The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
119
|
sequence length |
398
|
structure length |
390
|
Chain Sequence |
MTEGPYKLPPGWRWVRLGEVCLPTERRDPTKNPSTYFVYVDISAIDSTVGKIVSPKEILGQHAPSRARKVIRSGDVIFATTRPYLKNIALVPPDLDGQICSTGFCVIRANREFAEPEFLFHLCRSDFITNQLTASKMRGTSYPAVTDNDVYNTLIPLPPLEEQRRIVAKVEALMERVREVRRLRAEAQKDTELLMQTALAEVFPHPGADLPPGWRWVRLGEVCDIIMGQSPPSSTYNFEGNGLPFFQGKADFGDLHPTPRIWCSAPQKVARPGDVLISVRAPVGSTNVANLACCIGRGLAALRPRDSLERFWLLYYLHYLEPELSKAITKKDLQNVFIPLPPLEEQRRIVAYLDQIQQQVAALKRAQAETEAELKRLEQAILDKAFRGDL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of HsdS subunit from Thermoanaerobacter tengcongensis sheds lights on mechanism of dynamic opening and closing of type I methyltransferase
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Thermoanaerobacter tengcongensis
|
molecule keywords |
Restriction endonuclease S subunits
|
total genus |
119
|
structure length |
390
|
sequence length |
398
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-08-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01420 | Methylase_S | Type I restriction modification DNA specificity domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 | DNA methylase specificity domains | ||
Alpha Beta | Alpha-Beta Complex | Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 | DNA methylase specificity domains |
#chains in the Genus database with same CATH superfamily 1YDX A; 3OKG A; 1YF2 A; #chains in the Genus database with same CATH topology 2NP6 A; 2NP7 A; 1YDX A; 1G38 A; 2IH4 A; 2IH5 A; 3OKG A; 1AQI A; 1AQJ A; 1YF2 A; 2IH2 A; 2IBS A; 2IBT A; 2JG3 A; 2ADM A; #chains in the Genus database with same CATH homology 1YDX A; 3OKG A; 1YF2 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...