1S7MA

Crystal structure of hiabd1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
158
structure length
158
Chain Sequence
GAKTEINKDGLTITPANGAGANNANTISVTKDGISAGGQSVKNVVSGLKKFGDANFDPLTSSADNLTKQNDDAYKGLTNLDEKGTDKQTPVVADNTAATVGDLRGLGWVISADKTTGGSTEYHDQVRNANEVKFKSGNGINVSGKTVNGRREITFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Hia
publication title Structural basis for host recognition by the Haemophilus influenzae Hia autotransporter.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 27
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15403 HiaBD2 HiaBD2_N domain of Trimeric autotransporter adhesin (GIN)
A PF18669 Trp_ring Trimeric autotransporter adhesin Trp ring domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.140 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s7mA03
3.30.390.90 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1s7mA01
3.90.1780.10 Alpha Beta Alpha-Beta Complex Trimeric adhesin Trimeric adhesin 1s7mA02
3EMFA 3EMIA 1S7MA 3D9XA
chains in the Genus database with same CATH superfamily
1NUIA 3CC7Z 1ZY8A 2R6MA 3DK9A 4HGYA 2W3RA 1N2FA 3SJNA 4YWOA 3II4A 2WBAA 3DEQA 4IT1A 4EMJA 4H4RA 3IJQA 2GTHA 1FFUC 3GD4A 4TVYA 2K5RA 3VMGA 1YJ9Z 4H4YA 3CCUZ 3FV9A 4GGBA 2VF1A 3CCMZ 2CFYA 2JIMA 3LADA 3J80b 1W2BY 2YVJA 4J3ZA 3D46A 3MUCA 2RT9A 1K731 2WB1A 3MZKB 3RR1A 1NHRA 1WYGA 3V4BA 2HZGA 1TFIA 1YI2Z 2ZZBA 3GD3A 2W3SA 3H70A 2OTJZ 4K8GA 2E2HI 1Z02A 1PDYA 4MKSA 3S1NI 1NHPA 2XH4A 1WUFA 3AN1A 2PM9A 2PGWA 2NVYI 2WPFA 1Q861 4NB8A 1VQOZ 1P48A 2EQ6A 2ZZCA 2GDQA 3U9IA 1RLYA 2OTL1 2JMOA 1BKHA 1EC9A 1Q1WA 3QKEA 1ZH1A 3DDMA 3FKII 5FLMI 3DJJA 3S16I 4NEWA 3KIFA 1ECQA 4DGLA 2YQUA 3DG7A 3HOXI 3CXOA 4MGGA 1Q812 3OC4A 1BZLA 3DESA 2BC1A 5C44I 2XH2A 3I6EA 1BWCA 5J04A 4A3LI 1TKKA 3V5CA 4KWSA 4X2PA 1ZXIC 3SN4A 3DGBA 3UGVA 1LPFA 5FS8A 2PU0A 1STZA 1XDIA 1VQK1 1SB3B 4EWJA 1SJAA 4E4UA 3IX0A 4IP5A 5C4JI 2NPXA 4HNLA 4IL2A 5AN9F 1VQ91 2KI7B 1RQFA 2QRDB 2E2II 1USPB 1YUKA 3TW9A 2IZ4A 1NJI2 3MONA 1EBDA 1PDZA 2WOWA 2YVFA 4CL1A 2HQMA 4NBHA 1TWAI 2EQ7A 3IK4A 3T8QA 3BSMA 3I4NI 3KIHA 3CC4Z 1MDRA 2DW6A 1MUCA 1ZMDA 4H4WA 4M52A 2ZZ0A 1Y1VI 4Y7NI 4H2HA 1S72Z 2W04A 2QJMA 3R1ZA 3V5FA 3CD61 3S1QI 4EM4A 4DQYB 1KN0A 2GSHA 4EMWA 2JA8I 2OKTA 4S1TA 4H19A 2PSNA 2F5ZA 3ZVHA 3EMIA 2ZADA 4E6MA 2WP5A 3NS1B 5T6BA 3HOWI 2GU2A 2WPEA 3QLDA 3UJEA 4RVGA 1ZMCA 3UJRA 5BOFA 2R93I 3S17I 1X3ZA 2XSXA 2OVLA 3VCNA 4E33A 2NVTI 2QAEA 2MUCA 5FJOA 3PFRA 2PU1A 3H4KA 3RITA 2E7ZA 2E9HA 3EAOA 3NXLA 1SFOI 3GTQI 3P0WA 2HU9A 1MRAA 1EBGA 3GTMS 5IDZA 2M48A 1VQ9Z 3TDHB 2O4HA 2OLAA 3CGBA 1JJ2Y 3CCS1 4ROPA 5D1OA 4RVDA 1M901 1PFTA 2K3RA 4DHGA 1MO9A 3NFUA 4GFIA 1JDFA 5G5HB 2XGZA 3K7AI 2NVQI 3M3YI 5GRTA 3NVVB 4ZCWA 3VC5A 3QN3A 2CDUA 1N5XA 3D6WA 5ER0A 1ZK7A 2IZ3A 2ZC8A 4NBAA 3CD6Z 2PPGA 1XANA 3HPFA 2JA6I 3UXLA 4LIIA 4X6AI 3DG3A 2NQLA 4A3CI 3BG0B 2JA5I 2PCEA 3H0GI 1Q862 1SJCA 4G8TA 2QA4Z 2QQ6A 1LQLA 2V8IA 1FFVC 2DE7A 2A8XA 3NRZB 4GYPA 2JIPA 3T4NB 1L1OC 3HOVI 3CC21 3Q4DA 4MD7A 3S1MI 3F3PC 1JOAA 4DYEA 2OPJA 2OOXB 3EEDA 3CMA1 1EC7A 3DK4A 4NBEA 3HOUI 2GGGA 4EQWA 3SN1A 1I6HI 3FXGA 3CXCY 3VMIA 3ENLA 2NVXI 3SN0A 2OZTA 3EANA 2GRTA 3FYYA 2KPIA 2PMZA 1TYTA 3CCSZ 3G711 2QVHA 2AL2A 4A3FI 3ZLFA 3DK8A 3TJ4A 2NAPA 3LXDA 3MY9A 2GH5A 2OX4A 2JA7I 3JZUA 1JWHC 1FDOA 3CCLZ 1MDLA 2AL1A 2POZA 1N60C 3NZGA 1DXLA 5T64A 1JJ2Z 2GR2A 4JN8A 1ZB9A 5D1PA 1VLAA 3Q6JA 1I50I 1VQ81 1TYPA 1VQ61 5FS7A 2JIOA 3EF6A 2I5QA 4DWDA 1KCZA 1N61C 1RO0A 1GETA 1M1K1 2R9ZA 2V3VA 3CCJ1 3OW2Y 4HH4A 2J6AA 4K2SA 2VUGA 3ETRB 2GGIA 3Q87A 5FMHA 3FJ4A 3FCPA 1RO4A 4H4PA 1NHQA 3I561 3RZDI 3F3FC 3L5OA 1NU5A 2C3DA 3CC2Z 1F9CA 1GESA 4A3II 2GR3A 3PG6A 1MOKA 5FJRA 2AYDA 3CMAZ 1R0MA 4KPRA 3TCSA 1WJ2A 1NDAA 1EC8A 2JK6A 1GERA 4RS4A 2OG9A 2HNEA 1IYXA 2GL5A 3B97A 4FDCB 1Q822 2VUMI 3HW2A 4ENLA 2EQ9A 1YQZA 4EWCA 1FHVA 1GRGA 3UJ2A 3G71Z 4KPLA 4A3RA 4A3BI 1RO2A 4HN8A 3OW1A 2FYMA 4LA1A 3CXCZ 3TOYA 3ZVIA 3N4EA 5FJTA 3CYJA 4EMIA 2P8CA 1RM6B 4MXUA 1VQ71 1YHQ1 1VQL1 1VQ8Z 1K8A1 1VQ6Z 1ONEA 3ZLGA 4MH4A 1FO4A 3HKZA 1RVKA 3MKCA 1KKRA 1M902 5IP9I 2P88A 5FLXf 1GREA 2NVKX 5JRBA 3URHA 4J56A 2GGJA 2QR1B 3HRDC 4DN1A 1KQSY 2O56A 1KD11 4E32A 2E2JI 2B63I 5C4XI 4NBBA 3OW2Z 3NFZA 3RZOI 4AYBA 1JPMA 2X50A 2BJOA 4HCDA 2R92I 3ZVHB 4EQRA 4GR1A 1GRAA 3JVAA 3R0KA 5FJPA 3DERA 2Y0SA 3CB3A 2LFUA 3R11A 4E31A 4JQ9A 2RBLA 3N6JA 1Y1WI 1AA6A 2OQHA 2PMQA 2OTLZ 1FHUA 2G2KA 3DH9A 1GRBA 4JDRA 2PODA 1YIJ1 3KLJA 1N5WC 3NDIA 2AAQA 1QF8A 2XH0A 5FLXb 3KUMA 1NP6A 2E5AA 2H85A 1ML8A 2RABA 3A7RA 1K9M2 3SQSA 2YADA 2F4OA 3GTOI 1MNSA 4E2XA 3CXBA 3PO2I 1VDVA 3CT2A 4EQSA 1VQP1 4RV9A 2I3CA 2W03A 1YHQZ 2MNRA 3O0HA 4EQXA 5BOEA 2PS2A 3PO3I 5D1OB 5JCNA 3GCFA 1K8A2 2GGHA 3D2LA 1VQKZ 4E2ZA 2WOVA 2ONEA 3MZLB 1JRPA 3B9JB 3DIPA 3DGZA 3CCV1 3EKGA 3IJIA 5A2Qb 1BQGA 1X0TA 4HPNA 1AOGA 2Q4ZA 2JIQA 3VFCA 1YJN1 1E9IA 3AMZA 3JW7A 1TWHI 3UXKA 4E4FA 3A7AA 3TWBA 3R10A 3TE5B 1H2IA 4ZA0A 2QLVB 5JCMA 3CCR1 2FKPA 4H4XA 2GR0A 3DFYA 2R7ZI 1VQ51 3MQTA 3P93A 1M1K2 4K8DA 1KQSZ 3CPWY 2BC0A 4HCHA 2YU9I 2DE6A 1K732 3I551 3EUB3 1TWFI 1LVLA 3S47A 4A35A 1YIJZ 3BOXA 2PTXA 3CCE1 1ZKQA 4GRTA 1GRTA 2TPRA 2W54A 3CAWA 3FVDA 2JUBA 2V8JA 1QVGY 4A3DI 2PA6A 1VQN1 4K1WA 4M6UA 1VQPZ 2QKDA 4H50A 4KT2A 4GGHA 1OJTA 1ONFA 2F4MA 1DTNA 3U50C 2AKLA 1Z03A 3S2DI 2AL2B 3FG2P 3MSYA 3FQQA 4G7FA 3RO6A 1F8WA 4A3EI 4NB9A 3Q45A 1M6IA 4MD9A 3CCVZ 2QGYA 2X8HA 4NH1C 3JAMf 2HXUA 4BURA 3N4FA 4MMWA 3QFBA 1YJNZ 2ZAEB 1YIT1 4GYPC 1WCMI 3LUSA 3CCU1 3S15I 4TVWA 4JN7A 3CCRZ 4ZOHB 3NDJA 1Y1VS 1GXFA 1N8R1 3CK5A 4GISA 1R6WA 2JNYA 4BBRI 5TR3A 1EBHA 1K83I 2OO6A 3I55Z 1JEHA 4MRIA 1P43A 4GIRA 5FJUA 3P3BA 3VA8A 2V3AA 4NOZA 3CCEZ 3UCCA 3R07C 3UCDA 3JAMb 1QVFY 1KD12 1FDIA 3CPWZ 3IC9A 4GMEA 1NELA 3DFHA 1I3QI 5FS6A 3L8KA 3VTNA 3UJFA 1KC81 3CQZI 1VQNZ 2AKZA 3V3WA 3GO2A 4HGZA 2OZ8A 3T9PA 1GEUA 2P8BA 2QJJA 3TWAA 1F3PA 3K1GA 3T6CA 1QVGZ 3G6E1 1FEBA 3PWIA 3GTJI 3OPSA 3UJSA 2JR6A 1SJBA 4F4RA 1X2GA 5T67A 4FX9A 3TTEA 1FECA 4DX3A 3EEZA 1JCTA 3H8AA 1YITZ 3IJLA 2M6NA 2OOYB 1GV4A 1WUEA 3LB8A 5IT9f 3VDGA 2E3TA 2RHBA 3D9XA 1R9TI 3RNMA 2DW7A 3DG6A 4A3JI 7ENLA 3HOYI 2LEXA 2GGEA 2AKMA 3GY1A 1YUAA 3QWUA 1S7MA 3P5JB 4TNUA 3QTPA 5EBKA 3NH4A 4K7ZA 2OQYA 2YAUA 1P9NA 2P0IA 2QJNA 3MZNA 2GR1A 3GTMI 3S1RI 4HYRA 3J81f 4H4TA 4J1OA 2P3YA 4APNA 1SIWA 1Q7Y1 2W0HA 2PGEA 4E2YA 3GC2A 3CC41 3CCJZ 1V97A 5IT9b 2HXTA 2OZ3A 1QXFA 1QVFZ 3VCCA 2RDXA 4NBCA 1S721 3BG1B 4IHCA 4A93I 3GRSA 3I56Z 1WW9A 4NBFA 3HOZI 1XPYA 3OTRA 4BBSI 3NVWB 4DK1A 3G6EZ 3J7A4 4H4VA 3U4FA 3IFUA 2P28A 3GTGI 1XHCA 2EGTA 4DNAA 4E30A 3SR6B 2VPYA 3J81b 3NVYB 3R0UA 3M4OI 2PTYA 3CGEA 4FP1A 3GKQA 1D7YA 3RGTA 3SSZA 4E2WA 3TJIA 3I07A 2W55A 5A2Qf 3OZYA 1SJDA 1JROA 4H4UA 3QFAA 1N62C 2VPZA 3GTPI 3N6HA 3SQPA 3VB9A 3OP2A 1Y8CA 2CHRA 3T4WA 4E8GA 5LL6f 1YEYA 2BCPA 5CM2M 2RPRA 1VQ7Z 1VQLZ 4FI4A 1W2BZ 4IP4A 4KEMA 3QPEA 1K4QA 1TWGI 1ZX9A 4H4SA 2IV2X 2X99A 4ADWA 1GSNA 1WZNA 2Q51A 4A3GI 1RNIA 3D47A 4RVFA 1KD0A 3S2HI 2JIRA 3RRAA 3CME1 1YJW1 1N8R2 4A3MI 2QDDA 4MD8A 4A6GA 4NFRA 2PK7A 4DXKA 1X2HA 1VQZA 3ES7A 1USPA 1ZB8A 4JHMA 3TQPA 4YWSA 3THUA 1NHSA 4Z1YA 5U25A 1Q1RA 2QRCB 4XX2A 4A3KI 3BJSA 5KVHA 5EU9A 2PP1A 1VQ41 3H12A 4QTUA 4HCLA 3EMFA 4BY1I 1H6VA 3AM9A 1Q821 2QA41 1VQM1 1NPXA 3VMHA 5ENLA 1KC82 3S14I 3S5SA 4BV6A 3EERA 3I4MI 4NBGA 1QYPA 2V8KA 1V59A 4H83A 4IZGA 2WOIA 3CCQ1 3NH8A 1ELSA 1Q811 2VPWA 6ENLA 1TE6A 2YVGA 3STPA 4BXXI 5JCKA 3ESWA 1Q16A 3MWCA 3G4S1 3PWGA 5U1OA 5G5GB 4Y52I 1GRFA 4NBDA 4RVHA 2P3ZA 3R25A 4H1ZA 3GD6A 4J57A 4BY7I 5JCLA 3H3VJ 1KRLA 1Z01A 2QEX1 1JPDX 1T3QC 2GQWA 2V3BA 3CGDA 1TWCI 1ZDLA 3OZMA 3RCYA 3NH5A 2OFJA 5C3EI 3IR7A 3CC71 3ES8A 3H7VA 3CCL1 5FS9A 4HNCA 3DGHA 3CMEZ 1YJWZ 2EQ8A 2GTIA 2QDEA 3VC6A 2WAQA 3ZLHA 2V6OA 3GTKI 1FEAA 4IL0A 3I4KA 3FQMA 5IP7I 2HF1A 1NJI1 2X8GA 2DE5A 1YJ91 3IF8A 2O53A 4MONA 4EM3A 3CCM1 4QTTA 1FIQB 1VQ4Z 3A7UA 4H4QA 2V45A 2QREB 2RIQA 1Q7Y2 3GRTA 1VQ5Z 1W6TA 2VPXA 1VQMZ 2WP6A 3NVZB 1KKOA 2C3CA 4Z17A 1YI21 2X8CA 4M0XA 2OTJ1 3CCQZ 1K9M1 5KVIA 2PP0A 1DNCA 1GRHA 1DL6A 3SBFA 3CGCA 1WIIA 4E5TA 1TZZA 2PTZA 1X3WA 1OEPA 1VQO1 3PO3S 3G4SZ 2LIYA 3GTLI 2PTWA 2J3NA 2XH7A 2OZKA 3NO1A 3DJGX 3PK7A 3J80f 1XS2A 1N63C 2JS4A 4NEVA 1L8PA 2PP3A 2WPCA 2QEXZ 5JCIA 3I6TA 4H4ZA
chains in the Genus database with same CATH topology
1NUIA 3CC7Z 1ZY8A 2R6MA 3DK9A 4HGYA 1N2FA 4YWOA 3II4A 2WBAA 4EMJA 4H4RA 2GTHA 3GD4A 2K5RA 3VMGA 1YJ9Z 4H4YA 3CCUZ 2VF1A 3CCMZ 2CFYA 3LADA 3J80b 1W2BY 2YVJA 2RT9A 1K731 2WB1A 3MZKB 1NHRA 3GD3A 1TFIA 1YI2Z 2ZZBA 2OTJZ 2E2HI 1Z02A 3S1NI 1NHPA 2PM9A 2NVYI 2WPFA 1Q861 4NB8A 1VQOZ 2EQ6A 2ZZCA 1RLYA 2OTL1 2JMOA 1Q1WA 1ZH1A 3FKII 5FLMI 3DJJA 3S16I 4NEWA 3KIFA 4DGLA 2YQUA 3HOXI 1Q812 3OC4A 1BZLA 2BC1A 5C44I 1BWCA 4A3LI 1LPFA 5FS8A 1XDIA 1VQK1 3IX0A 5C4JI 2NPXA 5AN9F 1VQ91 2KI7B 1RQFA 2QRDB 2E2II 1USPB 1YUKA 2IZ4A 1NJI2 3MONA 1EBDA 2WOWA 2YVFA 4CL1A 2HQMA 4NBHA 1TWAI 2EQ7A 4H4WA 3I4NI 3KIHA 3CC4Z 1ZMDA 4M52A 2ZZ0A 1Y1VI 4Y7NI 1S72Z 2W04A 3CD61 3S1QI 4DQYB 1KN0A 4EMWA 2JA8I 3EMIA 4S1TA 2F5ZA 2WP5A 5T6BA 3HOWI 2GU2A 2WPEA 4RVGA 1ZMCA 2R93I 3S17I 1X3ZA 4E33A 2NVTI 2QAEA 3H4KA 2E9HA 3EAOA 1SFOI 3GTQI 2HU9A 3GTMS 2M48A 1VQ9Z 3TDHB 2O4HA 3CGBA 1JJ2Y 3CCS1 5D1OA 4RVDA 1M901 1PFTA 2K3RA 1MO9A 3K7AI 2NVQI 3M3YI 5GRTA 2CDUA 3D6WA 5ER0A 1ZK7A 2IZ3A 4NBAA 3CD6Z 1XANA 2JA6I 4LIIA 4X6AI 4A3CI 3BG0B 2JA5I 3H0GI 1Q862 2QA4Z 1LQLA 2V8IA 2DE7A 2A8XA 3T4NB 1L1OC 3HOVI 3CC21 4MD7A 3S1MI 3F3PC 1JOAA 2OOXB 3EEDA 3CMA1 4EQWA 3DK4A 4NBEA 3HOUI 1I6HI 3CXCY 3VMIA 2NVXI 3EANA 2GRTA 2KPIA 2PMZA 1TYTA 3CCSZ 3G711 4A3FI 3DK8A 3LXDA 2GH5A 2JA7I 1JWHC 3CCLZ 1DXLA 5T64A 1JJ2Z 2GR2A 1ZB9A 5D1PA 1VLAA 3Q6JA 1I50I 1VQ81 1TYPA 1VQ61 5FS7A 3EF6A 1RO0A 1GETA 1M1K1 2R9ZA 3CCJ1 3OW2Y 4HH4A 2J6AA 2VUGA 3Q87A 5FMHA 1RO4A 4H4PA 1NHQA 3I561 3RZDI 3F3FC 3L5OA 2GR3A 2C3DA 3CC2Z 1GESA 4EM4A 4A3II 3PG6A 1MOKA 3CMAZ 4KPRA 1NDAA 2JK6A 1GERA 4RS4A 4FDCB 1Q822 2VUMI 2EQ9A 1YQZA 4EWCA 1GRGA 3G71Z 4A3BI 1RO2A 4LA1A 3CXCZ 4EMIA 4MXUA 1VQ71 1YHQ1 1VQL1 1VQ8Z 1K8A1 1VQ6Z 4MH4A 3HKZA 1M902 5IP9I 5FLXf 1GREA 2NVKX 5JRBA 3URHA 4J56A 2QR1B 1KQSY 1KD11 4E32A 2E2JI 2B63I 5C4XI 4NBBA 3OW2Z 3NFZA 3RZOI 4AYBA 2X50A 4EQRA 2BJOA 2R92I 4GR1A 1GRAA 2Y0SA 2LFUA 4E31A 4JQ9A 2RBLA 1Y1WI 2OTLZ 2G2KA 3DH9A 1GRBA 4JDRA 1YIJ1 3KLJA 3NDIA 2AAQA 1QF8A 5FLXb 1NP6A 2H85A 1ML8A 2RABA 1K9M2 2YADA 2F4OA 3GTOI 4E2XA 3PO2I 4EQSA 1VQP1 4RV9A 2I3CA 2W03A 1YHQZ 4EQXA 3O0HA 3PO3I 5D1OB 5JCNA 3GCFA 1K8A2 1VQKZ 4E2ZA 2WOVA 3MZLB 3DGZA 3CCV1 5A2Qb 1X0TA 1AOGA 2Q4ZA 1YJN1 1TWHI 3TE5B 1H2IA 2QLVB 5JCMA 3CCR1 4H4XA 2GR0A 2R7ZI 1VQ51 1M1K2 4K8DA 1KQSZ 3CPWY 2BC0A 2YU9I 2DE6A 1K732 3I551 1TWFI 1LVLA 1YIJZ 3CCE1 1ZKQA 4GRTA 1GRTA 2TPRA 2JUBA 2V8JA 1QVGY 4A3DI 1VQN1 1VQPZ 2QKDA 4H50A 1OJTA 1ONFA 2F4MA 3U50C 2AKLA 1Z03A 3S2DI 3FG2P 3FQQA 1F8WA 4A3EI 4NB9A 1M6IA 4MD9A 3CCVZ 2X8HA 4NH1C 3JAMf 4BURA 3QFBA 1YJNZ 2ZAEB 1YIT1 1WCMI 3LUSA 3CCU1 3S15I 3CCRZ 3NDJA 1Y1VS 1GXFA 1N8R1 2JNYA 4BBRI 5TR3A 1K83I 3I55Z 1JEHA 4MRIA 2V3AA 4NOZA 3CCEZ 3JAMb 1QVFY 1KD12 3CPWZ 3IC9A 1I3QI 5FS6A 3L8KA 3VTNA 1KC81 3CQZI 1VQNZ 4HGZA 1GEUA 1F3PA 1QVGZ 3G6E1 1FEBA 3GTJI 2JR6A 5T67A 4FX9A 1FECA 1YITZ 2M6NA 2OOYB 1GV4A 3LB8A 5IT9f 3RNMA 2RHBA 3D9XA 1R9TI 4A3JI 3HOYI 1YUAA 3QWUA 1S7MA 3P5JB 4TNUA 5EBKA 3NH4A 4K7ZA 2YAUA 1P9NA 2GR1A 3GTMI 3S1RI 3J81f 4H4TA 4APNA 2P3YA 1Q7Y1 2W0HA 4E2YA 3CC41 3CCJZ 5IT9b 1QVFZ 4NBCA 1S721 3BG1B 4A93I 3GRSA 3I56Z 1WW9A 4NBFA 3HOZI 4BBSI 4H4VA 4DK1A 3G6EZ 3J7A4 3IFUA 2P28A 3GTGI 1XHCA 2EGTA 4DNAA 4E30A 3J81b 3M4OI 3CGEA 3GKQA 1D7YA 4E2WA 3I07A 5A2Qf 4H4UA 3QFAA 3SQPA 3GTPI 3VB9A 5LL6f 2BCPA 5CM2M 2RPRA 1VQ7Z 1VQLZ 1W2BZ 1K4QA 1TWGI 1ZX9A 4H4SA 2X99A 4ADWA 1GSNA 2Q51A 4A3GI 1RNIA 4RVFA 3S2HI 3CME1 1YJW1 1N8R2 4A3MI 4MD8A 4NFRA 2PK7A 1USPA 1ZB8A 1NHSA 5U25A 1Q1RA 2QRCB 4XX2A 4A3KI 5KVHA 1VQ41 4QTUA 3EMFA 4BY1I 1H6VA 1Q821 2QA41 1VQM1 1NPXA 3VMHA 1KC82 3S14I 4BV6A 3EERA 3I4MI 4NBGA 1QYPA 2V8KA 1V59A 2WOIA 3CCQ1 3NH8A 1Q811 2YVGA 5JCKA 4BXXI 3ESWA 3G4S1 5U1OA 4Y52I 1GRFA 4NBDA 4RVHA 4J57A 4BY7I 5JCLA 3H3VJ 1KRLA 1Z01A 2QEX1 2GQWA 2V3BA 3CGDA 1TWCI 1ZDLA 3NH5A 5C3EI 3CC71 5FS9A 3CCL1 3DGHA 3CMEZ 1YJWZ 2EQ8A 2GTIA 2WAQA 2V6OA 3GTKI 1FEAA 3FQMA 5IP7I 2HF1A 1NJI1 2X8GA 2DE5A 1YJ91 3IF8A 2O53A 4MONA 4EM3A 3CCM1 4QTTA 1VQ4Z 4H4QA 2QREB 2RIQA 1Q7Y2 3GRTA 1VQ5Z 1VQMZ 2WP6A 2C3CA 1YI21 2X8CA 2OTJ1 3CCQZ 1K9M1 5KVIA 1DNCA 1GRHA 1DL6A 3CGCA 1WIIA 1X3WA 1VQO1 3PO3S 3G4SZ 2LIYA 3GTLI 2J3NA 2OZKA 3DJGX 3J80f 4NEVA 2JS4A 2WPCA 2QEXZ 5JCIA 4H4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMF A;  3EMI A;  1S7M A;  3D9X A; 
#chains in the Genus database with same CATH topology
 1NUI A;  3CC7 Z;  1ZY8 A;  2R6M A;  3DK9 A;  4HGY A;  2W3R A;  1N2F A;  3SJN A;  4YWO A;  3II4 A;  2WBA A;  3DEQ A;  4IT1 A;  4EMJ A;  4H4R A;  3IJQ A;  2GTH A;  1FFU C;  3GD4 A;  4TVY A;  2K5R A;  3VMG A;  1YJ9 Z;  4H4Y A;  3CCU Z;  3FV9 A;  4GGB A;  2VF1 A;  3CCM Z;  2CFY A;  2JIM A;  3LAD A;  3J80 b;  1W2B Y;  2YVJ A;  4J3Z A;  3D46 A;  3MUC A;  2RT9 A;  1K73 1;  2WB1 A;  3MZK B;  3RR1 A;  1NHR A;  1WYG A;  3V4B A;  2HZG A;  1TFI A;  1YI2 Z;  2ZZB A;  3GD3 A;  2W3S A;  3H70 A;  2OTJ Z;  4K8G A;  2E2H I;  1Z02 A;  1PDY A;  4MKS A;  3S1N I;  1NHP A;  2XH4 A;  1WUF A;  3AN1 A;  2PM9 A;  2PGW A;  2NVY I;  2WPF A;  1Q86 1;  4NB8 A;  1VQO Z;  1P48 A;  2EQ6 A;  2ZZC A;  2GDQ A;  3U9I A;  1RLY A;  2OTL 1;  2JMO A;  1BKH A;  1EC9 A;  1Q1W A;  3QKE A;  1ZH1 A;  3DDM A;  3FKI I;  5FLM I;  3DJJ A;  3S16 I;  4NEW A;  3KIF A;  1ECQ A;  4DGL A;  2YQU A;  3DG7 A;  3HOX I;  3CXO A;  4MGG A;  1Q81 2;  3OC4 A;  1BZL A;  3DES A;  2BC1 A;  5C44 I;  2XH2 A;  3I6E A;  1BWC A;  5J04 A;  4A3L I;  1TKK A;  3V5C A;  4KWS A;  4X2P A;  1ZXI C;  3SN4 A;  3DGB A;  3UGV A;  1LPF A;  5FS8 A;  2PU0 A;  1STZ A;  1XDI A;  1VQK 1;  1SB3 B;  4EWJ A;  1SJA A;  4E4U A;  3IX0 A;  4IP5 A;  5C4J I;  2NPX A;  4HNL A;  4IL2 A;  5AN9 F;  1VQ9 1;  2KI7 B;  1RQF A;  2QRD B;  2E2I I;  1USP B;  1YUK A;  3TW9 A;  2IZ4 A;  1NJI 2;  3MON A;  1EBD A;  1PDZ A;  2WOW A;  2YVF A;  4CL1 A;  2HQM A;  4NBH A;  1TWA I;  2EQ7 A;  3IK4 A;  3T8Q A;  3BSM A;  3I4N I;  3KIH A;  3CC4 Z;  1MDR A;  2DW6 A;  1MUC A;  1ZMD A;  4H4W A;  4M52 A;  2ZZ0 A;  1Y1V I;  4Y7N I;  4H2H A;  1S72 Z;  2W04 A;  2QJM A;  3R1Z A;  3V5F A;  3CD6 1;  3S1Q I;  4EM4 A;  4DQY B;  1KN0 A;  2GSH A;  4EMW A;  2JA8 I;  2OKT A;  4S1T A;  4H19 A;  2PSN A;  2F5Z A;  3ZVH A;  3EMI A;  2ZAD A;  4E6M A;  2WP5 A;  3NS1 B;  5T6B A;  3HOW I;  2GU2 A;  2WPE A;  3QLD A;  3UJE A;  4RVG A;  1ZMC A;  3UJR A;  5BOF A;  2R93 I;  3S17 I;  1X3Z A;  2XSX A;  2OVL A;  3VCN A;  4E33 A;  2NVT I;  2QAE A;  2MUC A;  5FJO A;  3PFR A;  2PU1 A;  3H4K A;  3RIT A;  2E7Z A;  2E9H A;  3EAO A;  3NXL A;  1SFO I;  3GTQ I;  3P0W A;  2HU9 A;  1MRA A;  1EBG A;  3GTM S;  5IDZ A;  2M48 A;  1VQ9 Z;  3TDH B;  2O4H A;  2OLA A;  3CGB A;  1JJ2 Y;  3CCS 1;  4ROP A;  5D1O A;  4RVD A;  1M90 1;  1PFT A;  2K3R A;  4DHG A;  1MO9 A;  3NFU A;  4GFI A;  1JDF A;  5G5H B;  2XGZ A;  3K7A I;  2NVQ I;  3M3Y I;  5GRT A;  3NVV B;  4ZCW A;  3VC5 A;  3QN3 A;  2CDU A;  1N5X A;  3D6W A;  5ER0 A;  1ZK7 A;  2IZ3 A;  2ZC8 A;  4NBA A;  3CD6 Z;  2PPG A;  1XAN A;  3HPF A;  2JA6 I;  3UXL A;  4LII A;  4X6A I;  3DG3 A;  2NQL A;  4A3C I;  3BG0 B;  2JA5 I;  2PCE A;  3H0G I;  1Q86 2;  1SJC A;  4G8T A;  2QA4 Z;  2QQ6 A;  1LQL A;  2V8I A;  1FFV C;  2DE7 A;  2A8X A;  3NRZ B;  4GYP A;  2JIP A;  3T4N B;  1L1O C;  3HOV I;  3CC2 1;  3Q4D A;  4MD7 A;  3S1M I;  3F3P C;  1JOA A;  4DYE A;  2OPJ A;  2OOX B;  3EED A;  3CMA 1;  1EC7 A;  3DK4 A;  4NBE A;  3HOU I;  2GGG A;  4EQW A;  3SN1 A;  1I6H I;  3FXG A;  3CXC Y;  3VMI A;  3ENL A;  2NVX I;  3SN0 A;  2OZT A;  3EAN A;  2GRT A;  3FYY A;  2KPI A;  2PMZ A;  1TYT A;  3CCS Z;  3G71 1;  2QVH A;  2AL2 A;  4A3F I;  3ZLF A;  3DK8 A;  3TJ4 A;  2NAP A;  3LXD A;  3MY9 A;  2GH5 A;  2OX4 A;  2JA7 I;  3JZU A;  1JWH C;  1FDO A;  3CCL Z;  1MDL A;  2AL1 A;  2POZ A;  1N60 C;  3NZG A;  1DXL A;  5T64 A;  1JJ2 Z;  2GR2 A;  4JN8 A;  1ZB9 A;  5D1P A;  1VLA A;  3Q6J A;  1I50 I;  1VQ8 1;  1TYP A;  1VQ6 1;  5FS7 A;  2JIO A;  3EF6 A;  2I5Q A;  4DWD A;  1KCZ A;  1N61 C;  1RO0 A;  1GET A;  1M1K 1;  2R9Z A;  2V3V A;  3CCJ 1;  3OW2 Y;  4HH4 A;  2J6A A;  4K2S A;  2VUG A;  3ETR B;  2GGI A;  3Q87 A;  5FMH A;  3FJ4 A;  3FCP A;  1RO4 A;  4H4P A;  1NHQ A;  3I56 1;  3RZD I;  3F3F C;  3L5O A;  1NU5 A;  2C3D A;  3CC2 Z;  1F9C A;  1GES A;  4A3I I;  2GR3 A;  3PG6 A;  1MOK A;  5FJR A;  2AYD A;  3CMA Z;  1R0M A;  4KPR A;  3TCS A;  1WJ2 A;  1NDA A;  1EC8 A;  2JK6 A;  1GER A;  4RS4 A;  2OG9 A;  2HNE A;  1IYX A;  2GL5 A;  3B97 A;  4FDC B;  1Q82 2;  2VUM I;  3HW2 A;  4ENL A;  2EQ9 A;  1YQZ A;  4EWC A;  1FHV A;  1GRG A;  3UJ2 A;  3G71 Z;  4KPL A;  4A3R A;  4A3B I;  1RO2 A;  4HN8 A;  3OW1 A;  2FYM A;  4LA1 A;  3CXC Z;  3TOY A;  3ZVI A;  3N4E A;  5FJT A;  3CYJ A;  4EMI A;  2P8C A;  1RM6 B;  4MXU A;  1VQ7 1;  1YHQ 1;  1VQL 1;  1VQ8 Z;  1K8A 1;  1VQ6 Z;  1ONE A;  3ZLG A;  4MH4 A;  1FO4 A;  3HKZ A;  1RVK A;  3MKC A;  1KKR A;  1M90 2;  5IP9 I;  2P88 A;  5FLX f;  1GRE A;  2NVK X;  5JRB A;  3URH A;  4J56 A;  2GGJ A;  2QR1 B;  3HRD C;  4DN1 A;  1KQS Y;  2O56 A;  1KD1 1;  4E32 A;  2E2J I;  2B63 I;  5C4X I;  4NBB A;  3OW2 Z;  3NFZ A;  3RZO I;  4AYB A;  1JPM A;  2X50 A;  2BJO A;  4HCD A;  2R92 I;  3ZVH B;  4EQR A;  4GR1 A;  1GRA A;  3JVA A;  3R0K A;  5FJP A;  3DER A;  2Y0S A;  3CB3 A;  2LFU A;  3R11 A;  4E31 A;  4JQ9 A;  2RBL A;  3N6J A;  1Y1W I;  1AA6 A;  2OQH A;  2PMQ A;  2OTL Z;  1FHU A;  2G2K A;  3DH9 A;  1GRB A;  4JDR A;  2POD A;  1YIJ 1;  3KLJ A;  1N5W C;  3NDI A;  2AAQ A;  1QF8 A;  2XH0 A;  5FLX b;  3KUM A;  1NP6 A;  2E5A A;  2H85 A;  1ML8 A;  2RAB A;  3A7R A;  1K9M 2;  3SQS A;  2YAD A;  2F4O A;  3GTO I;  1MNS A;  4E2X A;  3CXB A;  3PO2 I;  1VDV A;  3CT2 A;  4EQS A;  1VQP 1;  4RV9 A;  2I3C A;  2W03 A;  1YHQ Z;  2MNR A;  3O0H A;  4EQX A;  5BOE A;  2PS2 A;  3PO3 I;  5D1O B;  5JCN A;  3GCF A;  1K8A 2;  2GGH A;  3D2L A;  1VQK Z;  4E2Z A;  2WOV A;  2ONE A;  3MZL B;  1JRP A;  3B9J B;  3DIP A;  3DGZ A;  3CCV 1;  3EKG A;  3IJI A;  5A2Q b;  1BQG A;  1X0T A;  4HPN A;  1AOG A;  2Q4Z A;  2JIQ A;  3VFC A;  1YJN 1;  1E9I A;  3AMZ A;  3JW7 A;  1TWH I;  3UXK A;  4E4F A;  3A7A A;  3TWB A;  3R10 A;  3TE5 B;  1H2I A;  4ZA0 A;  2QLV B;  5JCM A;  3CCR 1;  2FKP A;  4H4X A;  2GR0 A;  3DFY A;  2R7Z I;  1VQ5 1;  3MQT A;  3P93 A;  1M1K 2;  4K8D A;  1KQS Z;  3CPW Y;  2BC0 A;  4HCH A;  2YU9 I;  2DE6 A;  1K73 2;  3I55 1;  3EUB 3;  1TWF I;  1LVL A;  3S47 A;  4A35 A;  1YIJ Z;  3BOX A;  2PTX A;  3CCE 1;  1ZKQ A;  4GRT A;  1GRT A;  2TPR A;  2W54 A;  3CAW A;  3FVD A;  2JUB A;  2V8J A;  1QVG Y;  4A3D I;  2PA6 A;  1VQN 1;  4K1W A;  4M6U A;  1VQP Z;  2QKD A;  4H50 A;  4KT2 A;  4GGH A;  1OJT A;  1ONF A;  2F4M A;  1DTN A;  3U50 C;  2AKL A;  1Z03 A;  3S2D I;  2AL2 B;  3FG2 P;  3MSY A;  3FQQ A;  4G7F A;  3RO6 A;  1F8W A;  4A3E I;  4NB9 A;  3Q45 A;  1M6I A;  4MD9 A;  3CCV Z;  2QGY A;  2X8H A;  4NH1 C;  3JAM f;  2HXU A;  4BUR A;  3N4F A;  4MMW A;  3QFB A;  1YJN Z;  2ZAE B;  1YIT 1;  4GYP C;  1WCM I;  3LUS A;  3CCU 1;  3S15 I;  4TVW A;  4JN7 A;  3CCR Z;  4ZOH B;  3NDJ A;  1Y1V S;  1GXF A;  1N8R 1;  3CK5 A;  4GIS A;  1R6W A;  2JNY A;  4BBR I;  5TR3 A;  1EBH A;  1K83 I;  2OO6 A;  3I55 Z;  1JEH A;  4MRI A;  1P43 A;  4GIR A;  5FJU A;  3P3B A;  3VA8 A;  2V3A A;  4NOZ A;  3CCE Z;  3UCC A;  3R07 C;  3UCD A;  3JAM b;  1QVF Y;  1KD1 2;  1FDI A;  3CPW Z;  3IC9 A;  4GME A;  1NEL A;  3DFH A;  1I3Q I;  5FS6 A;  3L8K A;  3VTN A;  3UJF A;  1KC8 1;  3CQZ I;  1VQN Z;  2AKZ A;  3V3W A;  3GO2 A;  4HGZ A;  2OZ8 A;  3T9P A;  1GEU A;  2P8B A;  2QJJ A;  3TWA A;  1F3P A;  3K1G A;  3T6C A;  1QVG Z;  3G6E 1;  1FEB A;  3PWI A;  3GTJ I;  3OPS A;  3UJS A;  2JR6 A;  1SJB A;  4F4R A;  1X2G A;  5T67 A;  4FX9 A;  3TTE A;  1FEC A;  4DX3 A;  3EEZ A;  1JCT A;  3H8A A;  1YIT Z;  3IJL A;  2M6N A;  2OOY B;  1GV4 A;  1WUE A;  3LB8 A;  5IT9 f;  3VDG A;  2E3T A;  2RHB A;  3D9X A;  1R9T I;  3RNM A;  2DW7 A;  3DG6 A;  4A3J I;  7ENL A;  3HOY I;  2LEX A;  2GGE A;  2AKM A;  3GY1 A;  1YUA A;  3QWU A;  1S7M A;  3P5J B;  4TNU A;  3QTP A;  5EBK A;  3NH4 A;  4K7Z A;  2OQY A;  2YAU A;  1P9N A;  2P0I A;  2QJN A;  3MZN A;  2GR1 A;  3GTM I;  3S1R I;  4HYR A;  3J81 f;  4H4T A;  4J1O A;  2P3Y A;  4APN A;  1SIW A;  1Q7Y 1;  2W0H A;  2PGE A;  4E2Y A;  3GC2 A;  3CC4 1;  3CCJ Z;  1V97 A;  5IT9 b;  2HXT A;  2OZ3 A;  1QXF A;  1QVF Z;  3VCC A;  2RDX A;  4NBC A;  1S72 1;  3BG1 B;  4IHC A;  4A93 I;  3GRS A;  3I56 Z;  1WW9 A;  4NBF A;  3HOZ I;  1XPY A;  3OTR A;  4BBS I;  3NVW B;  4DK1 A;  3G6E Z;  3J7A 4;  4H4V A;  3U4F A;  3IFU A;  2P28 A;  3GTG I;  1XHC A;  2EGT A;  4DNA A;  4E30 A;  3SR6 B;  2VPY A;  3J81 b;  3NVY B;  3R0U A;  3M4O I;  2PTY A;  3CGE A;  4FP1 A;  3GKQ A;  1D7Y A;  3RGT A;  3SSZ A;  4E2W A;  3TJI A;  3I07 A;  2W55 A;  5A2Q f;  3OZY A;  1SJD A;  1JRO A;  4H4U A;  3QFA A;  1N62 C;  2VPZ A;  3GTP I;  3N6H A;  3SQP A;  3VB9 A;  3OP2 A;  1Y8C A;  2CHR A;  3T4W A;  4E8G A;  5LL6 f;  1YEY A;  2BCP A;  5CM2 M;  2RPR A;  1VQ7 Z;  1VQL Z;  4FI4 A;  1W2B Z;  4IP4 A;  4KEM A;  3QPE A;  1K4Q A;  1TWG I;  1ZX9 A;  4H4S A;  2IV2 X;  2X99 A;  4ADW A;  1GSN A;  1WZN A;  2Q51 A;  4A3G I;  1RNI A;  3D47 A;  4RVF A;  1KD0 A;  3S2H I;  2JIR A;  3RRA A;  3CME 1;  1YJW 1;  1N8R 2;  4A3M I;  2QDD A;  4MD8 A;  4A6G A;  4NFR A;  2PK7 A;  4DXK A;  1X2H A;  1VQZ A;  3ES7 A;  1USP A;  1ZB8 A;  4JHM A;  3TQP A;  4YWS A;  3THU A;  1NHS A;  4Z1Y A;  5U25 A;  1Q1R A;  2QRC B;  4XX2 A;  4A3K I;  3BJS A;  5KVH A;  5EU9 A;  2PP1 A;  1VQ4 1;  3H12 A;  4QTU A;  4HCL A;  3EMF A;  4BY1 I;  1H6V A;  3AM9 A;  1Q82 1;  2QA4 1;  1VQM 1;  1NPX A;  3VMH A;  5ENL A;  1KC8 2;  3S14 I;  3S5S A;  4BV6 A;  3EER A;  3I4M I;  4NBG A;  1QYP A;  2V8K A;  1V59 A;  4H83 A;  4IZG A;  2WOI A;  3CCQ 1;  3NH8 A;  1ELS A;  1Q81 1;  2VPW A;  6ENL A;  1TE6 A;  2YVG A;  3STP A;  4BXX I;  5JCK A;  3ESW A;  1Q16 A;  3MWC A;  3G4S 1;  3PWG A;  5U1O A;  5G5G B;  4Y52 I;  1GRF A;  4NBD A;  4RVH A;  2P3Z A;  3R25 A;  4H1Z A;  3GD6 A;  4J57 A;  4BY7 I;  5JCL A;  3H3V J;  1KRL A;  1Z01 A;  2QEX 1;  1JPD X;  1T3Q C;  2GQW A;  2V3B A;  3CGD A;  1TWC I;  1ZDL A;  3OZM A;  3RCY A;  3NH5 A;  2OFJ A;  5C3E I;  3IR7 A;  3CC7 1;  3ES8 A;  3H7V A;  3CCL 1;  5FS9 A;  4HNC A;  3DGH A;  3CME Z;  1YJW Z;  2EQ8 A;  2GTI A;  2QDE A;  3VC6 A;  2WAQ A;  3ZLH A;  2V6O A;  3GTK I;  1FEA A;  4IL0 A;  3I4K A;  3FQM A;  5IP7 I;  2HF1 A;  1NJI 1;  2X8G A;  2DE5 A;  1YJ9 1;  3IF8 A;  2O53 A;  4MON A;  4EM3 A;  3CCM 1;  4QTT A;  1FIQ B;  1VQ4 Z;  3A7U A;  4H4Q A;  2V45 A;  2QRE B;  2RIQ A;  1Q7Y 2;  3GRT A;  1VQ5 Z;  1W6T A;  2VPX A;  1VQM Z;  2WP6 A;  3NVZ B;  1KKO A;  2C3C A;  4Z17 A;  1YI2 1;  2X8C A;  4M0X A;  2OTJ 1;  3CCQ Z;  1K9M 1;  5KVI A;  2PP0 A;  1DNC A;  1GRH A;  1DL6 A;  3SBF A;  3CGC A;  1WII A;  4E5T A;  1TZZ A;  2PTZ A;  1X3W A;  1OEP A;  1VQO 1;  3PO3 S;  3G4S Z;  2LIY A;  3GTL I;  2PTW A;  2J3N A;  2XH7 A;  2OZK A;  3NO1 A;  3DJG X;  3PK7 A;  3J80 f;  1XS2 A;  1N63 C;  2JS4 A;  4NEV A;  1L8P A;  2PP3 A;  2WPC A;  2QEX Z;  5JCI A;  3I6T A;  4H4Z A; 
#chains in the Genus database with same CATH homology
 1NUI A;  3CC7 Z;  1ZY8 A;  2R6M A;  3DK9 A;  4HGY A;  1N2F A;  4YWO A;  3II4 A;  2WBA A;  4EMJ A;  4H4R A;  2GTH A;  3GD4 A;  2K5R A;  3VMG A;  1YJ9 Z;  4H4Y A;  3CCU Z;  2VF1 A;  3CCM Z;  2CFY A;  3LAD A;  3J80 b;  1W2B Y;  2YVJ A;  2RT9 A;  1K73 1;  2WB1 A;  3MZK B;  1NHR A;  3GD3 A;  1TFI A;  1YI2 Z;  2ZZB A;  2OTJ Z;  2E2H I;  1Z02 A;  3S1N I;  1NHP A;  2PM9 A;  2NVY I;  2WPF A;  1Q86 1;  4NB8 A;  1VQO Z;  2EQ6 A;  2ZZC A;  1RLY A;  2OTL 1;  2JMO A;  1Q1W A;  1ZH1 A;  3FKI I;  5FLM I;  3DJJ A;  3S16 I;  4NEW A;  3KIF A;  4DGL A;  2YQU A;  3HOX I;  1Q81 2;  3OC4 A;  1BZL A;  2BC1 A;  5C44 I;  1BWC A;  4A3L I;  1LPF A;  5FS8 A;  1XDI A;  1VQK 1;  3IX0 A;  5C4J I;  2NPX A;  5AN9 F;  1VQ9 1;  2KI7 B;  1RQF A;  2QRD B;  2E2I I;  1USP B;  1YUK A;  2IZ4 A;  1NJI 2;  3MON A;  1EBD A;  2WOW A;  2YVF A;  4CL1 A;  2HQM A;  4NBH A;  1TWA I;  2EQ7 A;  4H4W A;  3I4N I;  3KIH A;  3CC4 Z;  1ZMD A;  4M52 A;  2ZZ0 A;  1Y1V I;  4Y7N I;  1S72 Z;  2W04 A;  3CD6 1;  3S1Q I;  4DQY B;  1KN0 A;  4EMW A;  2JA8 I;  3EMI A;  4S1T A;  2F5Z A;  2WP5 A;  5T6B A;  3HOW I;  2GU2 A;  2WPE A;  4RVG A;  1ZMC A;  2R93 I;  3S17 I;  1X3Z A;  4E33 A;  2NVT I;  2QAE A;  3H4K A;  2E9H A;  3EAO A;  1SFO I;  3GTQ I;  2HU9 A;  3GTM S;  2M48 A;  1VQ9 Z;  3TDH B;  2O4H A;  3CGB A;  1JJ2 Y;  3CCS 1;  5D1O A;  4RVD A;  1M90 1;  1PFT A;  2K3R A;  1MO9 A;  3K7A I;  2NVQ I;  3M3Y I;  5GRT A;  2CDU A;  3D6W A;  5ER0 A;  1ZK7 A;  2IZ3 A;  4NBA A;  3CD6 Z;  1XAN A;  2JA6 I;  4LII A;  4X6A I;  4A3C I;  3BG0 B;  2JA5 I;  3H0G I;  1Q86 2;  2QA4 Z;  1LQL A;  2V8I A;  2DE7 A;  2A8X A;  3T4N B;  1L1O C;  3HOV I;  3CC2 1;  4MD7 A;  3S1M I;  3F3P C;  1JOA A;  2OOX B;  3EED A;  3CMA 1;  4EQW A;  3DK4 A;  4NBE A;  3HOU I;  1I6H I;  3CXC Y;  3VMI A;  2NVX I;  3EAN A;  2GRT A;  2KPI A;  2PMZ A;  1TYT A;  3CCS Z;  3G71 1;  4A3F I;  3DK8 A;  3LXD A;  2GH5 A;  2JA7 I;  1JWH C;  3CCL Z;  1DXL A;  5T64 A;  1JJ2 Z;  2GR2 A;  1ZB9 A;  5D1P A;  1VLA A;  3Q6J A;  1I50 I;  1VQ8 1;  1TYP A;  1VQ6 1;  5FS7 A;  3EF6 A;  1RO0 A;  1GET A;  1M1K 1;  2R9Z A;  3CCJ 1;  3OW2 Y;  4HH4 A;  2J6A A;  2VUG A;  3Q87 A;  5FMH A;  1RO4 A;  4H4P A;  1NHQ A;  3I56 1;  3RZD I;  3F3F C;  3L5O A;  2GR3 A;  2C3D A;  3CC2 Z;  1GES A;  4EM4 A;  4A3I I;  3PG6 A;  1MOK A;  3CMA Z;  4KPR A;  1NDA A;  2JK6 A;  1GER A;  4RS4 A;  4FDC B;  1Q82 2;  2VUM I;  2EQ9 A;  1YQZ A;  4EWC A;  1GRG A;  3G71 Z;  4A3B I;  1RO2 A;  4LA1 A;  3CXC Z;  4EMI A;  4MXU A;  1VQ7 1;  1YHQ 1;  1VQL 1;  1VQ8 Z;  1K8A 1;  1VQ6 Z;  4MH4 A;  3HKZ A;  1M90 2;  5IP9 I;  5FLX f;  1GRE A;  2NVK X;  5JRB A;  3URH A;  4J56 A;  2QR1 B;  1KQS Y;  1KD1 1;  4E32 A;  2E2J I;  2B63 I;  5C4X I;  4NBB A;  3OW2 Z;  3NFZ A;  3RZO I;  4AYB A;  2X50 A;  4EQR A;  2BJO A;  2R92 I;  4GR1 A;  1GRA A;  2Y0S A;  2LFU A;  4E31 A;  4JQ9 A;  2RBL A;  1Y1W I;  2OTL Z;  2G2K A;  3DH9 A;  1GRB A;  4JDR A;  1YIJ 1;  3KLJ A;  3NDI A;  2AAQ A;  1QF8 A;  5FLX b;  1NP6 A;  2H85 A;  1ML8 A;  2RAB A;  1K9M 2;  2YAD A;  2F4O A;  3GTO I;  4E2X A;  3PO2 I;  4EQS A;  1VQP 1;  4RV9 A;  2I3C A;  2W03 A;  1YHQ Z;  4EQX A;  3O0H A;  3PO3 I;  5D1O B;  5JCN A;  3GCF A;  1K8A 2;  1VQK Z;  4E2Z A;  2WOV A;  3MZL B;  3DGZ A;  3CCV 1;  5A2Q b;  1X0T A;  1AOG A;  2Q4Z A;  1YJN 1;  1TWH I;  3TE5 B;  1H2I A;  2QLV B;  5JCM A;  3CCR 1;  4H4X A;  2GR0 A;  2R7Z I;  1VQ5 1;  1M1K 2;  4K8D A;  1KQS Z;  3CPW Y;  2BC0 A;  2YU9 I;  2DE6 A;  1K73 2;  3I55 1;  1TWF I;  1LVL A;  1YIJ Z;  3CCE 1;  1ZKQ A;  4GRT A;  1GRT A;  2TPR A;  2JUB A;  2V8J A;  1QVG Y;  4A3D I;  1VQN 1;  1VQP Z;  2QKD A;  4H50 A;  1OJT A;  1ONF A;  2F4M A;  3U50 C;  2AKL A;  1Z03 A;  3S2D I;  3FG2 P;  3FQQ A;  1F8W A;  4A3E I;  4NB9 A;  1M6I A;  4MD9 A;  3CCV Z;  2X8H A;  4NH1 C;  3JAM f;  4BUR A;  3QFB A;  1YJN Z;  2ZAE B;  1YIT 1;  1WCM I;  3LUS A;  3CCU 1;  3S15 I;  3CCR Z;  3NDJ A;  1Y1V S;  1GXF A;  1N8R 1;  2JNY A;  4BBR I;  5TR3 A;  1K83 I;  3I55 Z;  1JEH A;  4MRI A;  2V3A A;  4NOZ A;  3CCE Z;  3JAM b;  1QVF Y;  1KD1 2;  3CPW Z;  3IC9 A;  1I3Q I;  5FS6 A;  3L8K A;  3VTN A;  1KC8 1;  3CQZ I;  1VQN Z;  4HGZ A;  1GEU A;  1F3P A;  1QVG Z;  3G6E 1;  1FEB A;  3GTJ I;  2JR6 A;  5T67 A;  4FX9 A;  1FEC A;  1YIT Z;  2M6N A;  2OOY B;  1GV4 A;  3LB8 A;  5IT9 f;  3RNM A;  2RHB A;  3D9X A;  1R9T I;  4A3J I;  3HOY I;  1YUA A;  3QWU A;  1S7M A;  3P5J B;  4TNU A;  5EBK A;  3NH4 A;  4K7Z A;  2YAU A;  1P9N A;  2GR1 A;  3GTM I;  3S1R I;  3J81 f;  4H4T A;  4APN A;  2P3Y A;  1Q7Y 1;  2W0H A;  4E2Y A;  3CC4 1;  3CCJ Z;  5IT9 b;  1QVF Z;  4NBC A;  1S72 1;  3BG1 B;  4A93 I;  3GRS A;  3I56 Z;  1WW9 A;  4NBF A;  3HOZ I;  4BBS I;  4H4V A;  4DK1 A;  3G6E Z;  3J7A 4;  3IFU A;  2P28 A;  3GTG I;  1XHC A;  2EGT A;  4DNA A;  4E30 A;  3J81 b;  3M4O I;  3CGE A;  3GKQ A;  1D7Y A;  4E2W A;  3I07 A;  5A2Q f;  4H4U A;  3QFA A;  3SQP A;  3GTP I;  3VB9 A;  5LL6 f;  2BCP A;  5CM2 M;  2RPR A;  1VQ7 Z;  1VQL Z;  1W2B Z;  1K4Q A;  1TWG I;  1ZX9 A;  4H4S A;  2X99 A;  4ADW A;  1GSN A;  2Q51 A;  4A3G I;  1RNI A;  4RVF A;  3S2H I;  3CME 1;  1YJW 1;  1N8R 2;  4A3M I;  4MD8 A;  4NFR A;  2PK7 A;  1USP A;  1ZB8 A;  1NHS A;  5U25 A;  1Q1R A;  2QRC B;  4XX2 A;  4A3K I;  5KVH A;  1VQ4 1;  4QTU A;  3EMF A;  4BY1 I;  1H6V A;  1Q82 1;  2QA4 1;  1VQM 1;  1NPX A;  3VMH A;  1KC8 2;  3S14 I;  4BV6 A;  3EER A;  3I4M I;  4NBG A;  1QYP A;  2V8K A;  1V59 A;  2WOI A;  3CCQ 1;  3NH8 A;  1Q81 1;  2YVG A;  5JCK A;  4BXX I;  3ESW A;  3G4S 1;  5U1O A;  4Y52 I;  1GRF A;  4NBD A;  4RVH A;  4J57 A;  4BY7 I;  5JCL A;  3H3V J;  1KRL A;  1Z01 A;  2QEX 1;  2GQW A;  2V3B A;  3CGD A;  1TWC I;  1ZDL A;  3NH5 A;  5C3E I;  3CC7 1;  5FS9 A;  3CCL 1;  3DGH A;  3CME Z;  1YJW Z;  2EQ8 A;  2GTI A;  2WAQ A;  2V6O A;  3GTK I;  1FEA A;  3FQM A;  5IP7 I;  2HF1 A;  1NJI 1;  2X8G A;  2DE5 A;  1YJ9 1;  3IF8 A;  2O53 A;  4MON A;  4EM3 A;  3CCM 1;  4QTT A;  1VQ4 Z;  4H4Q A;  2QRE B;  2RIQ A;  1Q7Y 2;  3GRT A;  1VQ5 Z;  1VQM Z;  2WP6 A;  2C3C A;  1YI2 1;  2X8C A;  2OTJ 1;  3CCQ Z;  1K9M 1;  5KVI A;  1DNC A;  1GRH A;  1DL6 A;  3CGC A;  1WII A;  1X3W A;  1VQO 1;  3PO3 S;  3G4S Z;  2LIY A;  3GTL I;  2J3N A;  2OZK A;  3DJG X;  3J80 f;  4NEV A;  2JS4 A;  2WPC A;  2QEX Z;  5JCI A;  4H4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...