  1WW9 A;  3V5C A;  3HKZ A;  4H4Z A;  1W2B Y;  2JIO A;  3TE5 B;  5FLX f;  4NB8 A;  2QA4 1;  1VQ9 1;  1M1K 2;  2WP6 A;  3MZN A;  1SFO I;  4IL0 A;  1FHV A;  1FDI A;  3URH A;  5FLM I;  1ZXI C;  3A7U A;  3K7A I;  5EBK A;  1GER A;  4BUR A;  3HOV I;  3CGE A;  5IP9 I;  4G7F A;  1MOK A;  4DQY B;  2NVX I;  5FS8 A;  3DIP A;  3T4W A;  2POD A;  3GC2 A;  3RIT A;  4X2P A;  2P8C A;  1IYX A;  3UCC A;  4EQS A;  4GIR A;  1FO4 A;  2Q4Z A;  3VA8 A;  1N61 C;  1YIJ Z;  4GIS A;  3FV9 A;  1DXL A;  3OP2 A;  2MNR A;  2P0I A;  4A3F I;  3DES A;  1S7M A;  1WYG A;  3OZM A;  4IHC A;  2GH5 A;  3SSZ A;  3H4K A;  2KI7 B;  3D9X A;  4EMI A;  1YI2 Z;  3EF6 A;  3OW2 Z;  5BOE A;  4NEW A;  3MZL B;  2HXU A;  2JNY A;  4DN1 A;  3BG0 B;  4H4T A;  1SJC A;  1Q7Y 2;  2AKZ A;  5GRT A;  1USP A;  1K83 I;  2VUG A;  4NBA A;  2OX4 A;  2DE7 A;  4E2X A;  3L8K A;  3ES7 A;  5ENL A;  3U50 C;  3ENL A;  1V97 A;  2WPE A;  2QEX 1;  2RT9 A;  2OQH A;  1YHQ Z;  3I6E A;  4DYE A;  2W3S A;  3QFB A;  1R6W A;  3DG7 A;  1QXF A;  3FXG A;  3UJE A;  2VPX A;  4NBC A;  2E2H I;  1Z03 A;  3JAM b;  2QGY A;  4K7Z A;  5A2Q b;  1VQ9 Z;  2QA4 Z;  1VDV A;  2JS4 A;  1YJN 1;  1ZH1 A;  4IL2 A;  4JHM A;  1X3W A;  3M4O I;  2QVH A;  1Y1V I;  2RAB A;  4MGG A;  2VPZ A;  3CC7 1;  3O0H A;  1QYP A;  2JA5 I;  3PWI A;  2OLA A;  2O53 A;  1K4Q A;  3R10 A;  3J81 b;  3V3W A;  2H85 A;  2PU1 A;  2GR0 A;  1MRA A;  3N6J A;  1RO0 A;  2GTI A;  1F9C A;  4EQW A;  1VQ4 1;  2V8K A;  1VQK 1;  3GY1 A;  3S17 I;  4E4F A;  3I4M I;  2JA6 I;  2R9Z A;  3D47 A;  2V8I A;  1NDA A;  1BKH A;  3JW7 A;  1XHC A;  3SQP A;  2YQU A;  3UXK A;  4Z1Y A;  1NHR A;  2RHB A;  3IK4 A;  1XS2 A;  1TWA I;  1Q82 2;  1WUE A;  1EBH A;  3NS1 B;  3TWA A;  2RIQ A;  4GME A;  3OW1 A;  3HOX I;  1GRH A;  3UJS A;  4BV6 A;  4QTT A;  5T6B A;  2OKT A;  3CXC Z;  1NEL A;  2AAQ A;  4E32 A;  3S2D I;  1I50 I;  2JIQ A;  3CC4 Z;  3JAM f;  1RM6 B;  2LFU A;  4KWS A;  2PTZ A;  3CPW Z;  1YIT 1;  1NU5 A;  1X3Z A;  5A2Q f;  2AL1 A;  2QQ6 A;  2W3R A;  4JN8 A;  3ZVI A;  1WUF A;  1M1K 1;  3II4 A;  4HGY A;  2JK6 A;  3VMI A;  3FJ4 A;  3N4F A;  3V5F A;  2PA6 A;  3P3B A;  4DHG A;  5CM2 M;  1VQ5 1;  1RVK A;  1TYT A;  1YJ9 1;  1VQ7 Z;  2IZ4 A;  1I6H I;  2GR3 A;  1ZB9 A;  1Q81 2;  1M90 2;  3GRS A;  1K9M 2;  3CC7 Z;  3CCS Z;  3ES8 A;  4LA1 A;  4ZA0 A;  3TJI A;  4EM3 A;  3U9I A;  3MQT A;  4EM4 A;  3RO6 A;  2QLV B;  3GTP I;  2C3C A;  1RLY A;  1KN0 A;  2P3Z A;  2IV2 X;  4NB9 A;  2P3Y A;  1GET A;  1ZY8 A;  2NVY I;  4RVH A;  1VQK Z;  1SJD A;  3QKE A;  2WAQ A;  3UJ2 A;  1Q7Y 1;  1DL6 A;  4H4R A;  1XDI A;  1YIJ 1;  2JMO A;  4A3B I;  2QJN A;  1YJW Z;  1YQZ A;  5J04 A;  4TNU A;  4HH4 A;  5D1O A;  2DW7 A;  3R25 A;  2E2J I;  2W03 A;  4ENL A;  1K73 1;  4DWD A;  1YI2 1;  4E4U A;  3ZLG A;  4E31 A;  3RZD I;  1Q1W A;  3Q6J A;  2X8H A;  3CQZ I;  5FS7 A;  2JR6 A;  2ZAE B;  2J3N A;  1MNS A;  5JCL A;  4NBG A;  3VTN A;  2E9H A;  1SJB A;  3R07 C;  2HNE A;  2QAE A;  3FKI I;  3S47 A;  4HNC A;  5KVI A;  2V3A A;  3STP A;  1AA6 A;  2NVK X;  1TYP A;  4MD8 A;  1GV4 A;  3EEZ A;  4E6M A;  1YHQ 1;  1K8A 2;  3G4S 1;  3S16 I;  4GGB A;  1N2F A;  4GR1 A;  1Y1W I;  3EUB 3;  2V3B A;  1YJ9 Z;  1MUC A;  4GGH A;  5U25 A;  2LEX A;  3GCF A;  5C4X I;  3CMA Z;  2GR2 A;  2P8B A;  3CCV Z;  4MMW A;  5ER0 A;  2PMQ A;  1QVF Y;  1NPX A;  1YUA A;  1FEB A;  2GTH A;  5FS9 A;  3MWC A;  1TWG I;  3DGB A;  3H3V J;  3IF8 A;  4MD7 A;  1FHU A;  1JWH C;  1JPD X;  2PK7 A;  1EBG A;  2DW6 A;  1KD0 A;  1DNC A;  3KUM A;  2PCE A;  2ZZC A;  2AL2 B;  1H6V A;  4A3K I;  1OEP A;  5JCN A;  2C3D A;  1VQ6 1;  2HXT A;  2XH2 A;  3PFR A;  2JIM A;  4BXX I;  3P5J B;  3SJN A;  3DFY A;  1ONE A;  2WB1 A;  4JQ9 A;  4KPR A;  1GEU A;  4J1O A;  3FQQ A;  1FIQ B;  5C4J I;  1SB3 B;  3CT2 A;  3VCC A;  2YVG A;  5JCI A;  1N60 C;  3OZY A;  2RBL A;  3CCR Z;  4A3I I;  1XPY A;  2CFY A;  2WP5 A;  3DK8 A;  2JIP A;  1YUK A;  3NVZ B;  2XH4 A;  4YWS A;  5TR3 A;  1D7Y A;  1MDL A;  1Z01 A;  1BZL A;  1GRG A;  1Q86 2;  3CC4 1;  3CCJ Z;  3GTJ I;  2BJO A;  1FFV C;  2J6A A;  3G4S Z;  1Q81 1;  3I6T A;  3CB3 A;  4YWO A;  2K5R A;  1K9M 1;  3TOY A;  1GES A;  4HNL A;  4IP4 A;  4F4R A;  2DE5 A;  3MZK B;  2EQ9 A;  3SQS A;  2MUC A;  1F3P A;  3PO2 I;  1JJ2 Y;  1X2H A;  3OC4 A;  3UJR A;  3QPE A;  3QFA A;  4MKS A;  1ECQ A;  3DGH A;  1LQL A;  3Q87 A;  4RVG A;  4HPN A;  1VQ7 1;  4EWJ A;  1GRF A;  4GFI A;  1TWF I;  1LVL A;  2CDU A;  1PDY A;  1KKO A;  2NVT I;  3CCS 1;  4DNA A;  3A7R A;  4K8G A;  2PGW A;  2DE6 A;  5U1O A;  2JA7 I;  3GTM I;  3F3P C;  2GGJ A;  1TWC I;  3HOW I;  2POZ A;  6ENL A;  2EGT A;  1P48 A;  2PTW A;  2OTL Z;  1VQ6 Z;  2PTX A;  5C3E I;  2AYD A;  3G6E Z;  1KD1 2;  2GGE A;  3V4B A;  2PM9 A;  2PS2 A;  3NH5 A;  3S14 I;  2QJM A;  1NP6 A;  4H4Q A;  2P28 A;  3EER A;  4MH4 A;  1GRB A;  2EQ8 A;  1TWH I;  1GRT A;  1YJW 1;  1EBD A;  3DER A;  3NO1 A;  3SN4 A;  4A3G I;  3S2H I;  2ZC8 A;  1KC8 1;  1QVG Z;  3Q4D A;  3CCU 1;  5JRB A;  4HCH A;  2HQM A;  1N8R 2;  5LL6 f;  3DGZ A;  1S72 1;  3DK4 A;  2QKD A;  4AYB A;  2Q51 A;  1VQO Z;  2QR1 B;  1KQS Z;  3J7A 4;  2QJJ A;  3IX0 A;  3BSM A;  2IZ3 A;  1P9N A;  4A3C I;  3NVY B;  3P93 A;  1TZZ A;  4JN7 A;  4KPL A;  3S1R I;  2OVL A;  3CME Z;  1EC8 A;  1TKK A;  3KIF A;  2WOW A;  2ZZB A;  3LAD A;  4H1Z A;  4ADW A;  3T4N B;  4HGZ A;  2AL2 A;  1VQN 1;  4RV9 A;  3IR7 A;  4M0X A;  3RCY A;  3J81 f;  3SBF A;  3F3F C;  2WPF A;  1V59 A;  2R6M A;  3BJS A;  2XGZ A;  3R1Z A;  2QRC B;  1WII A;  1JDF A;  3CMA 1;  5JCM A;  2YAD A;  3CCV 1;  2V6O A;  3AM9 A;  3IJQ A;  3JZU A;  3CGC A;  2XH7 A;  3CYJ A;  2E2I I;  3ZLF A;  3DG6 A;  1VQL Z;  4NBF A;  3S5S A;  4MD9 A;  2QDE A;  2YAU A;  4H50 A;  3ZVH B;  2OO6 A;  4A6G A;  2HU9 A;  2O4H A;  4A3L I;  2FKP A;  1MDR A;  1R9T I;  1FEC A;  3VFC A;  1P43 A;  2GL5 A;  2JUB A;  2E5A A;  2EQ7 A;  3VMH A;  3S15 I;  1L1O C;  3RZO I;  3OPS A;  2QRE B;  3MY9 A;  3KLJ A;  3VB9 A;  1FEA A;  4A93 I;  1NUI A;  5G5H B;  2OTJ 1;  3NFU A;  2F4M A;  3CCU Z;  3CGD A;  2GRT A;  5JCK A;  3G71 Z;  1N62 C;  3R0U A;  4DK1 A;  1JOA A;  3OTR A;  3PG6 A;  3OW2 Y;  1ZB8 A;  4NBD A;  1S72 Z;  3FVD A;  1NHQ A;  2W0H A;  2GSH A;  3HPF A;  2PTY A;  3CCR 1;  3NH4 A;  3GTG I;  3CCL Z;  4TVW A;  5FMH A;  3PO3 I;  3FQM A;  3TJ4 A;  3KIH A;  3NZG A;  4H4Y A;  4K2S A;  3S1N I;  2LIY A;  3CCJ 1;  4X6A I;  1PDZ A;  5BOF A;  1AOG A;  1ELS A;  4EQR A;  1VQN Z;  3CCE 1;  3HOZ I;  3EED A;  4ZOH B;  3EMF A;  1T3Q C;  2XH0 A;  2AKM A;  2GGG A;  3R11 A;  4FI4 A;  2YVF A;  1F8W A;  4A3R A;  4EQX A;  2PSN A;  2AKL A;  1RO4 A;  1X0T A;  3VC6 A;  2PMZ A;  2QDD A;  4NH1 C;  3VC5 A;  1OJT A;  3GTM S;  3DH9 A;  3UXL A;  3UJF A;  2PPG A;  1EC7 A;  3RR1 A;  3VDG A;  2YU9 I;  2XSX A;  2B63 I;  1LPF A;  3AN1 A;  2BC1 A;  4KEM A;  3QN3 A;  3QTP A;  1RO2 A;  1Q82 1;  2JA8 I;  3H12 A;  4RVD A;  5IP7 I;  3RNM A;  4E30 A;  2KPI A;  1EC9 A;  1VLA A;  2X8G A;  4DX3 A;  1N8R 1;  1STZ A;  1ZMC A;  2A8X A;  2OTL 1;  4J56 A;  1KCZ A;  3G6E 1;  2OZ3 A;  2PP1 A;  3CC2 1;  4G8T A;  4H19 A;  1X2G A;  3H0G I;  2GDQ A;  2OTJ Z;  3NFZ A;  1L8P A;  4DGL A;  4H4V A;  4A3E I;  2EQ6 A;  3GO2 A;  4CL1 A;  2NPX A;  1ONF A;  2TPR A;  1QVG Y;  2R7Z I;  1DTN A;  4H4P A;  5FJU A;  2BCP A;  3GTQ I;  2E7Z A;  2R92 I;  3ZLH A;  3ZVH A;  5FJO A;  1VQO 1;  4H4W A;  1NHS A;  1VQP 1;  2I3C A;  3CXC Y;  1KQS Y;  3GD4 A;  4NFR A;  2V8J A;  3CCE Z;  1R0M A;  1M90 1;  2OG9 A;  3CPW Y;  2GR1 A;  7ENL A;  3MSY A;  2HF1 A;  3A7A A;  3CME 1;  2VPW A;  2W55 A;  3P0W A;  3GTK I;  3CCQ Z;  3DFH A;  3FYY A;  2GGI A;  3MUC A;  3B9J B;  3EAO A;  1PFT A;  2GGH A;  3LUS A;  4NBH A;  1VQ8 Z;  5KVH A;  1SJA A;  3D6W A;  1VQZ A;  3HRD C;  4J3Z A;  3DEQ A;  4K1W A;  2V45 A;  2RPR A;  1N5W C;  1H2I A;  4ZCW A;  1SIW A;  3DJJ A;  4M52 A;  4Z17 A;  1KRL A;  4H2H A;  2WOV A;  3GD3 A;  3T6C A;  3NVW B;  5IDZ A;  4A3D I;  2NAP A;  2VPY A;  5D1P A;  1WZN A;  1ZDL A;  1QF8 A;  3J80 b;  4GYP C;  1VQL 1;  2O56 A;  3B97 A;  4FX9 A;  2OOY B;  3GD6 A;  3UGV A;  1K73 2;  5FJT A;  2ONE A;  4E8G A;  4H4U A;  4NEV A;  2R93 I;  3R0K A;  3HOU I;  3CC2 Z;  1ZK7 A;  1GXF A;  1JRO A;  1JCT A;  2OQY A;  3DDM A;  4A3M I;  2WOI A; 
#chains in the Genus database with same CATH homology
 2YVJ A;  5D1O B;  1W2B Z;  2VF1 A;  3I56 1;  1QVF Z;  3PO3 S;  4S1T A;  2WBA A;  2ZZ0 A;  4Y7N I;  4H4X A;  3G71 1;  1K8A 1;  2NVQ I;  1ZKQ A;  3ESW A;  3CCM 1;  2F5Z A;  1TFI A;  1NJI 2;  3CCL 1;  1VQP Z;  3DJG X;  3I4N I;  3NDI A;  1WCM I;  2Y0S A;  4EMW A;  1GRE A;  1BWC A;  3S1Q I;  3I55 1;  3J80 f;  1MO9 A;  4QTU A;  3GTO I;  2VUM I;  3DK9 A;  3GKQ A;  4MXU A;  4E2Z A;  4EWC A;  1ZMD A;  4EMJ A;  4NBB A;  4NOZ A;  2K3R A;  3NH8 A;  5T64 A;  4E2W A;  1ZX9 A;  3IC9 A;  2OOX B;  1VQM 1;  1JEH A;  2QEX Z;  2M6N A;  3LB8 A;  3CD6 1;  5IT9 b;  2BC0 A;  4LII A;  3TDH B;  1Z02 A;  4E2Y A;  4BBR I;  4J57 A;  1JJ2 Z;  3EMI A;  1RNI A;  5FS6 A;  3I56 Z;  2QRD B;  2M48 A;  3FG2 P;  1Q86 1;  2X8C A;  1YJN Z;  4BY1 I;  4JDR A;  4MRI A;  1USP B;  3CCM Z;  3VMG A;  2GQW A;  1NHP A;  4MON A;  4RVF A;  4BY7 I;  4RS4 A;  3HOY I;  1I3Q I;  4E33 A;  1VQ4 Z;  5FLX b;  3LXD A;  4BBS I;  4Y52 I;  3S1M I;  4FDC B;  3IFU A;  2X99 A;  2GU2 A;  3I55 Z;  3L5O A;  1RQF A;  5T67 A;  3CCQ 1;  5AN9 F;  2OZK A;  4GRT A;  4APN A;  1GRA A;  3CGB A;  1VQ8 1;  1GSN A;  2F4O A;  5IT9 f;  5C44 I;  4A3J I;  4H4S A;  1ML8 A;  1KD1 1;  3GRT A;  1VQM Z;  1Q1R A;  2WPC A;  3I07 A;  3CD6 Z;  3BG1 B;  1YIT Z;  2W04 A;  2G2K A;  2X50 A;  4K8D A;  4NBE A;  3NDJ A;  1M6I A;  3M3Y I;  1KC8 2;  3EAN A;  3MON A;  4XX2 A;  1VQ5 Z;  1XAN A;  1Y1V S;  1NJI 1;  3QWU A;  3GTL I;  1WW9 A;  3HKZ A;  4H4Z A;  1W2B Y;  3TE5 B;  5FLX f;  4NB8 A;  2QA4 1;  1VQ9 1;  1M1K 2;  2WP6 A;  1SFO I;  3URH A;  5FLM I;  3K7A I;  5EBK A;  1GER A;  4BUR A;  3HOV I;  3CGE A;  5IP9 I;  1MOK A;  4DQY B;  2NVX I;  5FS8 A;  4EQS A;  2Q4Z A;  1YIJ Z;  1DXL A;  4A3F I;  1S7M A;  2GH5 A;  3H4K A;  2KI7 B;  3D9X A;  4EMI A;  1YI2 Z;  3EF6 A;  3OW2 Z;  4NEW A;  3MZL B;  2JNY A;  3BG0 B;  4H4T A;  1Q7Y 2;  5GRT A;  1USP A;  1K83 I;  2VUG A;  4NBA A;  2DE7 A;  4E2X A;  3L8K A;  3U50 C;  2WPE A;  2QEX 1;  2RT9 A;  1YHQ Z;  3QFB A;  4NBC A;  2E2H I;  1Z03 A;  3JAM b;  4K7Z A;  5A2Q b;  1VQ9 Z;  2QA4 Z;  2JS4 A;  1YJN 1;  1ZH1 A;  1X3W A;  3M4O I;  2RAB A;  1Y1V I;  3CC7 1;  3O0H A;  1QYP A;  2JA5 I;  2O53 A;  1K4Q A;  3J81 b;  2H85 A;  2GR0 A;  1RO0 A;  2GTI A;  4EQW A;  1VQ4 1;  2V8K A;  1VQK 1;  3S17 I;  3I4M I;  2JA6 I;  2R9Z A;  2V8I A;  1NDA A;  3SQP A;  1XHC A;  2YQU A;  1NHR A;  2RHB A;  1TWA I;  1Q82 2;  2RIQ A;  3HOX I;  1GRH A;  4BV6 A;  4QTT A;  5T6B A;  3CXC Z;  2AAQ A;  4E32 A;  3S2D I;  1I50 I;  3CC4 Z;  3JAM f;  2LFU A;  3CPW Z;  1YIT 1;  1X3Z A;  5A2Q f;  1M1K 1;  3II4 A;  4HGY A;  2JK6 A;  3VMI A;  5CM2 M;  1VQ5 1;  1TYT A;  1YJ9 1;  1VQ7 Z;  2IZ4 A;  1I6H I;  2GR3 A;  1ZB9 A;  1Q81 2;  1M90 2;  3GRS A;  1K9M 2;  3CC7 Z;  3CCS Z;  4LA1 A;  4EM3 A;  4EM4 A;  2QLV B;  3GTP I;  2C3C A;  1RLY A;  1KN0 A;  4NB9 A;  2P3Y A;  1GET A;  1ZY8 A;  2NVY I;  4RVH A;  1VQK Z;  2WAQ A;  1Q7Y 1;  1DL6 A;  4H4R A;  1XDI A;  1YIJ 1;  2JMO A;  4A3B I;  1YJW Z;  1YQZ A;  4TNU A;  4HH4 A;  5D1O A;  2E2J I;  2W03 A;  1K73 1;  1YI2 1;  4E31 A;  3RZD I;  1Q1W A;  3Q6J A;  2X8H A;  3CQZ I;  5FS7 A;  2JR6 A;  2ZAE B;  2J3N A;  5JCL A;  4NBG A;  3VTN A;  2E9H A;  2QAE A;  3FKI I;  5KVI A;  2V3A A;  2NVK X;  1TYP A;  4MD8 A;  1GV4 A;  1YHQ 1;  1K8A 2;  3G4S 1;  3S16 I;  1N2F A;  4GR1 A;  1Y1W I;  2V3B A;  1YJ9 Z;  5U25 A;  3GCF A;  5C4X I;  3CMA Z;  2GR2 A;  3CCV Z;  5ER0 A;  1QVF Y;  1NPX A;  1YUA A;  1FEB A;  2GTH A;  5FS9 A;  1TWG I;  3H3V J;  3IF8 A;  4MD7 A;  1JWH C;  2PK7 A;  1DNC A;  2ZZC A;  1H6V A;  4A3K I;  5JCN A;  2C3D A;  1VQ6 1;  4BXX I;  3P5J B;  4JQ9 A;  2WB1 A;  4KPR A;  1GEU A;  3FQQ A;  5C4J I;  5JCI A;  2YVG A;  2RBL A;  3CCR Z;  4A3I I;  2CFY A;  2WP5 A;  3DK8 A;  5TR3 A;  1YUK A;  1D7Y A;  1Z01 A;  1BZL A;  1GRG A;  1Q86 2;  3CC4 1;  3CCJ Z;  3GTJ I;  2BJO A;  2J6A A;  3G4S Z;  1Q81 1;  4YWO A;  2K5R A;  1K9M 1;  1GES A;  2DE5 A;  3MZK B;  2EQ9 A;  1F3P A;  3PO2 I;  1JJ2 Y;  3OC4 A;  3QFA A;  3DGH A;  1LQL A;  3Q87 A;  4RVG A;  1VQ7 1;  1GRF A;  1TWF I;  1LVL A;  2CDU A;  2NVT I;  3CCS 1;  4DNA A;  2DE6 A;  5U1O A;  2JA7 I;  3GTM I;  3F3P C;  1TWC I;  3HOW I;  2EGT A;  2OTL Z;  1VQ6 Z;  5C3E I;  3G6E Z;  1KD1 2;  2PM9 A;  3NH5 A;  3S14 I;  4H4Q A;  1NP6 A;  2P28 A;  3EER A;  4MH4 A;  1GRB A;  2EQ8 A;  1TWH I;  1GRT A;  1YJW 1;  1EBD A;  4A3G I;  3S2H I;  1KC8 1;  1QVG Z;  3CCU 1;  5JRB A;  2HQM A;  1N8R 2;  5LL6 f;  3DGZ A;  1S72 1;  3DK4 A;  2QKD A;  4AYB A;  2Q51 A;  1VQO Z;  2QR1 B;  1KQS Z;  3J7A 4;  3IX0 A;  2IZ3 A;  1P9N A;  4A3C I;  3S1R I;  2WOW A;  3CME Z;  3LAD A;  4ADW A;  3KIF A;  2ZZB A;  3T4N B;  4HGZ A;  1VQN 1;  4RV9 A;  3J81 f;  3F3F C;  2WPF A;  1V59 A;  2R6M A;  2QRC B;  1WII A;  3CMA 1;  5JCM A;  2YAD A;  3CCV 1;  2V6O A;  3CGC A;  2E2I I;  1VQL Z;  4NBF A;  4MD9 A;  2YAU A;  4H50 A;  2HU9 A;  2O4H A;  4A3L I;  1R9T I;  1FEC A;  2JUB A;  2EQ7 A;  3VMH A;  3S15 I;  1L1O C;  3RZO I;  2QRE B;  3KLJ A;  3VB9 A;  1FEA A;  4A93 I;  1NUI A;  2OTJ 1;  2F4M A;  3CCU Z;  3CGD A;  2GRT A;  5JCK A;  3G71 Z;  4DK1 A;  1JOA A;  3PG6 A;  3OW2 Y;  1ZB8 A;  4NBD A;  1S72 Z;  1NHQ A;  2W0H A;  3CCR 1;  3NH4 A;  3GTG I;  3CCL Z;  5FMH A;  3PO3 I;  3FQM A;  3KIH A;  4H4Y A;  3S1N I;  2LIY A;  3CCJ 1;  4X6A I;  1AOG A;  4EQR A;  1VQN Z;  3CCE 1;  3HOZ I;  3EED A;  3EMF A;  2YVF A;  1F8W A;  4EQX A;  2AKL A;  1RO4 A;  1X0T A;  2PMZ A;  4NH1 C;  1OJT A;  3GTM S;  3DH9 A;  2YU9 I;  2B63 I;  1LPF A;  2BC1 A;  1RO2 A;  1Q82 1;  2JA8 I;  4RVD A;  5IP7 I;  3RNM A;  4E30 A;  2KPI A;  2X8G A;  1VLA A;  1N8R 1;  1ZMC A;  2A8X A;  2OTL 1;  4J56 A;  3G6E 1;  3CC2 1;  3H0G I;  2OTJ Z;  3NFZ A;  4DGL A;  4H4V A;  4A3E I;  2EQ6 A;  4CL1 A;  2NPX A;  1ONF A;  2TPR A;  1QVG Y;  2R7Z I;  4H4P A;  2BCP A;  3GTQ I;  2R92 I;  1VQO 1;  4H4W A;  1NHS A;  1VQP 1;  2I3C A;  3CXC Y;  1KQS Y;  3GD4 A;  4NFR A;  2V8J A;  3CCE Z;  1M90 1;  3CPW Y;  2GR1 A;  2HF1 A;  3CME 1;  3GTK I;  3CCQ Z;  3EAO A;  1PFT A;  3LUS A;  4NBH A;  1VQ8 Z;  5KVH A;  3D6W A;  2RPR A;  1H2I A;  3DJJ A;  4M52 A;  1KRL A;  2WOV A;  3GD3 A;  4A3D I;  5D1P A;  1ZDL A;  1QF8 A;  3J80 b;  1VQL 1;  4FX9 A;  2OOY B;  1K73 2;  4H4U A;  4NEV A;  2R93 I;  3HOU I;  3CC2 Z;  1ZK7 A;  1GXF A;  4A3M I;  2WOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...