The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
66
|
sequence length |
262
|
structure length |
256
|
Chain Sequence |
CTLWGAAGTASMEGSLLAKNRDWKPDHAQSLRLLHPEHGYAYLGLYADNGSEPGIKAGVNQKGLAVVAAEASSLPRALRGVLTRLLRDYGSLDEVASAADKLFAQARPVFLLLADAGGLMQVEIGQHGRYRLIRQQSGTLAHTNHYADTSLLDGAQTIGPSSQARLERIRFLLDQHPAHTLSEFERLSRDRHDGPDNSLWRSGREHTLAGWRIALPAGAPPRLQLTLANPGRAERDGDYALDSAFWAQPARTLLPK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of the Protein CV2077 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR62.
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Chromobacterium violaceum atcc 12472
|
| molecule keywords |
Uncharacterized protein CV2077
|
| total genus |
66
|
| structure length |
256
|
| sequence length |
262
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-03-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03417 | AAT | Acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 4-Layer Sandwich | Penicillin V Acylase; Chain A | Penicillin V Acylase; Chain A |
#chains in the Genus database with same CATH superfamily 2BJF A; 2QUY A; 3MJI A; 2X1C A; 2X1E A; 2PVA A; 2BJG A; 2Z71 A; 2IWM A; 3HBC A; 5HKE A; 2RG2 A; 4WL2 A; 3PVA A; 2RLC A; 2HF0 A; 2RF8 A; 2OQC A; 4WL3 A; 3GVZ A; 2HEZ A; 2X1D A; #chains in the Genus database with same CATH topology 2BJF A; 2QUY A; 3MJI A; 4BWC B; 2X1C A; 2X1E A; 2PVA A; 2BJG A; 2Z71 A; 2IWM A; 3HBC A; 5HKE A; 2RG2 A; 4WL2 A; 3PVA A; 2RLC A; 2HF0 A; 2RF8 A; 2OQC A; 3FBX A; 3GVZ A; 2HEZ A; 4WL3 A; 3FGT B; 2X1D A; 3FGR B; 3FGW A; #chains in the Genus database with same CATH homology 2BJF A; 2QUY A; 3MJI A; 4BWC B; 2X1C A; 2X1E A; 2PVA A; 2BJG A; 2Z71 A; 2IWM A; 3HBC A; 5HKE A; 2RG2 A; 4WL2 A; 3PVA A; 2RLC A; 2HF0 A; 2RF8 A; 2OQC A; 3FBX A; 3GVZ A; 2HEZ A; 4WL3 A; 3FGT B; 2X1D A; 3FGR B; 3FGW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
