1S7MA

Crystal structure of hiabd1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
158
Chain Sequence
GAKTEINKDGLTITPANGAGANNANTISVTKDGISAGGQSVKNVVSGLKKFGDANFDPLTSSADNLTKQNDDAYKGLTNLDEKGTDKQTPVVADNTAATVGDLRGLGWVISADKTTGGSTEYHDQVRNANEVKFKSGNGINVSGKTVNGRREITFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for host recognition by the Haemophilus influenzae Hia autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
molecule keywords Hia
total genus 27
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15403 HiaBD2 HiaBD2_N domain of Trimeric autotransporter adhesin (GIN)
A PF18669 Trp_ring Trimeric autotransporter adhesin Trp ring domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.140 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s7mA03
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1s7mA01
3.90.1780.10 Alpha Beta Alpha-Beta Complex Trimeric adhesin Trimeric adhesin 1s7mA02
3EMIA 3EMFA 1S7MA 3D9XA
chains in the Genus database with same CATH superfamily
2AL2B 4H4UA 3OW2Y 3UGVA 3M3YI 2JA7I 3K7AI 3QPEA 3NDJA 4Y7NI 2OQYA 3MSYA 1XPYA 3ENLA 1YJWZ 3GD6A 1DTNA 3PFRA 4BY1I 2OZTA 3J80b 3IJIA 4DHGA 4QTUA 2NVKX 4NBHA 1TWAI 2IZ3A 1JJ2Y 4EMWA 2P0IA 3I4KA 2NVYI 1WZNA 1N60C 2ZAEB 1N8R1 3DEQA 3GTMS 3S5SA 2PS2A 3I07A 3CCU1 4K7ZA 1NDAA 3GD4A 2XH0A 3UCCA 4Z1YA 1ELSA 2ONEA 2X8CA 1TFIA 2O4HA 4NOZA 2PPGA 4MD9A 3HRDC 3NFUA 3QLDA 3T6CA 2ZZBA 2F4OA 1JEHA 1R0MA 2I5QA 3P3BA 3CT2A 3CK5A 3T8QA 3CXCZ 3CMAZ 1VQ91 3KLJA 5FJOA 3SQSA 2OX4A 2JMOA 2O53A 3DIPA 3GTJI 2E5AA 3QTPA 4HNCA 2HU9A 3RGTA 2CFYA 5C44I 1M1K2 1F9CA 1P9NA 3NH4A 1SJBA 3CGCA 3CPWY 4H4QA 3CC41 4H83A 1MO9A 4IT1A 2E3TA 3S17I 2VUGA 4BURA 1ECQA 4Z17A 4HPNA 4BV6A 1PDYA 4GISA 2LFUA 3VMIA 1GRFA 2NQLA 2P28A 2CDUA 3OW1A 4J56A 5C4XI 1SJCA 4J57A 4J3ZA 1ML8A 2POZA 2J3NA 3GD3A 2EQ7A 4RVFA 4H4RA 3GTGI 2WPFA 2EQ6A 1T3QC 2QREB 3NZGA 1TKKA 2RT9A 3G4S1 1ZB8A 1QVFZ 2JIPA 3S1QI 4BBRI 3RITA 3EERA 3FQMA 2RPRA 3TWAA 3NXLA 4XX2A 3GTKI 3CCE1 1STZA 3L8KA 4E4UA 1OEPA 4KPLA 4ZOHB 4E5TA 3G71Z 2VPYA 1Q812 5IP7I 1RO0A 5ER0A 1FDOA 3IK4A 4H4WA 3CPWZ 1SB3B 4H4ZA 1X3ZA 2OTL1 2JR6A 4IL2A 3DJGX 1ZDLA 1BQGA 1K9M2 5LL6f 3CCJZ 4E32A 2GGIA 1S7MA 1BWCA 2AKMA 2PP0A 4H19A 5FS8A 4NBCA 1YITZ 3GCFA 4A3CI 4K2SA 4IHCA 2JIRA 2OTJ1 1Q861 5FJPA 3UXLA 2R92I 4K8DA 1TWFI 3I561 2QR1B 2RDXA 1YJ9Z 3CC21 2V3AA 3KUMA 2PCEA 2XH7A 1YJN1 3SN1A 3QFAA 3U9IA 2OKTA 3VCCA 3TQPA 5J04A 4A6GA 1RM6B 1S72Z 1VQ6Z 1X2HA 2DW7A 2IV2X 1SJAA 2GGEA 4NB9A 2H85A 1S721 2WPEA 1Y1WI 2JA5I 1X0TA 2OLAA 3FG2P 5U25A 3P5JB 4GFIA 4Y52I 1QF8A 1VQKZ 1TWCI 1W2BY 3HOWI 3PO3I 1GREA 1NJI2 2V8KA 3UJEA 2GTIA 2R6MA 1V97A 2GL5A 3NVYB 5EBKA 3G4SZ 1N8R2 1JOAA 1YIT1 4DGLA 1X3WA 1FFUC 2DE7A 4DX3A 2GGJA 4NBDA 4JDRA 1H2IA 5C4JI 1NPXA 3SQPA 3HOVI 5A2Qb 2NVXI 2QJMA 1X2GA 2RIQA 1E9IA 4DYEA 2ZADA 3DG7A 1YI2Z 1M901 1GRAA 2OZ3A 3CGEA 3R10A 2IZ4A 4LIIA 2EQ9A 1USPA 4A3DI 1JPMA 3KIFA 2E9HA 3Q6JA 3VMGA 3PO3S 3CYJA 4NBFA 4A93I 4EWJA 3DGZA 1DXLA 4M52A 3JAMb 1YHQZ 2GTHA 2LEXA 1LQLA 1FIQB 2F5ZA 3TJIA 2QKDA 3OPSA 2PGEA 2OZKA 3D6WA 4HYRA 1YJ91 1F8WA 1GEUA 1ZMCA 2PODA 2V3BA 3N6JA 2A8XA 2GR3A 2PA6A 3UJ2A 4DN1A 2XGZA 3PWIA 2OO6A 5JRBA 4CL1A 1KQSY 3PG6A 3VA8A 3I4NI 2WOWA 3CGBA 1NHRA 2OQHA 1R9TI 3CC71 2GR0A 5A2Qf 3PO2I 1KN0A 1P48A 3IJLA 2AYDA 5D1OA 3FVDA 2ZC8A 3D47A 1K732 2CHRA 1VQ8Z 3GTLI 1Z02A 1PDZA 1VQM1 2OTLZ 3T4NB 3LXDA 2VUMI 2M48A 3A7RA 4E2ZA 3JZUA 3S14I 3Q87A 4GGHA 3QFBA 3EKGA 4FP1A 3N4EA 2AKZA 5FLMI 2C3DA 3AM9A 3IR7A 3CCSZ 2JA6I 2RHBA 4X6AI 3TW9A 1Q862 1WYGA 1YIJ1 2NPXA 3DK4A 3K1GA 5FS9A 2P8BA 3UCDA 1FDIA 4EQRA 2O56A 1KC81 2K5RA 3MZLB 3HKZA 1YJW1 5IP9I 3TDHB 2KPIA 3V3WA 2PMZA 3UJFA 4GRTA 4NEVA 4YWOA 2QEX1 2R7ZI 2X50A 3GTPI 2HQMA 3HPFA 3V5FA 2QVHA 3R0KA 3RRAA 2AAQA 3VB9A 3LADA 2GSHA 4JHMA 5IDZA 3I6EA 5IT9b 1KKRA 3DG6A 4A3RA 1N63C 3S2HI 3LUSA 3CME1 5FS6A 4MD7A 1BKHA 1VQ9Z 1VQ5Z 4E6MA 4X2PA 4HCHA 2V6OA 4E4FA 3RZDI 4A3LI 3VC6A 1JDFA 3GTOI 2YVFA 3OP2A 4H4YA 4HNLA 1W6TA 2YVJA 2WPCA 3EF6A 3SN4A 7ENLA 3DFHA 3RNMA 2M6NA 5T64A 2PU1A 4A35A 3IX0A 2F4MA 3NVWB 3U4FA 1RLYA 4ZCWA 3H4KA 3CXBA 3S16I 3DK9A 1VQPZ 2V8JA 3CCR1 2E2II 4GIRA 5ENLA 4APNA 3S1NI 3AMZA 1VQP1 3H3VJ 4A3BI 3CQZI 3GKQA 1MRAA 4HH4A 1EC8A 1M1K1 5TR3A 5BOEA 5JCLA 3CMA1 2OPJA 1KKOA 2JUBA 3TE5B 1USPB 4NBBA 1VQN1 1TYTA 1AOGA 5JCIA 2JIMA 1Q7Y2 1K8A1 2X8HA 4DK1A 3UJRA 3CB3A 4MMWA 1L1OC 1VDVA 3BOXA 2Q51A 2LIYA 3CCUZ 2GQWA 2PTZA 2BC1A 4KT2A 1N61C 1TWHI 3FYYA 4JN7A 2WOIA 3QWUA 2YVGA 5FS7A 1MDRA 2NVTI 2QQ6A 3IJQA 3D46A 4EMJA 4A3EI 5FJTA 3CCL1 4JQ9A 3EUB3 3H0GI 2HF1A 2VPXA 4AYBA 3VDGA 1JRPA 4MONA 3R0UA 2WAQA 4J1OA 3ZVHA 1VQNZ 2QEXZ 2BCPA 2HXTA 2P8CA 3URHA 2MUCA 3S1MI 4RVDA 1GRTA 1I50I 1V59A 1WCMI 2MNRA 4DNAA 3T4WA 4FDCB 3CCMZ 1KCZA 2WOVA 5JCKA 1ZH1A 3G6E1 1YIJZ 3FQQA 3DGHA 5KVIA 2QGYA 1TZZA 1M6IA 2B63I 1VQ4Z 3UJSA 4NFRA 1YQZA 3VMHA 1VQ71 3S47A 3CCQZ 2X8GA 3TOYA 1Q1RA 4BBSI 2GGGA 2AL2A 1KD0A 1K731 1VQ51 1GXFA 3OW2Z 1Q1WA 2PP1A 2PTWA 3SJNA 3ES8A 2ZZCA 3MZKB 1MDLA 2P3ZA 1WUEA 2ZZ0A 4H4SA 5U1OA 1FHUA 2W55A 1FHVA 3SN0A 4GYPA 1VQMZ 1GESA 4EWCA 2XH2A 3H12A 2AL1A 4EQXA 2PM9A 1ONEA 3L5OA 1GRBA 1WJ2A 4A3MI 1JCTA 3II4A 1ZXIC 3CC7Z 2OFJA 5D1OB 3HOYI 3NRZB 3TJ4A 4DWDA 4HGYA 3NH8A 1VQL1 1PFTA 3HOXI 2HXUA 5GRTA 1K83I 1Y1VS 4EQSA 1F3PA 2W04A 2QA41 2C3CA 2YQUA 4MGGA 5C3EI 3HW2A 4GYPC 2PTYA 3MUCA 1WIIA 4E33A 1ZB9A 3CD61 1Y8CA 3NVVB 3MKCA 3R25A 4KWSA 3CCS1 1GSNA 2QJNA 4GMEA 3D9XA 1NHQA 4FI4A 2P88A 4NH1C 1K9M1 4IP4A 4H4PA 4A3GI 3VCNA 1I3QI 3DESA 3R11A 3ES7A 1VQK1 2HNEA 4BXXI 4HGZA 3O0HA 4GR1A 3THUA 2QAEA 3DG3A 4QTTA 1K8A2 2WB1A 3GY1A 1WUFA 4A3II 2OG9A 3CCVZ 1VQ81 2JS4A 3VTNA 3B97A 1DNCA 5G5HB 2JIOA 1N5WC 3I6TA 1LPFA 3MWCA 4RVHA 1NU5A 3OZYA 4H4TA 3EANA 4A3JI 3BSMA 2X99A 3CXCY 2EQ8A 3PWGA 2NVQI 3I55Z 1EC9A 1RO4A 1ZX9A 4GGBA 3GRSA 3FXGA 1XDIA 1M902 3BG1B 4A3FI 4LA1A 3J7A4 3ZLFA 1YUAA 1KRLA 1JWHC 3VFCA 1NHSA 2G2KA 1GRHA 2PP3A 3RZOI 2PSNA 3CCV1 1K4QA 5FJRA 4K8GA 3UXKA 1ZK7A 2V45A 1WW9A 4E31A 4E2XA 4S1TA 2WP5A 4K1WA 4ADWA 1KD12 3RCYA 5FLXb 3RO6A 2I3CA 4EM3A 3CC2Z 3CCEZ 1Q811 1XHCA 3JAMf 4NBGA 3DJJA 1QXFA 4ZA0A 3GO2A 3VC5A 2PGWA 3ESWA 3ZLHA 4EM4A 2YADA 4KEMA 5BOFA 3NH5A 4IZGA 4RVGA 1JJ2Z 3MZNA 2J6AA 3DK8A 2WBAA 3NS1B 4H2HA 4IL0A 1Q822 3EMFA 1EC7A 1TYPA 3H70A 1D7YA 3I4MI 2JIQA 3HOZI 2JNYA 3V4BA 3QN3A 3KIHA 2QLVB 5CM2M 3S15I 1TE6A 3CCJ1 3NFZA 1KC82 1SJDA 3AN1A 3IFUA 3SR6B 4MKSA 1Q7Y1 1YHQ1 1Z03A 2XH4A 5FMHA 3EEZA 5G5GB 1ZKQA 1EBHA 3M4OI 1RVKA 3MQTA 2DE6A 3OC4A 3V5CA 1NELA 2GDQA 2GR2A 2PTXA 3Q4DA 4TVYA 3IC9A 1Z01A 5T6BA 4G8TA 3MONA 3CC4Z 1SFOI 3OZMA 3F3PC 3DERA 4JN8A 4ROPA 2VF1A 2AKLA 1AA6A 1H6VA 5FLXf 1YI21 3FKII 4E8GA 2FYMA 1Q16A 1SIWA 2W3RA 3J81f 1VQ61 3S2DI 3GTQI 3GC2A 2PMQA 3R07C 3CXOA 2KI7B 2GR1A 2QA4Z 2E2HI 1XS2A 3LB8A 3GTMI 4EMIA 2P3YA 4NBAA 3U50C 3F3FC 1MOKA 4MD8A 1FEBA 2PU0A 1ONFA 3R1ZA 4IP5A 3ZVHB 2Q4ZA 1TWGI 2QJJA 4YWSA 3HOUI 3ZLGA 4NEWA 1N5XA 1NHPA 3A7AA 2QRDB 4M0XA 1FEAA 1YEYA 2K3RA 3P93A 3S1RI 2R93I 3FCPA 2W0HA 3MY9A 3BG0B 1QVFY 4MH4A 3H7VA 2PK7A 3N4FA 3OTRA 2BC0A 2DW6A 2W03A 1YJNZ 3NDIA 3G711 4H1ZA 1GERA 3TTEA 1N2FA 3I56Z 1FO4A 5AN9F 3J81b 2GGHA 2GRTA 3Q45A 4H4XA 4H50A 5KVHA 1NJI1 2BJOA 3I551 2OTJZ 1JPDX 1VQZA 1L8PA 2QRCB 2FKPA 3FJ4A 4FX9A 4TNUA 3ZVIA 4H4VA 2GU2A 3EAOA 1VLAA 1Y1VI 2WP6A 1IYXA 3DH9A 1MNSA 5JCMA 1QYPA 1I6HI 3CCM1 3SSZA 2OVLA 5T67A 2QDDA 2YU9I 3IF8A 1YUKA 2OOXB 1VQLZ 4NB8A 3P0WA 1RO2A 4RS4A 3D2LA 3FV9A 5D1PA 3RR1A 2E7ZA 2DE5A 4ENLA 2OZ8A 2RABA 1RNIA 1VQ7Z 3BJSA 1ZMDA 1NP6A 4E30A 4HCLA 1W2BZ 3CCRZ 3CAWA 3DDMA 3NO1A 1JROA 3CD6Z 4TVWA 1KQSZ 4A3KI 1QVGZ 3T9PA 1MUCA 1RQFA 3DFYA 2VPWA 3JVAA 2RBLA 1XANA 3A7UA 4DXKA 4KPRA 4HN8A 2EGTA 2NAPA 1EBDA 1VQOZ 1DL6A 5FJUA 1VQ41 2W3SA 3EMIA 3TWBA 3CGDA 2JK6A 3NVZB 3TCSA 3STPA 3G6EZ 1N62C 1GETA 3CMEZ 2QDEA 2OOYB 1LVLA 3GRTA 3ETRB 4G7FA 3PK7A 4E2YA 2XSXA 1GRGA 3QKEA 4HCDA 2E2JI 3B9JB 2JA8I 2VPZA 1BZLA 4M6UA 4RV9A 5IT9f 2GH5A 1R6WA 3J80f 4EQWA 1VQO1 2HZGA 3SBFA 5JCNA 2W54A 3CCQ1 1QVGY 3H8AA 1EBGA 2TPRA 2V3VA 2R9ZA 3CCLZ 1ZY8A 3N6HA 2YAUA 6ENLA 1KD11 4DQYB 3JW7A 4F4RA 1NUIA 4BY7I 4NBEA 2V8IA 3DGBA 2Y0SA 5EU9A 3EEDA 1OJTA 1P43A 1FECA 1FFVC 4E2WA 1GV4A 4MRIA 4MXUA 1Q821
chains in the Genus database with same CATH topology
4H4UA 3OW2Y 3M3YI 2JA7I 3K7AI 3NDJA 4Y7NI 1YJWZ 4BY1I 3J80b 4QTUA 2NVKX 4NBHA 1TWAI 2IZ3A 1JJ2Y 4EMWA 2NVYI 2ZAEB 1N8R1 3GTMS 3I07A 3CCU1 4K7ZA 1NDAA 3GD4A 5JCNA 2X8CA 4YWOA 1TFIA 2O4HA 4NOZA 4MD9A 2ZZBA 2F4OA 1JEHA 3CXCZ 3CMAZ 1VQ91 3KLJA 2JMOA 2O53A 3GTJI 2HU9A 2CFYA 5C44I 1M1K2 1P9NA 3NH4A 3CGCA 3CPWY 4H4QA 3CC41 1MO9A 3S17I 2VUGA 4BURA 4BV6A 2LFUA 3VMIA 1GRFA 2P28A 2CDUA 4J56A 5C4XI 4J57A 1ML8A 3GD3A 2J3NA 4H4RA 2EQ7A 4RVFA 3GTGI 2WPFA 2EQ6A 2QREB 2RT9A 3G4S1 1ZB8A 1QVFZ 3S1QI 4BBRI 3EERA 3FQMA 2RPRA 4XX2A 3GTKI 3CCE1 3L8KA 3G71Z 1Q812 5IP7I 1RO0A 5ER0A 4H4WA 3CPWZ 4H4ZA 1X3ZA 2OTL1 2JR6A 3DJGX 1ZDLA 1K9M2 5LL6f 3CCJZ 4E32A 1S7MA 1BWCA 5FS8A 4NBCA 1YITZ 3GCFA 4A3CI 2OTJ1 1Q861 2R92I 4K8DA 1TWFI 3I561 2QR1B 1YJ9Z 3CC21 2V3AA 1YJN1 3QFAA 1S72Z 1VQ6Z 1S721 4NB9A 2H85A 2WPEA 1Y1WI 2JA5I 1X0TA 3FG2P 5U25A 3P5JB 4Y52I 1QF8A 1VQKZ 1TWCI 1W2BY 3HOWI 3PO3I 1GREA 1NJI2 2V8KA 2GTIA 2R6MA 5EBKA 3G4SZ 1N8R2 1JOAA 1YIT1 4DGLA 1X3WA 2DE7A 4NBDA 4JDRA 1H2IA 5C4JI 1NPXA 3SQPA 3HOVI 5A2Qb 2NVXI 2RIQA 1YI2Z 1M901 1GRAA 3CGEA 2IZ4A 4LIIA 2EQ9A 1USPA 4A3DI 3KIFA 2E9HA 3Q6JA 3VMGA 3PO3S 4NBFA 4A93I 3DGZA 1DXLA 4M52A 3JAMb 1YHQZ 2GTHA 1LQLA 2F5ZA 2QKDA 2OZKA 3D6WA 1YJ91 1F8WA 1GEUA 1ZMCA 2V3BA 2A8XA 2GR3A 5JRBA 4CL1A 1KQSY 3PG6A 3I4NI 2WOWA 3CGBA 1NHRA 1R9TI 3CC71 2GR0A 5A2Qf 3PO2I 1KN0A 5D1OA 1K732 1VQ8Z 3GTLI 1Z02A 1VQM1 2OTLZ 3T4NB 3LXDA 2VUMI 2M48A 4E2ZA 3S14I 3Q87A 3QFBA 5FLMI 2C3DA 3CCSZ 2JA6I 2RHBA 4X6AI 1Q862 1YIJ1 2NPXA 3DK4A 5FS9A 4EQRA 1KC81 2K5RA 3MZLB 3HKZA 1YJW1 5IP9I 3TDHB 2KPIA 2PMZA 4GRTA 4NEVA 2QEX1 2R7ZI 2X50A 3GTPI 2HQMA 2AAQA 3VB9A 3LADA 5IT9b 3S2HI 3LUSA 3CME1 5FS6A 4MD7A 1VQ9Z 1VQ5Z 2V6OA 3RZDI 4A3LI 3GTOI 2YVFA 4H4YA 2YVJA 2WPCA 3EF6A 2M6NA 5T64A 3IX0A 2F4MA 1RLYA 3H4KA 3S16I 3DK9A 1VQPZ 2V8JA 3CCR1 2E2II 4APNA 3S1NI 1VQP1 3H3VJ 4A3BI 3CQZI 3GKQA 4HH4A 1M1K1 5TR3A 5JCLA 3CMA1 2JUBA 3TE5B 1USPB 4NBBA 1VQN1 1TYTA 1AOGA 5JCIA 1Q7Y2 1K8A1 2X8HA 4DK1A 1L1OC 2Q51A 2LIYA 3CCUZ 2GQWA 2BC1A 1TWHI 2WOIA 3QWUA 2YVGA 5FS7A 2NVTI 4EMJA 4A3EI 3CCL1 4JQ9A 3H0GI 2HF1A 4AYBA 4MONA 2WAQA 1VQNZ 2QEXZ 2BCPA 3URHA 3S1MI 4RVDA 1GRTA 1I50I 1V59A 1WCMI 4DNAA 4FDCB 3CCMZ 2WOVA 5JCKA 1ZH1A 3G6E1 1YIJZ 3FQQA 3DGHA 5KVIA 1M6IA 2B63I 1VQ4Z 4NFRA 1YQZA 3VMHA 1VQ71 3CCQZ 2X8GA 1Q1RA 4BBSI 1K731 1VQ51 1GXFA 3OW2Z 1Q1WA 2ZZCA 3MZKB 2ZZ0A 4H4SA 5U1OA 1VQMZ 1GESA 4EWCA 4EQXA 2PM9A 3L5OA 1GRBA 4A3MI 3II4A 3CC7Z 5D1OB 3HOYI 4HGYA 3NH8A 1VQL1 1PFTA 3HOXI 5GRTA 1K83I 1Y1VS 4EQSA 1F3PA 2W04A 2QA41 2C3CA 2YQUA 5C3EI 1WIIA 4E33A 1ZB9A 3CD61 3CCS1 1GSNA 3D9XA 1NHQA 4NH1C 1K9M1 4H4PA 4A3GI 1I3QI 1VQK1 4BXXI 4HGZA 3O0HA 4GR1A 2QAEA 4QTTA 1K8A2 2WB1A 4A3II 3CCVZ 1VQ81 2JS4A 3VTNA 1DNCA 1LPFA 4RVHA 4H4TA 3EANA 4A3JI 2X99A 3CXCY 2EQ8A 2NVQI 3I55Z 1RO4A 1ZX9A 3GRSA 1XDIA 1M902 3BG1B 4A3FI 4LA1A 3J7A4 1YUAA 1KRLA 1JWHC 1NHSA 2G2KA 1GRHA 3RZOI 3CCV1 1K4QA 1ZK7A 1WW9A 4E31A 4E2XA 4S1TA 2WP5A 4ADWA 1KD12 5FLXb 2I3CA 4EM3A 3CC2Z 3CCEZ 1Q811 1XHCA 3JAMf 4NBGA 3DJJA 3ESWA 4EM4A 2YADA 3NH5A 4RVGA 1JJ2Z 2J6AA 3DK8A 2WBAA 3EMFA 1Q822 1TYPA 1D7YA 3I4MI 3HOZI 2JNYA 3KIHA 2QLVB 5CM2M 3S15I 3CCJ1 3NFZA 1KC82 3IFUA 1Q7Y1 1YHQ1 1Z03A 5FMHA 1ZKQA 3M4OI 3OC4A 2DE6A 2GR2A 3IC9A 1Z01A 5T6BA 3RNMA 3MONA 3CC4Z 1SFOI 3F3PC 2VF1A 2AKLA 1H6VA 5FLXf 1YI21 3FKII 3J81f 1VQ61 3S2DI 3GTQI 2KI7B 2GR1A 2QA4Z 2E2HI 3LB8A 3GTMI 4EMIA 2P3YA 4NBAA 3U50C 3F3FC 1MOKA 4MD8A 1FEBA 1ONFA 2Q4ZA 1TWGI 3HOUI 4NEWA 1NHPA 2QRDB 1FEAA 2K3RA 3S1RI 2R93I 2W0HA 3BG0B 1QVFY 4MH4A 2PK7A 2BC0A 2W03A 1YJNZ 3NDIA 3G711 1GERA 1N2FA 3I56Z 5AN9F 3J81b 2GRTA 4H4XA 4H50A 5KVHA 1NJI1 2BJOA 3I551 2OTJZ 4FX9A 2QRCB 4TNUA 4H4VA 2GU2A 3EAOA 1VLAA 1Y1VI 2WP6A 3DH9A 5JCMA 1QYPA 1I6HI 3CCM1 5T67A 2YU9I 3IF8A 1YUKA 2OOXB 1VQLZ 4NB8A 1RO2A 4RS4A 5D1PA 2DE5A 2RABA 1RNIA 1VQ7Z 1ZMDA 1NP6A 4E30A 1W2BZ 3CCRZ 3CD6Z 1KQSZ 4A3KI 1QVGZ 1RQFA 2RBLA 1XANA 4KPRA 2EGTA 1EBDA 1VQOZ 1DL6A 1VQ41 3EMIA 3CGDA 2JK6A 3G6EZ 1GETA 3CMEZ 3GRTA 2OOYB 1LVLA 4E2YA 1GRGA 2E2JI 2JA8I 1BZLA 4RV9A 5IT9f 2GH5A 3J80f 4EQWA 1VQO1 3CCQ1 1QVGY 2TPRA 2R9ZA 3CCLZ 1ZY8A 2YAUA 1KD11 4DQYB 1NUIA 4BY7I 4NBEA 2V8IA 2Y0SA 3EEDA 1OJTA 1FECA 4E2WA 1GV4A 4MRIA 4MXUA 1Q821
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMI A;  3EMF A;  1S7M A;  3D9X A; 
#chains in the Genus database with same CATH topology
 2AL2 B;  4H4U A;  3OW2 Y;  3UGV A;  3M3Y I;  2JA7 I;  3K7A I;  3QPE A;  3NDJ A;  4Y7N I;  2OQY A;  3MSY A;  1XPY A;  3ENL A;  1YJW Z;  3GD6 A;  1DTN A;  3PFR A;  4BY1 I;  2OZT A;  3J80 b;  3IJI A;  4DHG A;  4QTU A;  2NVK X;  4NBH A;  1TWA I;  2IZ3 A;  1JJ2 Y;  4EMW A;  2P0I A;  3I4K A;  2NVY I;  1WZN A;  1N60 C;  2ZAE B;  1N8R 1;  3DEQ A;  3GTM S;  3S5S A;  2PS2 A;  3I07 A;  3CCU 1;  4K7Z A;  1NDA A;  3GD4 A;  2XH0 A;  3UCC A;  4Z1Y A;  1ELS A;  2ONE A;  2X8C A;  1TFI A;  2O4H A;  4NOZ A;  2PPG A;  4MD9 A;  3HRD C;  3NFU A;  3QLD A;  3T6C A;  2ZZB A;  2F4O A;  1JEH A;  1R0M A;  2I5Q A;  3P3B A;  3CT2 A;  3CK5 A;  3T8Q A;  3CXC Z;  3CMA Z;  1VQ9 1;  3KLJ A;  5FJO A;  3SQS A;  2OX4 A;  2JMO A;  2O53 A;  3DIP A;  3GTJ I;  2E5A A;  3QTP A;  4HNC A;  2HU9 A;  3RGT A;  2CFY A;  5C44 I;  1M1K 2;  1F9C A;  1P9N A;  3NH4 A;  1SJB A;  3CGC A;  3CPW Y;  4H4Q A;  3CC4 1;  4H83 A;  1MO9 A;  4IT1 A;  2E3T A;  3S17 I;  2VUG A;  4BUR A;  1ECQ A;  4Z17 A;  4HPN A;  4BV6 A;  1PDY A;  4GIS A;  2LFU A;  3VMI A;  1GRF A;  2NQL A;  2P28 A;  2CDU A;  3OW1 A;  4J56 A;  5C4X I;  1SJC A;  4J57 A;  4J3Z A;  1ML8 A;  2POZ A;  2J3N A;  3GD3 A;  2EQ7 A;  4RVF A;  4H4R A;  3GTG I;  2WPF A;  2EQ6 A;  1T3Q C;  2QRE B;  3NZG A;  1TKK A;  2RT9 A;  3G4S 1;  1ZB8 A;  1QVF Z;  2JIP A;  3S1Q I;  4BBR I;  3RIT A;  3EER A;  3FQM A;  2RPR A;  3TWA A;  3NXL A;  4XX2 A;  3GTK I;  3CCE 1;  1STZ A;  3L8K A;  4E4U A;  1OEP A;  4KPL A;  4ZOH B;  4E5T A;  3G71 Z;  2VPY A;  1Q81 2;  5IP7 I;  1RO0 A;  5ER0 A;  1FDO A;  3IK4 A;  4H4W A;  3CPW Z;  1SB3 B;  4H4Z A;  1X3Z A;  2OTL 1;  2JR6 A;  4IL2 A;  3DJG X;  1ZDL A;  1BQG A;  1K9M 2;  5LL6 f;  3CCJ Z;  4E32 A;  2GGI A;  1S7M A;  1BWC A;  2AKM A;  2PP0 A;  4H19 A;  5FS8 A;  4NBC A;  1YIT Z;  3GCF A;  4A3C I;  4K2S A;  4IHC A;  2JIR A;  2OTJ 1;  1Q86 1;  5FJP A;  3UXL A;  2R92 I;  4K8D A;  1TWF I;  3I56 1;  2QR1 B;  2RDX A;  1YJ9 Z;  3CC2 1;  2V3A A;  3KUM A;  2PCE A;  2XH7 A;  1YJN 1;  3SN1 A;  3QFA A;  3U9I A;  2OKT A;  3VCC A;  3TQP A;  5J04 A;  4A6G A;  1RM6 B;  1S72 Z;  1VQ6 Z;  1X2H A;  2DW7 A;  2IV2 X;  1SJA A;  2GGE A;  4NB9 A;  2H85 A;  1S72 1;  2WPE A;  1Y1W I;  2JA5 I;  1X0T A;  2OLA A;  3FG2 P;  5U25 A;  3P5J B;  4GFI A;  4Y52 I;  1QF8 A;  1VQK Z;  1TWC I;  1W2B Y;  3HOW I;  3PO3 I;  1GRE A;  1NJI 2;  2V8K A;  3UJE A;  2GTI A;  2R6M A;  1V97 A;  2GL5 A;  3NVY B;  5EBK A;  3G4S Z;  1N8R 2;  1JOA A;  1YIT 1;  4DGL A;  1X3W A;  1FFU C;  2DE7 A;  4DX3 A;  2GGJ A;  4NBD A;  4JDR A;  1H2I A;  5C4J I;  1NPX A;  3SQP A;  3HOV I;  5A2Q b;  2NVX I;  2QJM A;  1X2G A;  2RIQ A;  1E9I A;  4DYE A;  2ZAD A;  3DG7 A;  1YI2 Z;  1M90 1;  1GRA A;  2OZ3 A;  3CGE A;  3R10 A;  2IZ4 A;  4LII A;  2EQ9 A;  1USP A;  4A3D I;  1JPM A;  3KIF A;  2E9H A;  3Q6J A;  3VMG A;  3PO3 S;  3CYJ A;  4NBF A;  4A93 I;  4EWJ A;  3DGZ A;  1DXL A;  4M52 A;  3JAM b;  1YHQ Z;  2GTH A;  2LEX A;  1LQL A;  1FIQ B;  2F5Z A;  3TJI A;  2QKD A;  3OPS A;  2PGE A;  2OZK A;  3D6W A;  4HYR A;  1YJ9 1;  1F8W A;  1GEU A;  1ZMC A;  2POD A;  2V3B A;  3N6J A;  2A8X A;  2GR3 A;  2PA6 A;  3UJ2 A;  4DN1 A;  2XGZ A;  3PWI A;  2OO6 A;  5JRB A;  4CL1 A;  1KQS Y;  3PG6 A;  3VA8 A;  3I4N I;  2WOW A;  3CGB A;  1NHR A;  2OQH A;  1R9T I;  3CC7 1;  2GR0 A;  5A2Q f;  3PO2 I;  1KN0 A;  1P48 A;  3IJL A;  2AYD A;  5D1O A;  3FVD A;  2ZC8 A;  3D47 A;  1K73 2;  2CHR A;  1VQ8 Z;  3GTL I;  1Z02 A;  1PDZ A;  1VQM 1;  2OTL Z;  3T4N B;  3LXD A;  2VUM I;  2M48 A;  3A7R A;  4E2Z A;  3JZU A;  3S14 I;  3Q87 A;  4GGH A;  3QFB A;  3EKG A;  4FP1 A;  3N4E A;  2AKZ A;  5FLM I;  2C3D A;  3AM9 A;  3IR7 A;  3CCS Z;  2JA6 I;  2RHB A;  4X6A I;  3TW9 A;  1Q86 2;  1WYG A;  1YIJ 1;  2NPX A;  3DK4 A;  3K1G A;  5FS9 A;  2P8B A;  3UCD A;  1FDI A;  4EQR A;  2O56 A;  1KC8 1;  2K5R A;  3MZL B;  3HKZ A;  1YJW 1;  5IP9 I;  3TDH B;  2KPI A;  3V3W A;  2PMZ A;  3UJF A;  4GRT A;  4NEV A;  4YWO A;  2QEX 1;  2R7Z I;  2X50 A;  3GTP I;  2HQM A;  3HPF A;  3V5F A;  2QVH A;  3R0K A;  3RRA A;  2AAQ A;  3VB9 A;  3LAD A;  2GSH A;  4JHM A;  5IDZ A;  3I6E A;  5IT9 b;  1KKR A;  3DG6 A;  4A3R A;  1N63 C;  3S2H I;  3LUS A;  3CME 1;  5FS6 A;  4MD7 A;  1BKH A;  1VQ9 Z;  1VQ5 Z;  4E6M A;  4X2P A;  4HCH A;  2V6O A;  4E4F A;  3RZD I;  4A3L I;  3VC6 A;  1JDF A;  3GTO I;  2YVF A;  3OP2 A;  4H4Y A;  4HNL A;  1W6T A;  2YVJ A;  2WPC A;  3EF6 A;  3SN4 A;  7ENL A;  3DFH A;  3RNM A;  2M6N A;  5T64 A;  2PU1 A;  4A35 A;  3IX0 A;  2F4M A;  3NVW B;  3U4F A;  1RLY A;  4ZCW A;  3H4K A;  3CXB A;  3S16 I;  3DK9 A;  1VQP Z;  2V8J A;  3CCR 1;  2E2I I;  4GIR A;  5ENL A;  4APN A;  3S1N I;  3AMZ A;  1VQP 1;  3H3V J;  4A3B I;  3CQZ I;  3GKQ A;  1MRA A;  4HH4 A;  1EC8 A;  1M1K 1;  5TR3 A;  5BOE A;  5JCL A;  3CMA 1;  2OPJ A;  1KKO A;  2JUB A;  3TE5 B;  1USP B;  4NBB A;  1VQN 1;  1TYT A;  1AOG A;  5JCI A;  2JIM A;  1Q7Y 2;  1K8A 1;  2X8H A;  4DK1 A;  3UJR A;  3CB3 A;  4MMW A;  1L1O C;  1VDV A;  3BOX A;  2Q51 A;  2LIY A;  3CCU Z;  2GQW A;  2PTZ A;  2BC1 A;  4KT2 A;  1N61 C;  1TWH I;  3FYY A;  4JN7 A;  2WOI A;  3QWU A;  2YVG A;  5FS7 A;  1MDR A;  2NVT I;  2QQ6 A;  3IJQ A;  3D46 A;  4EMJ A;  4A3E I;  5FJT A;  3CCL 1;  4JQ9 A;  3EUB 3;  3H0G I;  2HF1 A;  2VPX A;  4AYB A;  3VDG A;  1JRP A;  4MON A;  3R0U A;  2WAQ A;  4J1O A;  3ZVH A;  1VQN Z;  2QEX Z;  2BCP A;  2HXT A;  2P8C A;  3URH A;  2MUC A;  3S1M I;  4RVD A;  1GRT A;  1I50 I;  1V59 A;  1WCM I;  2MNR A;  4DNA A;  3T4W A;  4FDC B;  3CCM Z;  1KCZ A;  2WOV A;  5JCK A;  1ZH1 A;  3G6E 1;  1YIJ Z;  3FQQ A;  3DGH A;  5KVI A;  2QGY A;  1TZZ A;  1M6I A;  2B63 I;  1VQ4 Z;  3UJS A;  4NFR A;  1YQZ A;  3VMH A;  1VQ7 1;  3S47 A;  3CCQ Z;  2X8G A;  3TOY A;  1Q1R A;  4BBS I;  2GGG A;  2AL2 A;  1KD0 A;  1K73 1;  1VQ5 1;  1GXF A;  3OW2 Z;  1Q1W A;  2PP1 A;  2PTW A;  3SJN A;  3ES8 A;  2ZZC A;  3MZK B;  1MDL A;  2P3Z A;  1WUE A;  2ZZ0 A;  4H4S A;  5U1O A;  1FHU A;  2W55 A;  1FHV A;  3SN0 A;  4GYP A;  1VQM Z;  1GES A;  4EWC A;  2XH2 A;  3H12 A;  2AL1 A;  4EQX A;  2PM9 A;  1ONE A;  3L5O A;  1GRB A;  1WJ2 A;  4A3M I;  1JCT A;  3II4 A;  1ZXI C;  3CC7 Z;  2OFJ A;  5D1O B;  3HOY I;  3NRZ B;  3TJ4 A;  4DWD A;  4HGY A;  3NH8 A;  1VQL 1;  1PFT A;  3HOX I;  2HXU A;  5GRT A;  1K83 I;  1Y1V S;  4EQS A;  1F3P A;  2W04 A;  2QA4 1;  2C3C A;  2YQU A;  4MGG A;  5C3E I;  3HW2 A;  4GYP C;  2PTY A;  3MUC A;  1WII A;  4E33 A;  1ZB9 A;  3CD6 1;  1Y8C A;  3NVV B;  3MKC A;  3R25 A;  4KWS A;  3CCS 1;  1GSN A;  2QJN A;  4GME A;  3D9X A;  1NHQ A;  4FI4 A;  2P88 A;  4NH1 C;  1K9M 1;  4IP4 A;  4H4P A;  4A3G I;  3VCN A;  1I3Q I;  3DES A;  3R11 A;  3ES7 A;  1VQK 1;  2HNE A;  4BXX I;  4HGZ A;  3O0H A;  4GR1 A;  3THU A;  2QAE A;  3DG3 A;  4QTT A;  1K8A 2;  2WB1 A;  3GY1 A;  1WUF A;  4A3I I;  2OG9 A;  3CCV Z;  1VQ8 1;  2JS4 A;  3VTN A;  3B97 A;  1DNC A;  5G5H B;  2JIO A;  1N5W C;  3I6T A;  1LPF A;  3MWC A;  4RVH A;  1NU5 A;  3OZY A;  4H4T A;  3EAN A;  4A3J I;  3BSM A;  2X99 A;  3CXC Y;  2EQ8 A;  3PWG A;  2NVQ I;  3I55 Z;  1EC9 A;  1RO4 A;  1ZX9 A;  4GGB A;  3GRS A;  3FXG A;  1XDI A;  1M90 2;  3BG1 B;  4A3F I;  4LA1 A;  3J7A 4;  3ZLF A;  1YUA A;  1KRL A;  1JWH C;  3VFC A;  1NHS A;  2G2K A;  1GRH A;  2PP3 A;  3RZO I;  2PSN A;  3CCV 1;  1K4Q A;  5FJR A;  4K8G A;  3UXK A;  1ZK7 A;  2V45 A;  1WW9 A;  4E31 A;  4E2X A;  4S1T A;  2WP5 A;  4K1W A;  4ADW A;  1KD1 2;  3RCY A;  5FLX b;  3RO6 A;  2I3C A;  4EM3 A;  3CC2 Z;  3CCE Z;  1Q81 1;  1XHC A;  3JAM f;  4NBG A;  3DJJ A;  1QXF A;  4ZA0 A;  3GO2 A;  3VC5 A;  2PGW A;  3ESW A;  3ZLH A;  4EM4 A;  2YAD A;  4KEM A;  5BOF A;  3NH5 A;  4IZG A;  4RVG A;  1JJ2 Z;  3MZN A;  2J6A A;  3DK8 A;  2WBA A;  3NS1 B;  4H2H A;  4IL0 A;  1Q82 2;  3EMF A;  1EC7 A;  1TYP A;  3H70 A;  1D7Y A;  3I4M I;  2JIQ A;  3HOZ I;  2JNY A;  3V4B A;  3QN3 A;  3KIH A;  2QLV B;  5CM2 M;  3S15 I;  1TE6 A;  3CCJ 1;  3NFZ A;  1KC8 2;  1SJD A;  3AN1 A;  3IFU A;  3SR6 B;  4MKS A;  1Q7Y 1;  1YHQ 1;  1Z03 A;  2XH4 A;  5FMH A;  3EEZ A;  5G5G B;  1ZKQ A;  1EBH A;  3M4O I;  1RVK A;  3MQT A;  2DE6 A;  3OC4 A;  3V5C A;  1NEL A;  2GDQ A;  2GR2 A;  2PTX A;  3Q4D A;  4TVY A;  3IC9 A;  1Z01 A;  5T6B A;  4G8T A;  3MON A;  3CC4 Z;  1SFO I;  3OZM A;  3F3P C;  3DER A;  4JN8 A;  4ROP A;  2VF1 A;  2AKL A;  1AA6 A;  1H6V A;  5FLX f;  1YI2 1;  3FKI I;  4E8G A;  2FYM A;  1Q16 A;  1SIW A;  2W3R A;  3J81 f;  1VQ6 1;  3S2D I;  3GTQ I;  3GC2 A;  2PMQ A;  3R07 C;  3CXO A;  2KI7 B;  2GR1 A;  2QA4 Z;  2E2H I;  1XS2 A;  3LB8 A;  3GTM I;  4EMI A;  2P3Y A;  4NBA A;  3U50 C;  3F3F C;  1MOK A;  4MD8 A;  1FEB A;  2PU0 A;  1ONF A;  3R1Z A;  4IP5 A;  3ZVH B;  2Q4Z A;  1TWG I;  2QJJ A;  4YWS A;  3HOU I;  3ZLG A;  4NEW A;  1N5X A;  1NHP A;  3A7A A;  2QRD B;  4M0X A;  1FEA A;  1YEY A;  2K3R A;  3P93 A;  3S1R I;  2R93 I;  3FCP A;  2W0H A;  3MY9 A;  3BG0 B;  1QVF Y;  4MH4 A;  3H7V A;  2PK7 A;  3N4F A;  3OTR A;  2BC0 A;  2DW6 A;  2W03 A;  1YJN Z;  3NDI A;  3G71 1;  4H1Z A;  1GER A;  3TTE A;  1N2F A;  3I56 Z;  1FO4 A;  5AN9 F;  3J81 b;  2GGH A;  2GRT A;  3Q45 A;  4H4X A;  4H50 A;  5KVH A;  1NJI 1;  2BJO A;  3I55 1;  2OTJ Z;  1JPD X;  1VQZ A;  1L8P A;  2QRC B;  2FKP A;  3FJ4 A;  4FX9 A;  4TNU A;  3ZVI A;  4H4V A;  2GU2 A;  3EAO A;  1VLA A;  1Y1V I;  2WP6 A;  1IYX A;  3DH9 A;  1MNS A;  5JCM A;  1QYP A;  1I6H I;  3CCM 1;  3SSZ A;  2OVL A;  5T67 A;  2QDD A;  2YU9 I;  3IF8 A;  1YUK A;  2OOX B;  1VQL Z;  4NB8 A;  3P0W A;  1RO2 A;  4RS4 A;  3D2L A;  3FV9 A;  5D1P A;  3RR1 A;  2E7Z A;  2DE5 A;  4ENL A;  2OZ8 A;  2RAB A;  1RNI A;  1VQ7 Z;  3BJS A;  1ZMD A;  1NP6 A;  4E30 A;  4HCL A;  1W2B Z;  3CCR Z;  3CAW A;  3DDM A;  3NO1 A;  1JRO A;  3CD6 Z;  4TVW A;  1KQS Z;  4A3K I;  1QVG Z;  3T9P A;  1MUC A;  1RQF A;  3DFY A;  2VPW A;  3JVA A;  2RBL A;  1XAN A;  3A7U A;  4DXK A;  4KPR A;  4HN8 A;  2EGT A;  2NAP A;  1EBD A;  1VQO Z;  1DL6 A;  5FJU A;  1VQ4 1;  2W3S A;  3EMI A;  3TWB A;  3CGD A;  2JK6 A;  3NVZ B;  3TCS A;  3STP A;  3G6E Z;  1N62 C;  1GET A;  3CME Z;  2QDE A;  2OOY B;  1LVL A;  3GRT A;  3ETR B;  4G7F A;  3PK7 A;  4E2Y A;  2XSX A;  1GRG A;  3QKE A;  4HCD A;  2E2J I;  3B9J B;  2JA8 I;  2VPZ A;  1BZL A;  4M6U A;  4RV9 A;  5IT9 f;  2GH5 A;  1R6W A;  3J80 f;  4EQW A;  1VQO 1;  2HZG A;  3SBF A;  5JCN A;  2W54 A;  3CCQ 1;  1QVG Y;  3H8A A;  1EBG A;  2TPR A;  2V3V A;  2R9Z A;  3CCL Z;  1ZY8 A;  3N6H A;  2YAU A;  6ENL A;  1KD1 1;  4DQY B;  3JW7 A;  4F4R A;  1NUI A;  4BY7 I;  4NBE A;  2V8I A;  3DGB A;  2Y0S A;  5EU9 A;  3EED A;  1OJT A;  1P43 A;  1FEC A;  1FFV C;  4E2W A;  1GV4 A;  4MRI A;  4MXU A;  1Q82 1; 
#chains in the Genus database with same CATH homology
 4H4U A;  3OW2 Y;  3M3Y I;  2JA7 I;  3K7A I;  3NDJ A;  4Y7N I;  1YJW Z;  4BY1 I;  3J80 b;  4QTU A;  2NVK X;  4NBH A;  1TWA I;  2IZ3 A;  1JJ2 Y;  4EMW A;  2NVY I;  2ZAE B;  1N8R 1;  3GTM S;  3I07 A;  3CCU 1;  4K7Z A;  1NDA A;  3GD4 A;  5JCN A;  2X8C A;  4YWO A;  1TFI A;  2O4H A;  4NOZ A;  4MD9 A;  2ZZB A;  2F4O A;  1JEH A;  3CXC Z;  3CMA Z;  1VQ9 1;  3KLJ A;  2JMO A;  2O53 A;  3GTJ I;  2HU9 A;  2CFY A;  5C44 I;  1M1K 2;  1P9N A;  3NH4 A;  3CGC A;  3CPW Y;  4H4Q A;  3CC4 1;  1MO9 A;  3S17 I;  2VUG A;  4BUR A;  4BV6 A;  2LFU A;  3VMI A;  1GRF A;  2P28 A;  2CDU A;  4J56 A;  5C4X I;  4J57 A;  1ML8 A;  3GD3 A;  2J3N A;  4H4R A;  2EQ7 A;  4RVF A;  3GTG I;  2WPF A;  2EQ6 A;  2QRE B;  2RT9 A;  3G4S 1;  1ZB8 A;  1QVF Z;  3S1Q I;  4BBR I;  3EER A;  3FQM A;  2RPR A;  4XX2 A;  3GTK I;  3CCE 1;  3L8K A;  3G71 Z;  1Q81 2;  5IP7 I;  1RO0 A;  5ER0 A;  4H4W A;  3CPW Z;  4H4Z A;  1X3Z A;  2OTL 1;  2JR6 A;  3DJG X;  1ZDL A;  1K9M 2;  5LL6 f;  3CCJ Z;  4E32 A;  1S7M A;  1BWC A;  5FS8 A;  4NBC A;  1YIT Z;  3GCF A;  4A3C I;  2OTJ 1;  1Q86 1;  2R92 I;  4K8D A;  1TWF I;  3I56 1;  2QR1 B;  1YJ9 Z;  3CC2 1;  2V3A A;  1YJN 1;  3QFA A;  1S72 Z;  1VQ6 Z;  1S72 1;  4NB9 A;  2H85 A;  2WPE A;  1Y1W I;  2JA5 I;  1X0T A;  3FG2 P;  5U25 A;  3P5J B;  4Y52 I;  1QF8 A;  1VQK Z;  1TWC I;  1W2B Y;  3HOW I;  3PO3 I;  1GRE A;  1NJI 2;  2V8K A;  2GTI A;  2R6M A;  5EBK A;  3G4S Z;  1N8R 2;  1JOA A;  1YIT 1;  4DGL A;  1X3W A;  2DE7 A;  4NBD A;  4JDR A;  1H2I A;  5C4J I;  1NPX A;  3SQP A;  3HOV I;  5A2Q b;  2NVX I;  2RIQ A;  1YI2 Z;  1M90 1;  1GRA A;  3CGE A;  2IZ4 A;  4LII A;  2EQ9 A;  1USP A;  4A3D I;  3KIF A;  2E9H A;  3Q6J A;  3VMG A;  3PO3 S;  4NBF A;  4A93 I;  3DGZ A;  1DXL A;  4M52 A;  3JAM b;  1YHQ Z;  2GTH A;  1LQL A;  2F5Z A;  2QKD A;  2OZK A;  3D6W A;  1YJ9 1;  1F8W A;  1GEU A;  1ZMC A;  2V3B A;  2A8X A;  2GR3 A;  5JRB A;  4CL1 A;  1KQS Y;  3PG6 A;  3I4N I;  2WOW A;  3CGB A;  1NHR A;  1R9T I;  3CC7 1;  2GR0 A;  5A2Q f;  3PO2 I;  1KN0 A;  5D1O A;  1K73 2;  1VQ8 Z;  3GTL I;  1Z02 A;  1VQM 1;  2OTL Z;  3T4N B;  3LXD A;  2VUM I;  2M48 A;  4E2Z A;  3S14 I;  3Q87 A;  3QFB A;  5FLM I;  2C3D A;  3CCS Z;  2JA6 I;  2RHB A;  4X6A I;  1Q86 2;  1YIJ 1;  2NPX A;  3DK4 A;  5FS9 A;  4EQR A;  1KC8 1;  2K5R A;  3MZL B;  3HKZ A;  1YJW 1;  5IP9 I;  3TDH B;  2KPI A;  2PMZ A;  4GRT A;  4NEV A;  2QEX 1;  2R7Z I;  2X50 A;  3GTP I;  2HQM A;  2AAQ A;  3VB9 A;  3LAD A;  5IT9 b;  3S2H I;  3LUS A;  3CME 1;  5FS6 A;  4MD7 A;  1VQ9 Z;  1VQ5 Z;  2V6O A;  3RZD I;  4A3L I;  3GTO I;  2YVF A;  4H4Y A;  2YVJ A;  2WPC A;  3EF6 A;  2M6N A;  5T64 A;  3IX0 A;  2F4M A;  1RLY A;  3H4K A;  3S16 I;  3DK9 A;  1VQP Z;  2V8J A;  3CCR 1;  2E2I I;  4APN A;  3S1N I;  1VQP 1;  3H3V J;  4A3B I;  3CQZ I;  3GKQ A;  4HH4 A;  1M1K 1;  5TR3 A;  5JCL A;  3CMA 1;  2JUB A;  3TE5 B;  1USP B;  4NBB A;  1VQN 1;  1TYT A;  1AOG A;  5JCI A;  1Q7Y 2;  1K8A 1;  2X8H A;  4DK1 A;  1L1O C;  2Q51 A;  2LIY A;  3CCU Z;  2GQW A;  2BC1 A;  1TWH I;  2WOI A;  3QWU A;  2YVG A;  5FS7 A;  2NVT I;  4EMJ A;  4A3E I;  3CCL 1;  4JQ9 A;  3H0G I;  2HF1 A;  4AYB A;  4MON A;  2WAQ A;  1VQN Z;  2QEX Z;  2BCP A;  3URH A;  3S1M I;  4RVD A;  1GRT A;  1I50 I;  1V59 A;  1WCM I;  4DNA A;  4FDC B;  3CCM Z;  2WOV A;  5JCK A;  1ZH1 A;  3G6E 1;  1YIJ Z;  3FQQ A;  3DGH A;  5KVI A;  1M6I A;  2B63 I;  1VQ4 Z;  4NFR A;  1YQZ A;  3VMH A;  1VQ7 1;  3CCQ Z;  2X8G A;  1Q1R A;  4BBS I;  1K73 1;  1VQ5 1;  1GXF A;  3OW2 Z;  1Q1W A;  2ZZC A;  3MZK B;  2ZZ0 A;  4H4S A;  5U1O A;  1VQM Z;  1GES A;  4EWC A;  4EQX A;  2PM9 A;  3L5O A;  1GRB A;  4A3M I;  3II4 A;  3CC7 Z;  5D1O B;  3HOY I;  4HGY A;  3NH8 A;  1VQL 1;  1PFT A;  3HOX I;  5GRT A;  1K83 I;  1Y1V S;  4EQS A;  1F3P A;  2W04 A;  2QA4 1;  2C3C A;  2YQU A;  5C3E I;  1WII A;  4E33 A;  1ZB9 A;  3CD6 1;  3CCS 1;  1GSN A;  3D9X A;  1NHQ A;  4NH1 C;  1K9M 1;  4H4P A;  4A3G I;  1I3Q I;  1VQK 1;  4BXX I;  4HGZ A;  3O0H A;  4GR1 A;  2QAE A;  4QTT A;  1K8A 2;  2WB1 A;  4A3I I;  3CCV Z;  1VQ8 1;  2JS4 A;  3VTN A;  1DNC A;  1LPF A;  4RVH A;  4H4T A;  3EAN A;  4A3J I;  2X99 A;  3CXC Y;  2EQ8 A;  2NVQ I;  3I55 Z;  1RO4 A;  1ZX9 A;  3GRS A;  1XDI A;  1M90 2;  3BG1 B;  4A3F I;  4LA1 A;  3J7A 4;  1YUA A;  1KRL A;  1JWH C;  1NHS A;  2G2K A;  1GRH A;  3RZO I;  3CCV 1;  1K4Q A;  1ZK7 A;  1WW9 A;  4E31 A;  4E2X A;  4S1T A;  2WP5 A;  4ADW A;  1KD1 2;  5FLX b;  2I3C A;  4EM3 A;  3CC2 Z;  3CCE Z;  1Q81 1;  1XHC A;  3JAM f;  4NBG A;  3DJJ A;  3ESW A;  4EM4 A;  2YAD A;  3NH5 A;  4RVG A;  1JJ2 Z;  2J6A A;  3DK8 A;  2WBA A;  3EMF A;  1Q82 2;  1TYP A;  1D7Y A;  3I4M I;  3HOZ I;  2JNY A;  3KIH A;  2QLV B;  5CM2 M;  3S15 I;  3CCJ 1;  3NFZ A;  1KC8 2;  3IFU A;  1Q7Y 1;  1YHQ 1;  1Z03 A;  5FMH A;  1ZKQ A;  3M4O I;  3OC4 A;  2DE6 A;  2GR2 A;  3IC9 A;  1Z01 A;  5T6B A;  3RNM A;  3MON A;  3CC4 Z;  1SFO I;  3F3P C;  2VF1 A;  2AKL A;  1H6V A;  5FLX f;  1YI2 1;  3FKI I;  3J81 f;  1VQ6 1;  3S2D I;  3GTQ I;  2KI7 B;  2GR1 A;  2QA4 Z;  2E2H I;  3LB8 A;  3GTM I;  4EMI A;  2P3Y A;  4NBA A;  3U50 C;  3F3F C;  1MOK A;  4MD8 A;  1FEB A;  1ONF A;  2Q4Z A;  1TWG I;  3HOU I;  4NEW A;  1NHP A;  2QRD B;  1FEA A;  2K3R A;  3S1R I;  2R93 I;  2W0H A;  3BG0 B;  1QVF Y;  4MH4 A;  2PK7 A;  2BC0 A;  2W03 A;  1YJN Z;  3NDI A;  3G71 1;  1GER A;  1N2F A;  3I56 Z;  5AN9 F;  3J81 b;  2GRT A;  4H4X A;  4H50 A;  5KVH A;  1NJI 1;  2BJO A;  3I55 1;  2OTJ Z;  4FX9 A;  2QRC B;  4TNU A;  4H4V A;  2GU2 A;  3EAO A;  1VLA A;  1Y1V I;  2WP6 A;  3DH9 A;  5JCM A;  1QYP A;  1I6H I;  3CCM 1;  5T67 A;  2YU9 I;  3IF8 A;  1YUK A;  2OOX B;  1VQL Z;  4NB8 A;  1RO2 A;  4RS4 A;  5D1P A;  2DE5 A;  2RAB A;  1RNI A;  1VQ7 Z;  1ZMD A;  1NP6 A;  4E30 A;  1W2B Z;  3CCR Z;  3CD6 Z;  1KQS Z;  4A3K I;  1QVG Z;  1RQF A;  2RBL A;  1XAN A;  4KPR A;  2EGT A;  1EBD A;  1VQO Z;  1DL6 A;  1VQ4 1;  3EMI A;  3CGD A;  2JK6 A;  3G6E Z;  1GET A;  3CME Z;  3GRT A;  2OOY B;  1LVL A;  4E2Y A;  1GRG A;  2E2J I;  2JA8 I;  1BZL A;  4RV9 A;  5IT9 f;  2GH5 A;  3J80 f;  4EQW A;  1VQO 1;  3CCQ 1;  1QVG Y;  2TPR A;  2R9Z A;  3CCL Z;  1ZY8 A;  2YAU A;  1KD1 1;  4DQY B;  1NUI A;  4BY7 I;  4NBE A;  2V8I A;  2Y0S A;  3EED A;  1OJT A;  1FEC A;  4E2W A;  1GV4 A;  4MRI A;  4MXU A;  1Q82 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...