1S7MA

Crystal structure of hiabd1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
158
Chain Sequence
GAKTEINKDGLTITPANGAGANNANTISVTKDGISAGGQSVKNVVSGLKKFGDANFDPLTSSADNLTKQNDDAYKGLTNLDEKGTDKQTPVVADNTAATVGDLRGLGWVISADKTTGGSTEYHDQVRNANEVKFKSGNGINVSGKTVNGRREITFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hia
publication title Structural basis for host recognition by the Haemophilus influenzae Hia autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
total genus 27
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15403 HiaBD2 HiaBD2_N domain of Trimeric autotransporter adhesin (GIN)
A PF18669 Trp_ring Trimeric autotransporter adhesin Trp ring domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.140 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s7mA03
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1s7mA01
3.90.1780.10 Alpha Beta Alpha-Beta Complex Trimeric adhesin Trimeric adhesin 1s7mA02
3D9XA 3EMIA 3EMFA 1S7MA
chains in the Genus database with same CATH superfamily
4AYBA 4H4SA 4H2HA 3CCM1 3CCEZ 2DE6A 3CXCZ 1GERA 1SJCA 3CAWA 2JIQA 1M1K1 3FXGA 2OTL1 3CC41 4Y52I 3NH8A 2P8CA 2OQYA 2ZZ0A 1VQNZ 3J81f 1YHQ1 1ZB8A 3NS1B 4HCDA 5JRBA 2EQ9A 1RO2A 2QJJA 1DXLA 3S5SA 3S15I 3FQQA 3VMGA 3CCJZ 3D2LA 1K732 3OZMA 4M6UA 4MKSA 1WW9A 1FEBA 2R93I 1YQZA 3URHA 1X3ZA 4K7ZA 5FS9A 1VQ51 1R0MA 3F3PC 2EQ7A 2W55A 1NJI2 3QLDA 3CCV1 4FDCB 4TVYA 1DTNA 4KT2A 5FJOA 3UCDA 2O4HA 2X50A 3CC7Z 1TZZA 1L1OC 3VCNA 3P5JB 1YI21 3J7A4 2FKPA 1Q16A 3GTKI 4K2SA 3EMFA 4E2ZA 3I4KA 3GD6A 4MXUA 3K7AI 2R92I 4JN7A 2GGJA 4FX9A 1M1K2 3S1RI 1FEAA 1QVFZ 4HYRA 1WYGA 2E7ZA 3NVVB 3G6EZ 5JCMA 1H2IA 2HQMA 3DERA 1TE6A 3Q6JA 3THUA 5FLXb 3CD61 4A6GA 3G71Z 3DK8A 2OKTA 1Y1WI 3ZLFA 2RPRA 2RIQA 3OP2A 1NHRA 2JK6A 2JIOA 3SN0A 4GGHA 4HPNA 3RCYA 3GY1A 2GGGA 3HOUI 4A3RA 3GD4A 4NBHA 3HOXI 2CFYA 2QEX1 2VUGA 1NU5A 2OZ3A 3CXBA 3DG6A 5TR3A 3TCSA 2JR6A 3RZOI 3CCE1 1MDRA 1FECA 1Z02A 3IX0A 1GXFA 2PSNA 4KPRA 2V8IA 5FJUA 2PTYA 3NFZA 1MOKA 2W3SA 1LPFA 4X6AI 3NVYB 4FI4A 2AKMA 1TYTA 1AA6A 3EANA 3ZLHA 3CCJ1 2LFUA 1ZK7A 2WPFA 3TDHB 2WPEA 3H4KA 3FJ4A 3OW2Z 4A3MI 1X2HA 3Q4DA 2PTWA 3GC2A 1WUFA 2ZZCA 3VFCA 4HH4A 4E4UA 3I56Z 1ZMDA 3A7RA 4MMWA 3U4FA 1T3QC 3TTEA 4QTTA 3R0KA 1F8WA 5FLXf 3SQSA 1FIQB 2BCPA 2CHRA 1VDVA 5EBKA 2IZ4A 5IT9b 3HOZI 2P28A 5AN9F 3CC71 1YIJ1 2BC1A 1GETA 3BJSA 4BURA 3K1GA 2EGTA 4MH4A 2NVYI 3VB9A 4MRIA 3OZYA 2YQUA 2WAQA 2B63I 3CCL1 4IP5A 2MUCA 1SFOI 2JIRA 1K8A2 2F4OA 1NPXA 2GQWA 2QAEA 1P43A 2WP5A 3G6E1 1TWCI 2QJMA 4A3KI 1N60C 2PODA 2F5ZA 2ONEA 3I551 2JUBA 3G711 2HXUA 3NO1A 3CB3A 4ZA0A 1YEYA 2X8CA 4J57A 4HNLA 3FV9A 1ZY8A 2WB1A 2I5QA 1ZMCA 1VQK1 2X99A 3VC6A 1JJ2Z 1BQGA 4H4PA 1VQ9Z 2PP0A 3NDJA 1KD11 2K5RA 3GTLI 2E2JI 1FO4A 3ZLGA 4MGGA 3RO6A 3CC21 4BY7I 1PDZA 2DW6A 3PWIA 4E5TA 1VQP1 1KQSY 2PTZA 4E2YA 1JPMA 2M48A 5FMHA 5IT9f 3D6WA 2YAUA 3FG2P 2K3RA 4IL0A 4EQWA 2R7ZI 1I3QI 2XH0A 5EU9A 2GTIA 2ZC8A 3M3YI 2PU0A 3SR6B 3QFBA 1QYPA 5BOFA 1I6HI 3D9XA 2E9HA 4GMEA 3HOWI 1ML8A 3BOXA 2W0HA 3S17I 3MSYA 3MZLB 3H3VJ 1XHCA 3TW9A 3CMEZ 4HGZA 3UJSA 1W6TA 3L8KA 4NBFA 1ZKQA 4K8GA 3RRAA 5JCNA 3EERA 2A8XA 1N62C 1ZX9A 4A3II 1P48A 2OVLA 3DFHA 4HCLA 3RR1A 5C4JI 1NUIA 1USPB 2BJOA 3S1NI 2PTXA 1TWFI 1W2BY 2WPCA 2P88A 1Q1RA 1GESA 2GGEA 2RDXA 4NH1C 4YWOA 4TVWA 1RLYA 3HKZA 1VQ6Z 3FKII 3BG0B 5G5GB 1FHVA 1JRPA 4RS4A 2OOXB 3DGZA 3S16I 4E33A 1ZXIC 1OEPA 2AAQA 3R1ZA 1GRTA 3H8AA 3NVWB 3JW7A 4A3DI 1KCZA 1TYPA 3MONA 3CGEA 3ESWA 5LL6f 3H7VA 2PP1A 1YITZ 3NFUA 3SSZA 4EMJA 2VPYA 1QVGY 4MD8A 4MD9A 1JEHA 5FS7A 1NHSA 5C4XI 2OLAA 3HPFA 2FYMA 2RBLA 2XH2A 4GYPC 3TQPA 1RM6B 1P9NA 1EC9A 1NP6A 4NBBA 3LXDA 3B9JB 5U25A 3CQZI 3VC5A 2XH4A 3P3BA 1N8R1 3QN3A 3R25A 3T4WA 1Y1VS 3BG1B 4DGLA 4H4VA 1M901 2GL5A 3GO2A 4KEMA 3VDGA 3JZUA 2R9ZA 4XX2A 4CL1A 2XH7A 2RT9A 3LUSA 4BBSI 2NVKX 2PS2A 2OFJA 3MQTA 5FJPA 3M4OI 4NEWA 4DWDA 1VQ8Z 2BC0A 3U50C 1X3WA 4NBEA 1X2GA 3AMZA 2C3DA 3O0HA 1Q861 3J80b 1USPA 2JMOA 2OOYB 4H4QA 1KRLA 2OZKA 3VMIA 3KIHA 3ENLA 2DE7A 3DG3A 4J3ZA 1SJBA 5GRTA 4GFIA 3H0GI 3T9PA 3G4SZ 2LIYA 2V3BA 4MONA 4BBRI 2X8GA 1RVKA 4E32A 1VQ7Z 3N6JA 2XGZA 4A93I 3CGDA 4DK1A 2QREB 4LIIA 1JROA 2POZA 1PFTA 4A3FI 2NQLA 4H83A 3I4MI 1MNSA 1GRFA 4J1OA 3QTPA 3V4BA 3V3WA 2JIMA 1N8R2 3DG7A 1VQOZ 3I6EA 4E8GA 3IR7A 2OZTA 4EQXA 1M902 3N4EA 1FDOA 1KD0A 4JHMA 2YVJA 4E30A 1S72Z 3EEDA 3AM9A 4K8DA 4LA1A 3FYYA 3VA8A 5IDZA 1DNCA 1TFIA 3N4FA 3V5FA 1VQN1 3NZGA 2GGIA 4EMIA 3P0WA 4J56A 4M0XA 3S14I 1STZA 1GV4A 2G2KA 3EF6A 2CDUA 1Q862 2J3NA 3S2HI 4H50A 3UCCA 3PK7A 3VCCA 3GTPI 2WP6A 1BWCA 4FP1A 3J80f 1JCTA 1F3PA 4A35A 2LEXA 1YJ9Z 4F4RA 1YJWZ 2XSXA 1WUEA 4RVGA 1M6IA 1N2FA 2F4MA 2I3CA 1VQ4Z 1Z03A 3A7AA 3DK4A 4H4XA 3CCUZ 3CXCY 4ENLA 5JCIA 4H4TA 3GKQA 2QGYA 2GTHA 2GU2A 4E2WA 4DNAA 3EMIA 1EC8A 3GTMI 3B97A 1GEUA 3JVAA 2GR2A 3CK5A 3PO3S 4ADWA 4DXKA 1JWHC 2NVXI 5IP7I 1RO4A 1K83I 3BSMA 2QKDA 1KN0A 4ZCWA 2VPWA 4GR1A 4EQSA 5BOEA 3IJQA 3GTJI 1VQ71 3CCQZ 2EQ6A 3RGTA 4BY1I 5FJTA 3NXLA 3SN1A 2NPXA 2PMQA 1PDYA 1R6WA 4JN8A 2GH5A 2P0IA 3F3FC 1YJNZ 4NEVA 2PK7A 3CPWY 2JNYA 1SJDA 3EAOA 3DEQA 3TJIA 1VQMZ 2O56A 2GRTA 2QRCB 3DFYA 3L5OA 3DIPA 4Y7NI 2YADA 1S721 3S2DI 1GRHA 3CCMZ 2GR0A 3DK9A 1QVFY 3P93A 3NVZB 4EWCA 1Q811 2JA8I 2OTLZ 1GRAA 3RZDI 3MUCA 1MO9A 4TNUA 5FLMI 3QFAA 3PG6A 3D47A 1QF8A 2P3YA 1SJAA 1YHQZ 3KIFA 4H4YA 1TWAI 2J6AA 1XPYA 5ER0A 2W54A 1Y8CA 3CMAZ 1N5WC 2E5AA 2AKLA 3I561 1YJW1 1EBGA 5C3EI 1H6VA 3IJLA 1IYXA 1VQZA 4H4WA 1X0TA 3D46A 2GR1A 3VTNA 3FCPA 2PU1A 3R10A 2QDEA 4M52A 4NB9A 4A3JI 1MDLA 3CCVZ 2QDDA 3DJGX 3J81b 1KKRA 4E2XA 3JAMb 1GREA 3OC4A 1KD12 3ES7A 1WJ2A 1YI2Z 3UXLA 4H1ZA 1GRBA 2ZADA 2HU9A 2ZAEB 2NAPA 1K731 3I4NI 3I07A 1DL6A 3EKGA 1Q812 2QA4Z 3CCQ1 4A3CI 1TWHI 1R9TI 2OPJA 4H19A 3CD6Z 5D1OB 3PWGA 4IHCA 3IC9A 5JCKA 2VPXA 1EBDA 2MNRA 1Y1VI 3HW2A 5KVIA 1L8PA 1FHUA 2IV2X 1NHPA 4DYEA 1VQ91 3ZVHA 1RQFA 1KC81 2P3ZA 3H12A 1KKOA 1XDIA 1I50I 2JS4A 2QEXZ 5IP9I 1EC7A 1BKHA 3NRZB 1OJTA 1EBHA 1SIWA 1N63C 1AOGA 3OTRA 4K1WA 4RV9A 2C3CA 2IZ3A 3DJJA 2YVFA 4GIRA 4RVDA 2TPRA 4IT1A 3U9IA 5CM2M 4A3LI 4NB8A 4EMWA 2AL2A 3ETRB 3JAMf 3SQPA 4YWSA 3UJRA 2OZ8A 3T6CA 2PCEA 5A2Qb 2Y0SA 3CMA1 3CGBA 4H4ZA 3CCSZ 2JA6I 3DGBA 2V8JA 4QTUA 3CME1 1JJ2Y 3QPEA 4DX3A 1Q7Y1 4G8TA 2Q4ZA 2JA7I 3R11A 4DN1A 3II4A 1E9IA 1FFUC 4E4FA 2GGHA 4G7FA 3T8QA 4JDRA 2NVTI 2QR1B 5D1OA 3T4NB 2QRDB 3CPWZ 3STPA 1YIJZ 1KC82 3CYJA 1V97A 4E6MA 4MD7A 4ROPA 3CCRZ 1NHQA 1VQ61 2AYDA 2E2II 5T64A 4NFRA 4S1TA 1JOAA 1MRAA 1MUCA 3S47A 4BV6A 3NDIA 2V6OA 4Z17A 3CCLZ 3MKCA 4GGBA 3SJNA 2QA41 3MWCA 4JQ9A 1KQSZ 1YIT1 4NOZA 2VUMI 2HZGA 2DW7A 4RVHA 2E2HI 3I55Z 1LQLA 3R0UA 2WOIA 2OTJZ 3DH9A 3GRTA 1K9M1 1RNIA 7ENLA 2WOWA 3V5CA 5G5HB 2OO6A 5A2Qf 2PGEA 2WBAA 1VQKZ 6ENLA 3CGCA 1TWGI 2X8HA 2KI7B 4GISA 1Q7Y2 1JPDX 3DGHA 1ECQA 1GSNA 3NH4A 2W3RA 4HGYA 1LVLA 1K8A1 4H4RA 3PFRA 1VQLZ 3PO3I 2HXTA 2O53A 3CC2Z 1VQ81 1SB3B 4KWSA 4NBAA 1W2BZ 3GTGI 3KUMA 2R6MA 1VQPZ 2YU9I 1GRGA 2P8BA 3UJFA 3IFUA 5D1PA 4GRTA 4X2PA 3UGVA 2W03A 4IZGA 3UXKA 3UJEA 3G4S1 3RNMA 3FQMA 3CCS1 1WCMI 4KPLA 2QQ6A 2PM9A 3IF8A 3UJ2A 4E31A 2HNEA 1RO0A 2H85A 2V3AA 3CT2A 3CXOA 3PO2I 4RVFA 2V45A 1QVGZ 3SBFA 3S1MI 1K4QA 4IP4A 1K9M2 5FS8A 4EWJA 1ZB9A 1ELSA 3N6HA 3GTOI 5FS6A 2W04A 3QWUA 2JA5I 1VQO1 1S7MA 3TOYA 5JCLA 2GR3A 3CCR1 2PA6A 4HCHA 1ONFA 2OG9A 2PGWA 3SN4A 2WOVA 1ZDLA 3I6TA 3ES8A 3FVDA 3GTMS 1FFVC 3IK4A 4EM3A 3TJ4A 2VPZA 3R07C 3CC4Z 1Q1WA 3LB8A 2GSHA 5U1OA 1XS2A 3HOVI 2OTJ1 2AL1A 3GD3A 3ZVHB 2AKZA 2Q51A 4NBCA 4EM4A 4A3BI 3GCFA 1YJ91 3QKEA 3Q87A 4DHGA 2PMZA 2NVQI 2QVHA 2YVGA 2KPIA 1Q821 1YUAA 1N5XA 2HF1A 4A3GI 5KVHA 5T6BA 2JIPA 1VQ41 1D7YA 2GDQA 3CCU1 2ZZBA 4APNA 2RHBA 1VQ5Z 1F9CA 3OW1A 4GYPA 2DE5A 1Z01A 3TE5B 2M6NA 5T67A 1VQL1 3GRSA 5J04A 2PP3A 3IJIA 2EQ8A 3GTQI 2AL2B 3MZNA 3HRDC 4DQYB 3VMHA 3KLJA 1N61C 3NH5A 3EEZA 1WZNA 4EQRA 2V8KA 5C44I 4H4UA 4NBDA 3ZVIA 3DDMA 3HOYI 1FDIA 1V59A 4IL2A 2V3VA 1NELA 2OX4A 3DESA 3AN1A 3OW2Y 2OQHA 2PPGA 1YUKA 3S1QI 1WIIA 3LADA 1BZLA 4ZOHB 1NDAA 4HN8A 4A3EI 3MY9A 2QJNA 2VF1A 3A7UA 4BXXI 1QXFA 1XANA 3H70A 4HNCA 5ENLA 3TWBA 1NJI1 2QLVB 3OPSA 1YJN1 3Q45A 2E3TA 1ZH1A 1ONEA 4NBGA 1Q822 5FJRA 4Z1YA 1VQM1 1JDFA 2RABA 3TWAA 3MZKB 1VLAA 3EUB3 1TKKA 3RITA
chains in the Genus database with same CATH topology
4AYBA 4H4SA 3CCM1 3CCEZ 2DE6A 3CXCZ 1GERA 1M1K1 2OTL1 3CC41 4Y52I 3NH8A 2ZZ0A 1VQNZ 3J81f 1YHQ1 1ZB8A 5JRBA 2EQ9A 1RO2A 1DXLA 3S15I 3FQQA 3VMGA 3CCJZ 1K732 1WW9A 1FEBA 2R93I 1YQZA 3URHA 1X3ZA 4K7ZA 5FS9A 1VQ51 3F3PC 2EQ7A 1NJI2 3CCV1 4FDCB 2O4HA 2X50A 3CC7Z 1L1OC 3P5JB 1YI21 3J7A4 3GTKI 3EMFA 4E2ZA 4MXUA 3K7AI 2R92I 4FX9A 1M1K2 3S1RI 1FEAA 1QVFZ 5JCMA 3G6EZ 1H2IA 2HQMA 3Q6JA 5FLXb 3CD61 3G71Z 3DK8A 1Y1WI 2RPRA 2RIQA 1NHRA 2JK6A 3HOUI 3GD4A 4NBHA 3HOXI 2CFYA 2QEX1 2VUGA 5TR3A 2JR6A 3RZOI 3CCE1 1FECA 1Z02A 3IX0A 1GXFA 4KPRA 2V8IA 3NFZA 1MOKA 1LPFA 4X6AI 1TYTA 3EANA 3CCJ1 2LFUA 1ZK7A 2WPFA 3TDHB 2WPEA 3H4KA 3OW2Z 4A3MI 2ZZCA 4HH4A 3I56Z 1ZMDA 4QTTA 1F8WA 5FLXf 2BCPA 5EBKA 2IZ4A 5IT9b 3HOZI 2P28A 5AN9F 3CC71 1YIJ1 2BC1A 1GETA 4BURA 2EGTA 4MH4A 2NVYI 3VB9A 4MRIA 2YQUA 2WAQA 2B63I 3CCL1 1SFOI 1K8A2 2F4OA 1NPXA 2GQWA 2QAEA 2WP5A 3G6E1 1TWCI 4A3KI 2F5ZA 3I551 2JUBA 3G711 2X8CA 4J57A 1ZY8A 2WB1A 1ZMCA 1VQK1 2X99A 1JJ2Z 4H4PA 1VQ9Z 3NDJA 1KD11 2K5RA 3GTLI 2E2JI 3CC21 4BY7I 1VQP1 1KQSY 4E2YA 2M48A 5FMHA 5IT9f 3D6WA 2YAUA 3FG2P 2K3RA 4EQWA 2R7ZI 1I3QI 2GTIA 3M3YI 3QFBA 1QYPA 1I6HI 3D9XA 2E9HA 3HOWI 1ML8A 2W0HA 3S17I 3MZLB 3H3VJ 1XHCA 3CMEZ 4HGZA 3L8KA 4NBFA 1ZKQA 5JCNA 3EERA 2A8XA 1ZX9A 4A3II 5C4JI 1NUIA 1USPB 2BJOA 3S1NI 2WPCA 1TWFI 1W2BY 1Q1RA 1GESA 4YWOA 4NH1C 1RLYA 3HKZA 1VQ6Z 3FKII 3BG0B 4RS4A 2OOXB 3DGZA 3S16I 4E33A 2AAQA 1GRTA 4A3DI 1TYPA 3MONA 3CGEA 3ESWA 5LL6f 1YITZ 4EMJA 1QVGY 4MD8A 4MD9A 1JEHA 5FS7A 1NHSA 5C4XI 2RBLA 1P9NA 1NP6A 4NBBA 3LXDA 5U25A 3CQZI 1N8R1 1Y1VS 3BG1B 4DGLA 4H4VA 1M901 2R9ZA 4XX2A 4CL1A 2RT9A 3LUSA 4BBSI 2NVKX 3M4OI 4NEWA 1VQ8Z 2BC0A 3U50C 1X3WA 4NBEA 3O0HA 2C3DA 1Q861 3J80b 1USPA 2JMOA 2OOYB 4H4QA 1KRLA 2OZKA 3VMIA 3KIHA 5GRTA 2DE7A 3H0GI 3G4SZ 2LIYA 2V3BA 4MONA 4BBRI 2X8GA 4E32A 1VQ7Z 4A93I 3CGDA 4DK1A 2QREB 4LIIA 1PFTA 4A3FI 3I4MI 1GRFA 1N8R2 1VQOZ 4EQXA 1M902 2YVJA 4E30A 1S72Z 3EEDA 4K8DA 4LA1A 1DNCA 1TFIA 1VQN1 4EMIA 4J56A 3S14I 1GV4A 2G2KA 3EF6A 2CDUA 1Q862 2J3NA 3S2HI 4H50A 3GTPI 2WP6A 1BWCA 3J80f 1F3PA 1YJ9Z 1YJWZ 4RVGA 1M6IA 1N2FA 2F4MA 2I3CA 1VQ4Z 1Z03A 3DK4A 4H4XA 3CCUZ 3CXCY 5JCIA 4H4TA 3GKQA 2GTHA 2GU2A 4E2WA 4DNAA 3EMIA 3GTMI 1GEUA 2GR2A 3PO3S 4ADWA 1JWHC 2NVXI 5IP7I 1RO4A 1K83I 2QKDA 1KN0A 4GR1A 4EQSA 3GTJI 1VQ71 3CCQZ 2EQ6A 4BY1I 2NPXA 2GH5A 3F3FC 1YJNZ 4NEVA 2PK7A 3CPWY 2JNYA 3EAOA 1VQMZ 2GRTA 2QRCB 3L5OA 4Y7NI 2YADA 1S721 3S2DI 1GRHA 3CCMZ 2GR0A 3DK9A 1QVFY 4EWCA 1Q811 2JA8I 2OTLZ 1GRAA 3RZDI 1MO9A 4TNUA 5FLMI 3QFAA 3PG6A 1QF8A 2P3YA 1YHQZ 3KIFA 4H4YA 1TWAI 2J6AA 5ER0A 3CMAZ 2AKLA 3I561 1YJW1 5C3EI 1H6VA 4H4WA 1X0TA 2GR1A 3VTNA 4M52A 4NB9A 4A3JI 3CCVZ 3DJGX 3J81b 4E2XA 3JAMb 1GREA 3OC4A 1KD12 1YI2Z 1GRBA 2HU9A 2ZAEB 1K731 3I4NI 3I07A 1DL6A 1Q812 2QA4Z 3CCQ1 4A3CI 1TWHI 1R9TI 3CD6Z 5D1OB 3IC9A 5JCKA 1EBDA 1Y1VI 5KVIA 1NHPA 1VQ91 1RQFA 1KC81 1XDIA 1I50I 2JS4A 2QEXZ 5IP9I 1OJTA 1AOGA 4RV9A 2C3CA 2IZ3A 3DJJA 2YVFA 4RVDA 2TPRA 5CM2M 4A3LI 4NB8A 4EMWA 3JAMf 3SQPA 5A2Qb 2Y0SA 3CMA1 3CGBA 4H4ZA 3CCSZ 2JA6I 2V8JA 4QTUA 3CME1 1JJ2Y 1Q7Y1 2Q4ZA 2JA7I 3II4A 4JDRA 2NVTI 2QR1B 5D1OA 3T4NB 2QRDB 3CPWZ 1YIJZ 1KC82 4MD7A 3CCRZ 1NHQA 1VQ61 2E2II 1JOAA 5T64A 4NFRA 4S1TA 4BV6A 3NDIA 2V6OA 3CCLZ 2QA41 4JQ9A 1KQSZ 1YIT1 4NOZA 2VUMI 4RVHA 2E2HI 3I55Z 1LQLA 2WOIA 2OTJZ 3DH9A 3GRTA 1K9M1 1RNIA 2WOWA 5A2Qf 2WBAA 1VQKZ 3CGCA 1TWGI 2X8HA 2KI7B 1Q7Y2 3DGHA 1GSNA 3NH4A 4HGYA 1LVLA 1K8A1 4H4RA 1VQLZ 3PO3I 2O53A 3CC2Z 1VQ81 4NBAA 1W2BZ 3GTGI 2R6MA 1VQPZ 2YU9I 1GRGA 3IFUA 5D1PA 4GRTA 2W03A 3G4S1 3RNMA 3FQMA 3CCS1 1WCMI 2PM9A 3IF8A 4E31A 1RO0A 2H85A 2V3AA 3PO2I 4RVFA 1QVGZ 3S1MI 1K4QA 1K9M2 5FS8A 1ZB9A 3GTOI 5FS6A 2W04A 3QWUA 2JA5I 1VQO1 1S7MA 5JCLA 2GR3A 3CCR1 1ONFA 2WOVA 1ZDLA 3GTMS 4EM3A 3CC4Z 1Q1WA 3LB8A 5U1OA 3HOVI 2OTJ1 3GD3A 2Q51A 4NBCA 4EM4A 4A3BI 3GCFA 1YJ91 3Q87A 2PMZA 2NVQI 2YVGA 2KPIA 1Q821 1YUAA 2HF1A 4A3GI 5KVHA 5T6BA 1VQ41 1D7YA 3CCU1 2ZZBA 4APNA 2RHBA 1VQ5Z 2DE5A 1Z01A 3TE5B 2M6NA 5T67A 1VQL1 3GRSA 2EQ8A 3GTQI 4DQYB 3VMHA 3KLJA 3NH5A 4EQRA 2V8KA 5C44I 4H4UA 4NBDA 3HOYI 1V59A 3OW2Y 1YUKA 3S1QI 1WIIA 3LADA 1BZLA 1NDAA 4A3EI 2VF1A 4BXXI 1XANA 1NJI1 2QLVB 1YJN1 1ZH1A 4NBGA 1Q822 1VQM1 2RABA 3MZKB 1VLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9X A;  3EMI A;  3EMF A;  1S7M A; 
#chains in the Genus database with same CATH topology
 4AYB A;  4H4S A;  4H2H A;  3CCM 1;  3CCE Z;  2DE6 A;  3CXC Z;  1GER A;  1SJC A;  3CAW A;  2JIQ A;  1M1K 1;  3FXG A;  2OTL 1;  3CC4 1;  4Y52 I;  3NH8 A;  2P8C A;  2OQY A;  2ZZ0 A;  1VQN Z;  3J81 f;  1YHQ 1;  1ZB8 A;  3NS1 B;  4HCD A;  5JRB A;  2EQ9 A;  1RO2 A;  2QJJ A;  1DXL A;  3S5S A;  3S15 I;  3FQQ A;  3VMG A;  3CCJ Z;  3D2L A;  1K73 2;  3OZM A;  4M6U A;  4MKS A;  1WW9 A;  1FEB A;  2R93 I;  1YQZ A;  3URH A;  1X3Z A;  4K7Z A;  5FS9 A;  1VQ5 1;  1R0M A;  3F3P C;  2EQ7 A;  2W55 A;  1NJI 2;  3QLD A;  3CCV 1;  4FDC B;  4TVY A;  1DTN A;  4KT2 A;  5FJO A;  3UCD A;  2O4H A;  2X50 A;  3CC7 Z;  1TZZ A;  1L1O C;  3VCN A;  3P5J B;  1YI2 1;  3J7A 4;  2FKP A;  1Q16 A;  3GTK I;  4K2S A;  3EMF A;  4E2Z A;  3I4K A;  3GD6 A;  4MXU A;  3K7A I;  2R92 I;  4JN7 A;  2GGJ A;  4FX9 A;  1M1K 2;  3S1R I;  1FEA A;  1QVF Z;  4HYR A;  1WYG A;  2E7Z A;  3NVV B;  3G6E Z;  5JCM A;  1H2I A;  2HQM A;  3DER A;  1TE6 A;  3Q6J A;  3THU A;  5FLX b;  3CD6 1;  4A6G A;  3G71 Z;  3DK8 A;  2OKT A;  1Y1W I;  3ZLF A;  2RPR A;  2RIQ A;  3OP2 A;  1NHR A;  2JK6 A;  2JIO A;  3SN0 A;  4GGH A;  4HPN A;  3RCY A;  3GY1 A;  2GGG A;  3HOU I;  4A3R A;  3GD4 A;  4NBH A;  3HOX I;  2CFY A;  2QEX 1;  2VUG A;  1NU5 A;  2OZ3 A;  3CXB A;  3DG6 A;  5TR3 A;  3TCS A;  2JR6 A;  3RZO I;  3CCE 1;  1MDR A;  1FEC A;  1Z02 A;  3IX0 A;  1GXF A;  2PSN A;  4KPR A;  2V8I A;  5FJU A;  2PTY A;  3NFZ A;  1MOK A;  2W3S A;  1LPF A;  4X6A I;  3NVY B;  4FI4 A;  2AKM A;  1TYT A;  1AA6 A;  3EAN A;  3ZLH A;  3CCJ 1;  2LFU A;  1ZK7 A;  2WPF A;  3TDH B;  2WPE A;  3H4K A;  3FJ4 A;  3OW2 Z;  4A3M I;  1X2H A;  3Q4D A;  2PTW A;  3GC2 A;  1WUF A;  2ZZC A;  3VFC A;  4HH4 A;  4E4U A;  3I56 Z;  1ZMD A;  3A7R A;  4MMW A;  3U4F A;  1T3Q C;  3TTE A;  4QTT A;  3R0K A;  1F8W A;  5FLX f;  3SQS A;  1FIQ B;  2BCP A;  2CHR A;  1VDV A;  5EBK A;  2IZ4 A;  5IT9 b;  3HOZ I;  2P28 A;  5AN9 F;  3CC7 1;  1YIJ 1;  2BC1 A;  1GET A;  3BJS A;  4BUR A;  3K1G A;  2EGT A;  4MH4 A;  2NVY I;  3VB9 A;  4MRI A;  3OZY A;  2YQU A;  2WAQ A;  2B63 I;  3CCL 1;  4IP5 A;  2MUC A;  1SFO I;  2JIR A;  1K8A 2;  2F4O A;  1NPX A;  2GQW A;  2QAE A;  1P43 A;  2WP5 A;  3G6E 1;  1TWC I;  2QJM A;  4A3K I;  1N60 C;  2POD A;  2F5Z A;  2ONE A;  3I55 1;  2JUB A;  3G71 1;  2HXU A;  3NO1 A;  3CB3 A;  4ZA0 A;  1YEY A;  2X8C A;  4J57 A;  4HNL A;  3FV9 A;  1ZY8 A;  2WB1 A;  2I5Q A;  1ZMC A;  1VQK 1;  2X99 A;  3VC6 A;  1JJ2 Z;  1BQG A;  4H4P A;  1VQ9 Z;  2PP0 A;  3NDJ A;  1KD1 1;  2K5R A;  3GTL I;  2E2J I;  1FO4 A;  3ZLG A;  4MGG A;  3RO6 A;  3CC2 1;  4BY7 I;  1PDZ A;  2DW6 A;  3PWI A;  4E5T A;  1VQP 1;  1KQS Y;  2PTZ A;  4E2Y A;  1JPM A;  2M48 A;  5FMH A;  5IT9 f;  3D6W A;  2YAU A;  3FG2 P;  2K3R A;  4IL0 A;  4EQW A;  2R7Z I;  1I3Q I;  2XH0 A;  5EU9 A;  2GTI A;  2ZC8 A;  3M3Y I;  2PU0 A;  3SR6 B;  3QFB A;  1QYP A;  5BOF A;  1I6H I;  3D9X A;  2E9H A;  4GME A;  3HOW I;  1ML8 A;  3BOX A;  2W0H A;  3S17 I;  3MSY A;  3MZL B;  3H3V J;  1XHC A;  3TW9 A;  3CME Z;  4HGZ A;  3UJS A;  1W6T A;  3L8K A;  4NBF A;  1ZKQ A;  4K8G A;  3RRA A;  5JCN A;  3EER A;  2A8X A;  1N62 C;  1ZX9 A;  4A3I I;  1P48 A;  2OVL A;  3DFH A;  4HCL A;  3RR1 A;  5C4J I;  1NUI A;  1USP B;  2BJO A;  3S1N I;  2PTX A;  1TWF I;  1W2B Y;  2WPC A;  2P88 A;  1Q1R A;  1GES A;  2GGE A;  2RDX A;  4NH1 C;  4YWO A;  4TVW A;  1RLY A;  3HKZ A;  1VQ6 Z;  3FKI I;  3BG0 B;  5G5G B;  1FHV A;  1JRP A;  4RS4 A;  2OOX B;  3DGZ A;  3S16 I;  4E33 A;  1ZXI C;  1OEP A;  2AAQ A;  3R1Z A;  1GRT A;  3H8A A;  3NVW B;  3JW7 A;  4A3D I;  1KCZ A;  1TYP A;  3MON A;  3CGE A;  3ESW A;  5LL6 f;  3H7V A;  2PP1 A;  1YIT Z;  3NFU A;  3SSZ A;  4EMJ A;  2VPY A;  1QVG Y;  4MD8 A;  4MD9 A;  1JEH A;  5FS7 A;  1NHS A;  5C4X I;  2OLA A;  3HPF A;  2FYM A;  2RBL A;  2XH2 A;  4GYP C;  3TQP A;  1RM6 B;  1P9N A;  1EC9 A;  1NP6 A;  4NBB A;  3LXD A;  3B9J B;  5U25 A;  3CQZ I;  3VC5 A;  2XH4 A;  3P3B A;  1N8R 1;  3QN3 A;  3R25 A;  3T4W A;  1Y1V S;  3BG1 B;  4DGL A;  4H4V A;  1M90 1;  2GL5 A;  3GO2 A;  4KEM A;  3VDG A;  3JZU A;  2R9Z A;  4XX2 A;  4CL1 A;  2XH7 A;  2RT9 A;  3LUS A;  4BBS I;  2NVK X;  2PS2 A;  2OFJ A;  3MQT A;  5FJP A;  3M4O I;  4NEW A;  4DWD A;  1VQ8 Z;  2BC0 A;  3U50 C;  1X3W A;  4NBE A;  1X2G A;  3AMZ A;  2C3D A;  3O0H A;  1Q86 1;  3J80 b;  1USP A;  2JMO A;  2OOY B;  4H4Q A;  1KRL A;  2OZK A;  3VMI A;  3KIH A;  3ENL A;  2DE7 A;  3DG3 A;  4J3Z A;  1SJB A;  5GRT A;  4GFI A;  3H0G I;  3T9P A;  3G4S Z;  2LIY A;  2V3B A;  4MON A;  4BBR I;  2X8G A;  1RVK A;  4E32 A;  1VQ7 Z;  3N6J A;  2XGZ A;  4A93 I;  3CGD A;  4DK1 A;  2QRE B;  4LII A;  1JRO A;  2POZ A;  1PFT A;  4A3F I;  2NQL A;  4H83 A;  3I4M I;  1MNS A;  1GRF A;  4J1O A;  3QTP A;  3V4B A;  3V3W A;  2JIM A;  1N8R 2;  3DG7 A;  1VQO Z;  3I6E A;  4E8G A;  3IR7 A;  2OZT A;  4EQX A;  1M90 2;  3N4E A;  1FDO A;  1KD0 A;  4JHM A;  2YVJ A;  4E30 A;  1S72 Z;  3EED A;  3AM9 A;  4K8D A;  4LA1 A;  3FYY A;  3VA8 A;  5IDZ A;  1DNC A;  1TFI A;  3N4F A;  3V5F A;  1VQN 1;  3NZG A;  2GGI A;  4EMI A;  3P0W A;  4J56 A;  4M0X A;  3S14 I;  1STZ A;  1GV4 A;  2G2K A;  3EF6 A;  2CDU A;  1Q86 2;  2J3N A;  3S2H I;  4H50 A;  3UCC A;  3PK7 A;  3VCC A;  3GTP I;  2WP6 A;  1BWC A;  4FP1 A;  3J80 f;  1JCT A;  1F3P A;  4A35 A;  2LEX A;  1YJ9 Z;  4F4R A;  1YJW Z;  2XSX A;  1WUE A;  4RVG A;  1M6I A;  1N2F A;  2F4M A;  2I3C A;  1VQ4 Z;  1Z03 A;  3A7A A;  3DK4 A;  4H4X A;  3CCU Z;  3CXC Y;  4ENL A;  5JCI A;  4H4T A;  3GKQ A;  2QGY A;  2GTH A;  2GU2 A;  4E2W A;  4DNA A;  3EMI A;  1EC8 A;  3GTM I;  3B97 A;  1GEU A;  3JVA A;  2GR2 A;  3CK5 A;  3PO3 S;  4ADW A;  4DXK A;  1JWH C;  2NVX I;  5IP7 I;  1RO4 A;  1K83 I;  3BSM A;  2QKD A;  1KN0 A;  4ZCW A;  2VPW A;  4GR1 A;  4EQS A;  5BOE A;  3IJQ A;  3GTJ I;  1VQ7 1;  3CCQ Z;  2EQ6 A;  3RGT A;  4BY1 I;  5FJT A;  3NXL A;  3SN1 A;  2NPX A;  2PMQ A;  1PDY A;  1R6W A;  4JN8 A;  2GH5 A;  2P0I A;  3F3F C;  1YJN Z;  4NEV A;  2PK7 A;  3CPW Y;  2JNY A;  1SJD A;  3EAO A;  3DEQ A;  3TJI A;  1VQM Z;  2O56 A;  2GRT A;  2QRC B;  3DFY A;  3L5O A;  3DIP A;  4Y7N I;  2YAD A;  1S72 1;  3S2D I;  1GRH A;  3CCM Z;  2GR0 A;  3DK9 A;  1QVF Y;  3P93 A;  3NVZ B;  4EWC A;  1Q81 1;  2JA8 I;  2OTL Z;  1GRA A;  3RZD I;  3MUC A;  1MO9 A;  4TNU A;  5FLM I;  3QFA A;  3PG6 A;  3D47 A;  1QF8 A;  2P3Y A;  1SJA A;  1YHQ Z;  3KIF A;  4H4Y A;  1TWA I;  2J6A A;  1XPY A;  5ER0 A;  2W54 A;  1Y8C A;  3CMA Z;  1N5W C;  2E5A A;  2AKL A;  3I56 1;  1YJW 1;  1EBG A;  5C3E I;  1H6V A;  3IJL A;  1IYX A;  1VQZ A;  4H4W A;  1X0T A;  3D46 A;  2GR1 A;  3VTN A;  3FCP A;  2PU1 A;  3R10 A;  2QDE A;  4M52 A;  4NB9 A;  4A3J I;  1MDL A;  3CCV Z;  2QDD A;  3DJG X;  3J81 b;  1KKR A;  4E2X A;  3JAM b;  1GRE A;  3OC4 A;  1KD1 2;  3ES7 A;  1WJ2 A;  1YI2 Z;  3UXL A;  4H1Z A;  1GRB A;  2ZAD A;  2HU9 A;  2ZAE B;  2NAP A;  1K73 1;  3I4N I;  3I07 A;  1DL6 A;  3EKG A;  1Q81 2;  2QA4 Z;  3CCQ 1;  4A3C I;  1TWH I;  1R9T I;  2OPJ A;  4H19 A;  3CD6 Z;  5D1O B;  3PWG A;  4IHC A;  3IC9 A;  5JCK A;  2VPX A;  1EBD A;  2MNR A;  1Y1V I;  3HW2 A;  5KVI A;  1L8P A;  1FHU A;  2IV2 X;  1NHP A;  4DYE A;  1VQ9 1;  3ZVH A;  1RQF A;  1KC8 1;  2P3Z A;  3H12 A;  1KKO A;  1XDI A;  1I50 I;  2JS4 A;  2QEX Z;  5IP9 I;  1EC7 A;  1BKH A;  3NRZ B;  1OJT A;  1EBH A;  1SIW A;  1N63 C;  1AOG A;  3OTR A;  4K1W A;  4RV9 A;  2C3C A;  2IZ3 A;  3DJJ A;  2YVF A;  4GIR A;  4RVD A;  2TPR A;  4IT1 A;  3U9I A;  5CM2 M;  4A3L I;  4NB8 A;  4EMW A;  2AL2 A;  3ETR B;  3JAM f;  3SQP A;  4YWS A;  3UJR A;  2OZ8 A;  3T6C A;  2PCE A;  5A2Q b;  2Y0S A;  3CMA 1;  3CGB A;  4H4Z A;  3CCS Z;  2JA6 I;  3DGB A;  2V8J A;  4QTU A;  3CME 1;  1JJ2 Y;  3QPE A;  4DX3 A;  1Q7Y 1;  4G8T A;  2Q4Z A;  2JA7 I;  3R11 A;  4DN1 A;  3II4 A;  1E9I A;  1FFU C;  4E4F A;  2GGH A;  4G7F A;  3T8Q A;  4JDR A;  2NVT I;  2QR1 B;  5D1O A;  3T4N B;  2QRD B;  3CPW Z;  3STP A;  1YIJ Z;  1KC8 2;  3CYJ A;  1V97 A;  4E6M A;  4MD7 A;  4ROP A;  3CCR Z;  1NHQ A;  1VQ6 1;  2AYD A;  2E2I I;  5T64 A;  4NFR A;  4S1T A;  1JOA A;  1MRA A;  1MUC A;  3S47 A;  4BV6 A;  3NDI A;  2V6O A;  4Z17 A;  3CCL Z;  3MKC A;  4GGB A;  3SJN A;  2QA4 1;  3MWC A;  4JQ9 A;  1KQS Z;  1YIT 1;  4NOZ A;  2VUM I;  2HZG A;  2DW7 A;  4RVH A;  2E2H I;  3I55 Z;  1LQL A;  3R0U A;  2WOI A;  2OTJ Z;  3DH9 A;  3GRT A;  1K9M 1;  1RNI A;  7ENL A;  2WOW A;  3V5C A;  5G5H B;  2OO6 A;  5A2Q f;  2PGE A;  2WBA A;  1VQK Z;  6ENL A;  3CGC A;  1TWG I;  2X8H A;  2KI7 B;  4GIS A;  1Q7Y 2;  1JPD X;  3DGH A;  1ECQ A;  1GSN A;  3NH4 A;  2W3R A;  4HGY A;  1LVL A;  1K8A 1;  4H4R A;  3PFR A;  1VQL Z;  3PO3 I;  2HXT A;  2O53 A;  3CC2 Z;  1VQ8 1;  1SB3 B;  4KWS A;  4NBA A;  1W2B Z;  3GTG I;  3KUM A;  2R6M A;  1VQP Z;  2YU9 I;  1GRG A;  2P8B A;  3UJF A;  3IFU A;  5D1P A;  4GRT A;  4X2P A;  3UGV A;  2W03 A;  4IZG A;  3UXK A;  3UJE A;  3G4S 1;  3RNM A;  3FQM A;  3CCS 1;  1WCM I;  4KPL A;  2QQ6 A;  2PM9 A;  3IF8 A;  3UJ2 A;  4E31 A;  2HNE A;  1RO0 A;  2H85 A;  2V3A A;  3CT2 A;  3CXO A;  3PO2 I;  4RVF A;  2V45 A;  1QVG Z;  3SBF A;  3S1M I;  1K4Q A;  4IP4 A;  1K9M 2;  5FS8 A;  4EWJ A;  1ZB9 A;  1ELS A;  3N6H A;  3GTO I;  5FS6 A;  2W04 A;  3QWU A;  2JA5 I;  1VQO 1;  1S7M A;  3TOY A;  5JCL A;  2GR3 A;  3CCR 1;  2PA6 A;  4HCH A;  1ONF A;  2OG9 A;  2PGW A;  3SN4 A;  2WOV A;  1ZDL A;  3I6T A;  3ES8 A;  3FVD A;  3GTM S;  1FFV C;  3IK4 A;  4EM3 A;  3TJ4 A;  2VPZ A;  3R07 C;  3CC4 Z;  1Q1W A;  3LB8 A;  2GSH A;  5U1O A;  1XS2 A;  3HOV I;  2OTJ 1;  2AL1 A;  3GD3 A;  3ZVH B;  2AKZ A;  2Q51 A;  4NBC A;  4EM4 A;  4A3B I;  3GCF A;  1YJ9 1;  3QKE A;  3Q87 A;  4DHG A;  2PMZ A;  2NVQ I;  2QVH A;  2YVG A;  2KPI A;  1Q82 1;  1YUA A;  1N5X A;  2HF1 A;  4A3G I;  5KVH A;  5T6B A;  2JIP A;  1VQ4 1;  1D7Y A;  2GDQ A;  3CCU 1;  2ZZB A;  4APN A;  2RHB A;  1VQ5 Z;  1F9C A;  3OW1 A;  4GYP A;  2DE5 A;  1Z01 A;  3TE5 B;  2M6N A;  5T67 A;  1VQL 1;  3GRS A;  5J04 A;  2PP3 A;  3IJI A;  2EQ8 A;  3GTQ I;  2AL2 B;  3MZN A;  3HRD C;  4DQY B;  3VMH A;  3KLJ A;  1N61 C;  3NH5 A;  3EEZ A;  1WZN A;  4EQR A;  2V8K A;  5C44 I;  4H4U A;  4NBD A;  3ZVI A;  3DDM A;  3HOY I;  1FDI A;  1V59 A;  4IL2 A;  2V3V A;  1NEL A;  2OX4 A;  3DES A;  3AN1 A;  3OW2 Y;  2OQH A;  2PPG A;  1YUK A;  3S1Q I;  1WII A;  3LAD A;  1BZL A;  4ZOH B;  1NDA A;  4HN8 A;  4A3E I;  3MY9 A;  2QJN A;  2VF1 A;  3A7U A;  4BXX I;  1QXF A;  1XAN A;  3H70 A;  4HNC A;  5ENL A;  3TWB A;  1NJI 1;  2QLV B;  3OPS A;  1YJN 1;  3Q45 A;  2E3T A;  1ZH1 A;  1ONE A;  4NBG A;  1Q82 2;  5FJR A;  4Z1Y A;  1VQM 1;  1JDF A;  2RAB A;  3TWA A;  3MZK B;  1VLA A;  3EUB 3;  1TKK A;  3RIT A; 
#chains in the Genus database with same CATH homology
 4AYB A;  4H4S A;  3CCM 1;  3CCE Z;  2DE6 A;  3CXC Z;  1GER A;  1M1K 1;  2OTL 1;  3CC4 1;  4Y52 I;  3NH8 A;  2ZZ0 A;  1VQN Z;  3J81 f;  1YHQ 1;  1ZB8 A;  5JRB A;  2EQ9 A;  1RO2 A;  1DXL A;  3S15 I;  3FQQ A;  3VMG A;  3CCJ Z;  1K73 2;  1WW9 A;  1FEB A;  2R93 I;  1YQZ A;  3URH A;  1X3Z A;  4K7Z A;  5FS9 A;  1VQ5 1;  3F3P C;  2EQ7 A;  1NJI 2;  3CCV 1;  4FDC B;  2O4H A;  2X50 A;  3CC7 Z;  1L1O C;  3P5J B;  1YI2 1;  3J7A 4;  3GTK I;  3EMF A;  4E2Z A;  4MXU A;  3K7A I;  2R92 I;  4FX9 A;  1M1K 2;  3S1R I;  1FEA A;  1QVF Z;  5JCM A;  3G6E Z;  1H2I A;  2HQM A;  3Q6J A;  5FLX b;  3CD6 1;  3G71 Z;  3DK8 A;  1Y1W I;  2RPR A;  2RIQ A;  1NHR A;  2JK6 A;  3HOU I;  3GD4 A;  4NBH A;  3HOX I;  2CFY A;  2QEX 1;  2VUG A;  5TR3 A;  2JR6 A;  3RZO I;  3CCE 1;  1FEC A;  1Z02 A;  3IX0 A;  1GXF A;  4KPR A;  2V8I A;  3NFZ A;  1MOK A;  1LPF A;  4X6A I;  1TYT A;  3EAN A;  3CCJ 1;  2LFU A;  1ZK7 A;  2WPF A;  3TDH B;  2WPE A;  3H4K A;  3OW2 Z;  4A3M I;  2ZZC A;  4HH4 A;  3I56 Z;  1ZMD A;  4QTT A;  1F8W A;  5FLX f;  2BCP A;  5EBK A;  2IZ4 A;  5IT9 b;  3HOZ I;  2P28 A;  5AN9 F;  3CC7 1;  1YIJ 1;  2BC1 A;  1GET A;  4BUR A;  2EGT A;  4MH4 A;  2NVY I;  3VB9 A;  4MRI A;  2YQU A;  2WAQ A;  2B63 I;  3CCL 1;  1SFO I;  1K8A 2;  2F4O A;  1NPX A;  2GQW A;  2QAE A;  2WP5 A;  3G6E 1;  1TWC I;  4A3K I;  2F5Z A;  3I55 1;  2JUB A;  3G71 1;  2X8C A;  4J57 A;  1ZY8 A;  2WB1 A;  1ZMC A;  1VQK 1;  2X99 A;  1JJ2 Z;  4H4P A;  1VQ9 Z;  3NDJ A;  1KD1 1;  2K5R A;  3GTL I;  2E2J I;  3CC2 1;  4BY7 I;  1VQP 1;  1KQS Y;  4E2Y A;  2M48 A;  5FMH A;  5IT9 f;  3D6W A;  2YAU A;  3FG2 P;  2K3R A;  4EQW A;  2R7Z I;  1I3Q I;  2GTI A;  3M3Y I;  3QFB A;  1QYP A;  1I6H I;  3D9X A;  2E9H A;  3HOW I;  1ML8 A;  2W0H A;  3S17 I;  3MZL B;  3H3V J;  1XHC A;  3CME Z;  4HGZ A;  3L8K A;  4NBF A;  1ZKQ A;  5JCN A;  3EER A;  2A8X A;  1ZX9 A;  4A3I I;  5C4J I;  1NUI A;  1USP B;  2BJO A;  3S1N I;  2WPC A;  1TWF I;  1W2B Y;  1Q1R A;  1GES A;  4YWO A;  4NH1 C;  1RLY A;  3HKZ A;  1VQ6 Z;  3FKI I;  3BG0 B;  4RS4 A;  2OOX B;  3DGZ A;  3S16 I;  4E33 A;  2AAQ A;  1GRT A;  4A3D I;  1TYP A;  3MON A;  3CGE A;  3ESW A;  5LL6 f;  1YIT Z;  4EMJ A;  1QVG Y;  4MD8 A;  4MD9 A;  1JEH A;  5FS7 A;  1NHS A;  5C4X I;  2RBL A;  1P9N A;  1NP6 A;  4NBB A;  3LXD A;  5U25 A;  3CQZ I;  1N8R 1;  1Y1V S;  3BG1 B;  4DGL A;  4H4V A;  1M90 1;  2R9Z A;  4XX2 A;  4CL1 A;  2RT9 A;  3LUS A;  4BBS I;  2NVK X;  3M4O I;  4NEW A;  1VQ8 Z;  2BC0 A;  3U50 C;  1X3W A;  4NBE A;  3O0H A;  2C3D A;  1Q86 1;  3J80 b;  1USP A;  2JMO A;  2OOY B;  4H4Q A;  1KRL A;  2OZK A;  3VMI A;  3KIH A;  5GRT A;  2DE7 A;  3H0G I;  3G4S Z;  2LIY A;  2V3B A;  4MON A;  4BBR I;  2X8G A;  4E32 A;  1VQ7 Z;  4A93 I;  3CGD A;  4DK1 A;  2QRE B;  4LII A;  1PFT A;  4A3F I;  3I4M I;  1GRF A;  1N8R 2;  1VQO Z;  4EQX A;  1M90 2;  2YVJ A;  4E30 A;  1S72 Z;  3EED A;  4K8D A;  4LA1 A;  1DNC A;  1TFI A;  1VQN 1;  4EMI A;  4J56 A;  3S14 I;  1GV4 A;  2G2K A;  3EF6 A;  2CDU A;  1Q86 2;  2J3N A;  3S2H I;  4H50 A;  3GTP I;  2WP6 A;  1BWC A;  3J80 f;  1F3P A;  1YJ9 Z;  1YJW Z;  4RVG A;  1M6I A;  1N2F A;  2F4M A;  2I3C A;  1VQ4 Z;  1Z03 A;  3DK4 A;  4H4X A;  3CCU Z;  3CXC Y;  5JCI A;  4H4T A;  3GKQ A;  2GTH A;  2GU2 A;  4E2W A;  4DNA A;  3EMI A;  3GTM I;  1GEU A;  2GR2 A;  3PO3 S;  4ADW A;  1JWH C;  2NVX I;  5IP7 I;  1RO4 A;  1K83 I;  2QKD A;  1KN0 A;  4GR1 A;  4EQS A;  3GTJ I;  1VQ7 1;  3CCQ Z;  2EQ6 A;  4BY1 I;  2NPX A;  2GH5 A;  3F3F C;  1YJN Z;  4NEV A;  2PK7 A;  3CPW Y;  2JNY A;  3EAO A;  1VQM Z;  2GRT A;  2QRC B;  3L5O A;  4Y7N I;  2YAD A;  1S72 1;  3S2D I;  1GRH A;  3CCM Z;  2GR0 A;  3DK9 A;  1QVF Y;  4EWC A;  1Q81 1;  2JA8 I;  2OTL Z;  1GRA A;  3RZD I;  1MO9 A;  4TNU A;  5FLM I;  3QFA A;  3PG6 A;  1QF8 A;  2P3Y A;  1YHQ Z;  3KIF A;  4H4Y A;  1TWA I;  2J6A A;  5ER0 A;  3CMA Z;  2AKL A;  3I56 1;  1YJW 1;  5C3E I;  1H6V A;  4H4W A;  1X0T A;  2GR1 A;  3VTN A;  4M52 A;  4NB9 A;  4A3J I;  3CCV Z;  3DJG X;  3J81 b;  4E2X A;  3JAM b;  1GRE A;  3OC4 A;  1KD1 2;  1YI2 Z;  1GRB A;  2HU9 A;  2ZAE B;  1K73 1;  3I4N I;  3I07 A;  1DL6 A;  1Q81 2;  2QA4 Z;  3CCQ 1;  4A3C I;  1TWH I;  1R9T I;  3CD6 Z;  5D1O B;  3IC9 A;  5JCK A;  1EBD A;  1Y1V I;  5KVI A;  1NHP A;  1VQ9 1;  1RQF A;  1KC8 1;  1XDI A;  1I50 I;  2JS4 A;  2QEX Z;  5IP9 I;  1OJT A;  1AOG A;  4RV9 A;  2C3C A;  2IZ3 A;  3DJJ A;  2YVF A;  4RVD A;  2TPR A;  5CM2 M;  4A3L I;  4NB8 A;  4EMW A;  3JAM f;  3SQP A;  5A2Q b;  2Y0S A;  3CMA 1;  3CGB A;  4H4Z A;  3CCS Z;  2JA6 I;  2V8J A;  4QTU A;  3CME 1;  1JJ2 Y;  1Q7Y 1;  2Q4Z A;  2JA7 I;  3II4 A;  4JDR A;  2NVT I;  2QR1 B;  5D1O A;  3T4N B;  2QRD B;  3CPW Z;  1YIJ Z;  1KC8 2;  4MD7 A;  3CCR Z;  1NHQ A;  1VQ6 1;  2E2I I;  1JOA A;  5T64 A;  4NFR A;  4S1T A;  4BV6 A;  3NDI A;  2V6O A;  3CCL Z;  2QA4 1;  4JQ9 A;  1KQS Z;  1YIT 1;  4NOZ A;  2VUM I;  4RVH A;  2E2H I;  3I55 Z;  1LQL A;  2WOI A;  2OTJ Z;  3DH9 A;  3GRT A;  1K9M 1;  1RNI A;  2WOW A;  5A2Q f;  2WBA A;  1VQK Z;  3CGC A;  1TWG I;  2X8H A;  2KI7 B;  1Q7Y 2;  3DGH A;  1GSN A;  3NH4 A;  4HGY A;  1LVL A;  1K8A 1;  4H4R A;  1VQL Z;  3PO3 I;  2O53 A;  3CC2 Z;  1VQ8 1;  4NBA A;  1W2B Z;  3GTG I;  2R6M A;  1VQP Z;  2YU9 I;  1GRG A;  3IFU A;  5D1P A;  4GRT A;  2W03 A;  3G4S 1;  3RNM A;  3FQM A;  3CCS 1;  1WCM I;  2PM9 A;  3IF8 A;  4E31 A;  1RO0 A;  2H85 A;  2V3A A;  3PO2 I;  4RVF A;  1QVG Z;  3S1M I;  1K4Q A;  1K9M 2;  5FS8 A;  1ZB9 A;  3GTO I;  5FS6 A;  2W04 A;  3QWU A;  2JA5 I;  1VQO 1;  1S7M A;  5JCL A;  2GR3 A;  3CCR 1;  1ONF A;  2WOV A;  1ZDL A;  3GTM S;  4EM3 A;  3CC4 Z;  1Q1W A;  3LB8 A;  5U1O A;  3HOV I;  2OTJ 1;  3GD3 A;  2Q51 A;  4NBC A;  4EM4 A;  4A3B I;  3GCF A;  1YJ9 1;  3Q87 A;  2PMZ A;  2NVQ I;  2YVG A;  2KPI A;  1Q82 1;  1YUA A;  2HF1 A;  4A3G I;  5KVH A;  5T6B A;  1VQ4 1;  1D7Y A;  3CCU 1;  2ZZB A;  4APN A;  2RHB A;  1VQ5 Z;  2DE5 A;  1Z01 A;  3TE5 B;  2M6N A;  5T67 A;  1VQL 1;  3GRS A;  2EQ8 A;  3GTQ I;  4DQY B;  3VMH A;  3KLJ A;  3NH5 A;  4EQR A;  2V8K A;  5C44 I;  4H4U A;  4NBD A;  3HOY I;  1V59 A;  3OW2 Y;  1YUK A;  3S1Q I;  1WII A;  3LAD A;  1BZL A;  1NDA A;  4A3E I;  2VF1 A;  4BXX I;  1XAN A;  1NJI 1;  2QLV B;  1YJN 1;  1ZH1 A;  4NBG A;  1Q82 2;  1VQM 1;  2RAB A;  3MZK B;  1VLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...