The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
122
|
structure length |
122
|
Chain Sequence |
MDHLKHLQQLQNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALKLHEEDCPIDENFIRQKMPKDKQIKEEDLVAIFAASPIDNIEAYVEEIKNASIKRKLFGLANTIREQAH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Three-dimensional structure of N-terminal domain of DnaB helicase and helicase-primase interactions in Helicobacter pylori
pubmed doi rcsb |
molecule tags |
Hydrolase/replication
|
source organism |
Helicobacter pylori
|
molecule keywords |
Replicative DNA helicase
|
total genus |
46
|
structure length |
122
|
sequence length |
122
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.6.4.12: DNA helicase. |
pdb deposition date | 2009-04-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00772 | DnaB | DnaB-like helicase N terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | DNAb Helicase; Chain A | DNAb Helicase; Chain A |
#chains in the Genus database with same CATH superfamily 4IM9 A; 3BGW A; 1T3W A; 2LZN A; 2R5U A; 2VYF A; 1JWE A; 4ESV A; 3GXV A; 2R6C A; 2R6A A; 4EHS A; 2R6A C; 1B79 A; 1Z8S A; 2R6C G; 2Q6T A; 2HAJ A; 2R6D A; #chains in the Genus database with same CATH topology 4IM9 A; 3BGW A; 1T3W A; 2LZN A; 2R5U A; 2VYF A; 1JWE A; 4ESV A; 3GXV A; 2R6C A; 2R6A A; 4EHS A; 2R6A C; 1B79 A; 1Z8S A; 2R6C G; 2Q6T A; 2HAJ A; 2R6D A; #chains in the Genus database with same CATH homology 4IM9 A; 3BGW A; 1T3W A; 2LZN A; 2R5U A; 2VYF A; 1JWE A; 4ESV A; 3GXV A; 2R6C A; 2R6A A; 4EHS A; 2R6A C; 1B79 A; 1Z8S A; 2R6C G; 2Q6T A; 2HAJ A; 2R6D A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...