3J80a

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
97
structure length
97
Chain Sequence
PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIRDLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
molecule keywords 18S rRNA
molecule tags Ribosome
source organism Saccharomyces cerevisiae
total genus 8
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
a PF01283 Ribosomal_S26e Ribosomal protein S26e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1740.20 Alpha Beta 2-Layer Sandwich first zn-finger domain of poly(adp-ribose) polymerase-1 first zn-finger domain of poly(adp-ribose) polymerase-1 3j80a00
5LL6e 3J81a 5A2Qa 5IT9a 3J7A3 3J80a 3JAMa 5FLXa
chains in the Genus database with same CATH superfamily
3J81a 3OD8A 5A2Qa 3J7A3 3JAMa 5FLXa 1V9XA 4AV1A 2CS2A 2L30A 4OQAA 3ODAA 5IT9a 4DQYA 4OPXA 1UW0A 3ODEA 5LL6e 2L31A 3ODCA 2DMJA 4OQBA 3J80a 2N8AA
chains in the Genus database with same CATH topology
5LL6e 3J81a 5A2Qa 5IT9a 3J7A3 3J80a 3JAMa 5FLXa
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 e;  3J81 a;  5A2Q a;  5IT9 a;  3J7A 3;  3J80 a;  3JAM a;  5FLX a; 
#chains in the Genus database with same CATH topology
 3J81 a;  3OD8 A;  5A2Q a;  3J7A 3;  3JAM a;  5FLX a;  1V9X A;  4AV1 A;  2CS2 A;  2L30 A;  4OQA A;  3ODA A;  5IT9 a;  4DQY A;  4OPX A;  1UW0 A;  3ODE A;  5LL6 e;  2L31 A;  3ODC A;  2DMJ A;  4OQB A;  3J80 a;  2N8A A; 
#chains in the Genus database with same CATH homology
 5LL6 e;  3J81 a;  5A2Q a;  5IT9 a;  3J7A 3;  3J80 a;  3JAM a;  5FLX a; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...