3JAMa

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIRDLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
molecule keywords 18S rRNA
molecule tags Translation
source organism Saccharomyces cerevisiae
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
a PF01283 Ribosomal_S26e Ribosomal protein S26e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1740.20 Alpha Beta 2-Layer Sandwich first zn-finger domain of poly(adp-ribose) polymerase-1 first zn-finger domain of poly(adp-ribose) polymerase-1 3jama00
3J7A3 5IT9a 3J80a 5FLXa 3J81a 5LL6e 3JAMa 5A2Qa
chains in the Genus database with same CATH superfamily
1V9XA 4DQYA 5IT9a 5FLXa 5LL6e 2DMJA 3ODEA 2N8AA 2L30A 3JAMa 5A2Qa 2CS2A 3OD8A 2L31A 3J80a 3ODAA 1UW0A 3J7A3 4OQBA 4AV1A 3J81a 4OQAA 4OPXA 3ODCA
chains in the Genus database with same CATH topology
3J7A3 5IT9a 3J80a 5FLXa 3J81a 5LL6e 3JAMa 5A2Qa
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A 3;  5IT9 a;  3J80 a;  5FLX a;  3J81 a;  5LL6 e;  3JAM a;  5A2Q a; 
#chains in the Genus database with same CATH topology
 1V9X A;  4DQY A;  5IT9 a;  5FLX a;  5LL6 e;  2DMJ A;  3ODE A;  2N8A A;  2L30 A;  3JAM a;  5A2Q a;  2CS2 A;  3OD8 A;  2L31 A;  3J80 a;  3ODA A;  1UW0 A;  3J7A 3;  4OQB A;  4AV1 A;  3J81 a;  4OQA A;  4OPX A;  3ODC A; 
#chains in the Genus database with same CATH homology
 3J7A 3;  5IT9 a;  3J80 a;  5FLX a;  3J81 a;  5LL6 e;  3JAM a;  5A2Q a; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...