The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
98
|
sequence length |
334
|
structure length |
334
|
Chain Sequence |
MLGSSSLSIRTTDDKSLFARTMDFTMEPDSKVIIVPRNYGIRLLEKENVVINNSYAFVGMGSTDITSPVLYDGVNEKGLMGAMLYYATFATYADEPKKGTRGINPVYVISQVLGNCVTVDDVIEKLTSYTLLNEANIILGFAPPLHYTFTDASGESIVIEPDKTGITIHRKTIGVMTNSPGYEWHQTNLRAYIGVTPNPPQDIMMGDLDLTPFGQGAGGLGLPGDFTPSARFLRVAYWKKYTEKAKNETEGVTNLFHILSSVNIPKGVVLTNEGKTDYTIYTSAMCAQSKNYYFKLYDNSRISAVSLMAENLNSQDLITFEWDRKQDIKQLNQV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Activation of catalytic cysteine without a base in a Mutant Penicillin Acylase Precursor
rcsb |
| molecule keywords |
Penicillin acylase
|
| molecule tags |
Hydrolase
|
| source organism |
Bacillus sphaericus
|
| total genus |
98
|
| structure length |
334
|
| sequence length |
334
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
3.5.1.11: Penicillin amidase. |
| pdb deposition date | 2010-04-12 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02275 | CBAH | Linear amide C-N hydrolases, choloylglycine hydrolase family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 4-Layer Sandwich | Penicillin V Acylase; Chain A | Penicillin V Acylase; Chain A |
#chains in the Genus database with same CATH superfamily 2X1C A; 2RF8 A; 2BJG A; 2Z71 A; 2X1E A; 4WL2 A; 2BJF A; 2OQC A; 3PVA A; 2IWM A; 3MJI A; 2PVA A; 2HF0 A; 5HKE A; 4WL3 A; 3HBC A; 2RG2 A; 3GVZ A; 2QUY A; 2X1D A; 2RLC A; 2HEZ A; #chains in the Genus database with same CATH topology 2X1C A; 2RF8 A; 2BJG A; 3FGR B; 2Z71 A; 2X1E A; 4WL2 A; 2BJF A; 3FBX A; 3FGT B; 2OQC A; 3PVA A; 2IWM A; 3MJI A; 2PVA A; 2HF0 A; 5HKE A; 4WL3 A; 3HBC A; 2RG2 A; 3GVZ A; 4BWC B; 2QUY A; 3FGW A; 2X1D A; 2RLC A; 2HEZ A; #chains in the Genus database with same CATH homology 2X1C A; 2RF8 A; 2BJG A; 3FGR B; 2Z71 A; 2X1E A; 4WL2 A; 2BJF A; 3FBX A; 3FGT B; 2OQC A; 3PVA A; 2IWM A; 3MJI A; 2PVA A; 2HF0 A; 5HKE A; 4WL3 A; 3HBC A; 2RG2 A; 3GVZ A; 4BWC B; 2QUY A; 3FGW A; 2X1D A; 2RLC A; 2HEZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...