The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
93
|
structure length |
93
|
Chain Sequence |
HMDFSQLGGLLDGMKKEFSQLEEKNKDTIHTSKSGGGMVSVSFNGLGELVDLQIDDSLLEDKEAMQIYLMSALNDGYKAVEENRKNLAFNMLG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of uncharacterized protein HP0035 from Helicobacter pylori
rcsb |
| molecule keywords |
protein HP0035
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Helicobacter pylori
|
| total genus |
28
|
| structure length |
93
|
| sequence length |
93
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2008-10-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02575 | YbaB_DNA_bd | YbaB/EbfC DNA-binding family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Ybab; Chain: A; | Nucleoid-associated protein YbaB-like domain |
#chains in the Genus database with same CATH superfamily 1YBX A; 1J8B A; 1PUG A; 3F42 A; #chains in the Genus database with same CATH topology 1J8B A; 3FEW X; 1PUG A; 1WD5 A; 3F42 A; 1YBX A; 2D46 A; #chains in the Genus database with same CATH homology 1YBX A; 1J8B A; 1PUG A; 3F42 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...