The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
100
|
structure length |
100
|
Chain Sequence |
MPKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIRDLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Ribosome
|
| molecule keywords |
Ribosomal protein uS2
|
| publication title |
Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb |
| source organism |
Cricket paralysis virus
|
| total genus |
10
|
| structure length |
100
|
| sequence length |
100
|
| ec nomenclature | |
| pdb deposition date | 2016-03-16 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | first zn-finger domain of poly(adp-ribose) polymerase-1 | first zn-finger domain of poly(adp-ribose) polymerase-1 |
#chains in the Genus database with same CATH superfamily 3J7A 3; 5FLX a; 3J81 a; 5LL6 e; 5A2Q a; 3JAM a; 3J80 a; 5IT9 a; #chains in the Genus database with same CATH topology 4OPX A; 3ODC A; 3J81 a; 3JAM a; 1UW0 A; 5FLX a; 5LL6 e; 3ODE A; 5IT9 a; 4AV1 A; 2L31 A; 3ODA A; 1V9X A; 3J80 a; 4OQA A; 2CS2 A; 4DQY A; 3J7A 3; 3OD8 A; 5A2Q a; 2DMJ A; 4OQB A; 2N8A A; 2L30 A; #chains in the Genus database with same CATH homology 3J7A 3; 5FLX a; 3J81 a; 5LL6 e; 5A2Q a; 3JAM a; 3J80 a; 5IT9 a;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
