1YDXA

Crystal structure of type-i restriction-modification system s subunit from m. genitalium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
374
structure length
374
Chain Sequence
MTPKLKLNNNINWTKRTIDSLFDLKKGEMLEKELITPEGKYEYFNGGVKNSGRTDKFNTFKNTISVIVGGSCGYVRLADKNFFCGQSNCTLNLLDPLELDLKFAYYALKSQQERIEALAFGTTIQNIRISDLKELEIPFTSNKNEQHAIANTLSVFDERLENLASLIEINRKLRDEYAHKLFSLDEAFLSHWKLEALQSQMHEITLGEIFNFKSGKYLKSEERLEEGKFPYYGAGIDNTGFVAEPNTEKDTISIISNGYSLGNIRYHEIPWFNGTGSIALEPMNNEIYVPFFYCALKYLQKDIKERMKSDDSPFLSLKLAGEIKVPYVKSFQLQRKAGKIVFLLDQKLDQYKKELSSLTVIRDTLLKKLFPDMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords type I restriction enzyme specificity protein MG438
publication title Crystal Structure of a Putative Type I Restriction-Modification S Subunit from Mycoplasma genitalium
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Dna binding protein
total genus 109
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2004-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01420 Methylase_S Type I restriction modification DNA specificity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1120 Mainly Alpha Orthogonal Bundle Helix Hairpins Bipartite methylase S protein 1ydxA02
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA03
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA01
3OKGA 1YF2A 1YDXA
chains in the Genus database with same CATH superfamily
1YTFB 5ITZB 4IIJA 1VQOV 2HVKC 4X1KA 1MSDA 1YJNV 5B3SB 3DC5A 5EBMC 5ITZA 4X65B 1YF2A 4FLWA 1H2MA 4TWKA 1VF6A 3VQXA 3IAYA 4CS3A 3FB7C 1SQFA 2QE7G 2IBZH 5J2TB 4KUMA 1BQ0A 5KA5A 1F23A 3AG4C 4H37A 2YSUB 5J2TA 3MHSC 4JI2B 4R7CA 4LH7A 2ADMA 2QM7A 3N27A 4UV8A 3CC4V 1K73W 5FPRA 4KL1A 2UUCB 1NJIW 1FJGB 1NVPB 2QSAA 2ZDIC 4FLVA 3ZMZA 4JI7O 2LGQA 4I7ZB 3WG7B 3ZCCA 4FLTA 1FXKB 1XNRO 3KCXA 4DR7B 5B1AC 4LF5O 1HNZO 4FZ1A 1FXKA 2W6IG 1OZ0A 4G27B 4UFZA 4X88A 1EZJA 4WBNB 4YXWG 5CBFA 2ZD9A 2IU3A 2NN4A 2YEVB 1QNMA 4DUZB 1LNQA 1OV9A 3ETDA 1N32B 4RQEA 3CE2A 4DR2B 4JI1B 5BMVB 1P84F 1YCIA 4ZKIA 2YEVA 1Q6IA 1R3KC 4UCUA 3CC2V 1IZ3A 1VQLV 4PA6A 3B8MA 1XHZA 4AQYO 2XAGA 5BMVA 3NR7A 4B3RB 4MSWC 5HFMA 5F2VO 1LUWA 4MTXA 4RQFA 1RM1B 5KA6A 3SJAC 2P5OA 3CCEV 3SJQC 4XBFA 2CAZC 2QWNB 1M5IA 4I50B 3BAAA 3CSXA 3T4DA 5CBHA 2UXXA 1KKCA 3S3WA 1X4TA 4I50A 5KAIZ 3TXQA 5KHIA 5B66Z 2G38A 2Q0AA 1CPYA 2AGAA 4DUYO 1D2DA 3EHBB 3H01A 3M7MX 2KKWA 2Q7EA 2XASA 3D8CA 5L3BA 5EYPB 5IYCO 3OAAG 4JAUA 1VARA 3B4SA 2UXCB 5EIBC 4MVRA 1QR9A 3OEEG 1V9PA 3C90A 2ARHA 5EYPA 1KP3A 5KUMA 5B1OA 1IBMO 2YUAA 1XMQB 1Q82W 1KU9A 4GYCB 4GKJO 4LFCB 3MAQA 5H9CA 4LF4O 2DYSC 4MVUA 3JAMN 2FYUH 4LF9B 3LSUA 2ETNA 3W7SA 2UXNA 4UCRA 4DR6O 1NR1A 1Z5VA 4CS4A 1Q5OA 2E75B 1PNLA 1PNMA 3JD0A 4BIZA 1NH2D 1VP7A 3UO3A 1WP8A 2EIMC 3BFRA 1GAXA 5BXZA 1MNGA 1YI2V 4O2AB 4QPKA 3ZMVA 1YTFD 3B40A 2VS0A 4LF8B 4O2AA 3K57A 2JIZG 4CH4A 1XREA 2Y69C 4P2ZA 1K4DC 1FD9A 2QTOA 3BHPA 3W7UA 5LOVB 1THZA 2EJRA 4LR3A 4DV1O 1NS1A 2WLHA 2YXHA 4UV9A 4DV2B 3B09A 1EN5A 1HWYA 2XAFA 2QDOA 1DF4A 1Y74A 3SPHA 5LOVA 4JYBA 2MK3A 4WFFA 3LSQA 1R73A 4DV5O 1MZFA 4HYOA 4X64B 2GV9A 2OIGA 4CBCA 5KHJA 2ZM6B 1NVPD 2PUSA 2ZXWC 4DR1O 1E1QG 5C8YB 4CH5A 1N8RW 2Q69A 2CGOA 3AG2B 4F4LA 1FPOA 3OT7A 4OPAA 1WB8A 2JGUA 3OTOB 3HKDB 5C8YA 1NR7A 4O4JB 1YXBA 4JYAB 1IBLO 1BT8A 1YHQV 4IT5A 3HKDA 2B1IA 4DW0A 2YIAA 4FM2A 4O4JA 3OUSA 5LA6B 2ZCEA 3DGEA 2VQFO 4YHHB 4MTOA 4DR5O 2UU9B 1PV0A 2DOSA 5LA6A 2AHZA 4EB6B 2L6LA 4K3AA 3PJSK 4PHZA 3E8BA 5KHGA 3STLC 3JCUZ 3RFRA 4EB6A 3MDSA 1JJ2U 3RBZA 4H44B 1Y67A 1M93A 3JSLA 2QTSA 4I5SA 1KQSU 5KMGB 3CXHF 4FLZA 1S5LZ 4EFBA 4MVOA 3AK2A 4MS2A 1VQ9V 4OPHA 4TT3G 5KMGA 4IYHA 3M8AA 4X8AA 1Y6XA 2EINB 1N34B 4N21A 5CA1B 1AI4A 1XI1A 2DYRB 3H9VA 4MTGA 3CP1A 4JI0B 4PDVA 5B5EZ 2QR4A 3UQ8A 4IHJB 5CA1A 2W0XA 2GSMB 1GTOA 3RVZA 3G80A 3WFVA 4LF7B 2ZR2A 4IHJA 1SQVH 2ZT9B 3ASOB 2N04A 2DJVA 2WLLB 2XT9A 1IVSA 3OE7G 3ABMB 5EBLC 1XNRB 1XQ8A 2M6YA 4QGPA 2CTQA 4YIPA 2X6AA 2WLLA 4DV0O 1DLBA 1H2LA 5EC1C 3F5WC 1VQ4V 2Y0IA 4EKWA 4CC5A 2HG5C 1ZX3A 1R3IC 2PYLA 3CEIA 1WLEA 3ZN1A 2OTLV 5K1XA 5E1AC 4I9QA 1Q8IA 3W7XA 3TETA 4JI5O 2HJDA 1PNKA 1IXMA 1JA8A 5LP6B 1M1KW 3D3QA 2CDYA 4B3TO 1AQJA 4ASUG 3ZIAG 3T1HO 4NXMO 3I56V 5LP6A 2VQEO 3RYIA 3TGUH 4PI2A 1GN4A 5BY1A 1ZAUA 2P22C 2Y4UA 4AQYB 2IW5A 4JV5B 4GX0A 4JAVA 3JARB 4B08A 3ZJZA 3AG7A 4U7OA 4X62O 4DV7B 1HR0O 4UVBA 2OT5A 4X1IB 1OCCC 2WLIB 3G6EV 3JARA 2ADQB 4E4EA 1AQIA 1W0JG 1AJNA 2P6JA 3CRMA 4ZIBA 4LFAO 2A79B 2ILMA 2WLIA 1JMKC 3MHHC 3BRCA 4RAIA 2Q7HA 1FFXB 4WFBV 2HFEC 1KYOF 3E22B 4J11A 5L3CA 2QKCA 1M56B 4DUYB 1FFXA 4MW3A 2C2AA 1BZKA 3SYPA 4TSFG 2Z5UA 3E22A 2VWKA 4NVPA 1TUEB 3X2QB 2ZIMA 4MTFA 3SYCA 4J7JA 2AZ0A 5B1BB 5JJJB 2AHYA 3RYFB 2PI5A 1VQ5V 4O4LB 3GVMA 1PKXA 3VBBA 3H1IH 4UUJC 4TV9B 4JI6O 4JGSA 2RMKB 2V4DA 3RYFA 1MA1A 4O4LA 3ABKC 2UXBB 5L3FA 4TV9A 3A0RA 4GX5A 1FXVA 4RUEA 4DW1A 4U3JB 1SC5B 4CH6A 4LF4B 2JRIA 1K3EA 4PDRA 1O9HA 5LMNO 1V55C 4FFKA 5B1NA 1VQMV 4U3JA 4YY3B 1UPGA 3LDCA 1G4YB 2F4VO 3B2EE 3B77A 4FM0A 2X7RB 4GCZA 1N36B 2YXLA 1VF7A 2WLKA 1NBMG 4B7KA 3LDDA 4OX9O 1D5NA 3K03A 5J2UB 1N33O 1Q90D 1IDSA 5CBGA 4NKGB 2A06H 2JJ2G 2EILB 5J2UA 3D36A 3N2GB 1KUQA 3K58A 1UJWB 1SETA 4WCEV 2LFRA 4LCUC 1K92A 1NH2B 4XDJA 4F6EA 1AR5A 3ZRWB 2PI4A 4X20B 2NR5A 2NNUA 2OCHA 1L0LH 4TOIA 3QNEA 3T2MA 4DV5B 2N05A 3ZRWA 4X20A 2HHHO 2V1DA 2HP8A 4DR1B 2P06A 3ZRVA 3JD4A 2AZ2A 4BWAA 3IJ4A 1YVWA 4H33A 3G4SV 3QO5A 3UCSC 2ZNJA 3HPLC 2NP7A 4GZRB 2PY5A 2XAHA 1IBLB 1QLEC 4QE9A 1GRJA 4GKKO 2XTAA 5GW7A 2WPDG 2E5LB 3E83A 3CCLV 1XL4A 1Y66A 3BABA 3SPIA 1VF5B 3W7WA 2E76B 3R66A 5EBWC 3A0BZ 4LH6A 4J7ZA 3J80N 2E3CA 3IFXA 4DV6B 2DYRC 3E86A 5IWAO 2LGWA 3JD2A 3OUFA 4FIPC 3OFNG 2HVJC 1M9NA 3CD6V 3BVOA 2ODMA 2EIKB 2GUZB 3TK1A 4TV8B 5CA0B 4ABMA 3K06A 3ZX6A 2Q67A 2WWWA 5IY5C 3FYEB 1XDCA 2IH2A 4CS2A 5KUKA 4JI4B 1YJ9V 2GUZA 3UT5B 4TV8A 5CA0A 3H1JH 3ASOC 3ZMSA 4Z1MG 5L3EA 1PD3A 3RGBA 1SKVA 1NT2B 5IDJA 2PZSA 3ABMC 5H5NA 4HBNA 1OCRC 4Q20A 4J42A 1TAEA 1BHAA 2W0FC 1AJQA 1QR8A 3QO8A 1JQ0A 4WBNA 1BE3H 1NZ6A 1U96A 2A0LA 1DTOA 2BOCC 1H2KA 4UCSA 2GTSA 4Q6GA 5FPOA 1H2SB 1YJWV 1WA8B 3NXSA 2QWOB 3OW2U 2OCCC 2Y48A 3JD3A 3CYOA 4GUNA 4MVZA 1HNWO 1WA8A 1SQQH 2KSDA 1NTZH 1S72V 2LP7A 2YXYA 1BQZA 5FL7G 1KB9F 4JI3O 1PPJH 1UFIA 1K33A 2DE0X 1DF5A 1JPXA 4PA9A 4D7TA 1F7YA 4NTXA 1COWG 5IT9N 3SYQA 3K9AA 2L35A 3U11A 2JDIG 5J9PC 5JJEB 3ZMUA 3VQYA 2AW9A 1MZEA 2ZE5A 4FPPA 3CCUV 2IH5A 2YIDA 3SGIA 3WU2Z 2PGGA 2QKAA 4NXNO 4B3TB 1DK1A 2F66C 3K59A 4B3MO 4PA7A 2UUBO 1NTMH 2VQEB 3A8TA 1RPOA 2BSKB 4XDKA 5IJ9B 3JD1A 1XMOO 4ZHQB 4JI8B 3CC7V 2XUMA 1FFTB 5D5PA 4MT8A 2BSKA 2IJKA 3ZEDA 1P4RA 1YITV 3VOUA 4B3SO 4ZHQA 1GM7A 2Q73A 4GT1A 2BTOA 4JYYA 5D5QA 2CUGA 2BE3A 2JEXA 1WAZA 1XEQA 3CMEV 1TVKB 5FNVB 3L71H 2R9RB 1B06A 3E35A 2IBTA 1FYJA 1YZBA 3VQVA 3ABLB 2LO1A 1TVKA 1FXHA 5FNVA 3RW0A 2EIJB 4R6ZA 1S5JA 2O57A 1BSMA 3HKEB 3M99B 1SS3A 1F4NA 1CXZB 3DXRB 5CB4B 1M57C 4MVQA 4FMTA 3HKEA 2ZNIA 3RWRD 3DXRA 1NQTA 1VIBA 5CB4A 1CP9A 1NTKH 1YIJV 4FZ0A 1L1FA 4R50A 3OEHG 2QA4V 4RWUA 1I08A 4A5UB 3O9OA 4K8XA 4J10A 5TISZ 1AILA 3E89A 4LFBO 2YDEA 1XUQA 2M7WA 3LNMB 4J41A 5IYZB 3ASNB 5LMNB 3L9DA 3CRQA 5LMUB 2EBOA 1XNQO 4G28B 4DRXB 5IYZA 1TUBB 1XILA 4HZ3A 1K5QA 1KP2A 5BZBA 1I94O 2YIBA 2HEPA 2ZINA 3CJHB 3L75H 4LP8A 4DRXA 3DC6A 1TUBA 2X6CA 4Z2WA 5JJNB 1BGYH 1H8HG 3T1CA 5A9GA 1VF6C 3CJHA 2VWJA 5B3SC 5JH7B 1E1RG 1V54B 4P9OA 3BA8A 1XOUA 1IBKO 4X65O 3PN1A 3QG5A 1GM9A 3ETQA 3SYOA 5JH7A 3K5LA 1EFRG 2YI9A 1OCOB 3AG1B 2P4VA 1J5EB 2IH1C 1OJHA 1JVMA 4KFMA 1GO3F 5IYDO 4ZI7B 2IJHA 1ZWIC 1Q7YW 3UKMA 4H0LB 3JAWB 3CMAV 4BR6A 3J7AU 3EVKA 2XAQA 4JI2O 4NTYA 3JAWA 3APQA 5CA3A 1FJGO 4CZZA 4I0XB 1WJZA 3R65A 1M90W 4KP4A 1BL8A 3G71V 2QM4A 4GLXA 3WG7C 4LBEC 4F6RB 3SPCA 4I0XA 1GN2A 2HLDG 1FXKC 3UO2A 5DN6G 4H13B 2GTAA 3K5OA 4F6RA 3L74H 3I55V 5BR8O 1P7GA 4NTWA 2WSSG 4IGGA 3AK3A 2IBSA 4FLUA 1AP5A 4I9WA 4UB8Z 1WB7A 2DWDC 1GH6A 4WFAV 1MABG 4DUZO 1IXBA 3HKCB 2QWQB 1GK9A 1VQNV 3L70H 4O4IB 5LXTB 4JI7B 4YJ2B 1GN6A 4ICGA 3I5DA 3F7YC 3HKCA 3OGIB 4AI8A 2WAMA 2WLNA 1PM9A 2OIEA 2ZDIA 1KECA 3HB3B 4W4LA 2KQXA 1Q86W 4B3RO 1RM1C 4O4IA 5LXTA 4YJ2A 4P30A 3MD0A 4LF5B 1HNZB 5B1AB 5HFLA 2LW1A 3E8GA 3VQWA 4WFEA 3DSQA 4QE7A 2H8PC 2QKSA 5KHHA 2ITDC 1DGSA 2B1GA 4BW5A 1VQPV 4DV4O 4ZOLB 1TGOA 2ADPA 4J9ZB 2FMLA 3G6BA 4ZOLA 2JEUA 1JX9A 2HR3A 2N74A 2FB5A 4IYIA 2HKOA 2HJFC 2UXCO 1HNWB 3STZC 4PA3A 2EX3A 1XBLA 3AEIA 1HNXO 3FB6C 5LHIA 4LF6O 1XMQO 4JYCA 4X1IA 2RNBA 2BTQB 1ORQC 5LL6Y 4LFCO 1R6TA 5JQGB 3D3IA 4X9QA 1PP9H 3ETEA 1PL4A 2BTQA 2ZE6A 5DEDA 1BHBA 1WP7A 4LF9O 4B7EA 3LNNA 5JQGA 3ZBHA 5IYBO 5C93A 2ITCC 2YIBD 1H2GA 3FD9A 2NP6A 3OR7C 1G6UA 3K5MA 1P49A 5DECA 4MVMA 1AVMA 4NXNB 1JFFB 1N0JA 4X89A 4NYKA 1LUVA 1B3QA 1QCEA 1SQBH 4B3MB 4J9YB 4L8JA 3AK1A 1U97A 3IC9A 2EJ7A 1JFFA 1S3JA 2UXDO 1FAFA 1IBMB 4MVSA 1XMOB 1BCCH 2H94A 4LF8O 1VQ6V 2PTMA 4GKJB 1CEZA 5LHGA 3S3XA 1RPRA 4JTAB 3G67A 3OD4A 4B3SB 1K97A 3SDLA 4E2LA 2DYSB 2F93B 4D6TH 1R6NA 3IGAC 5EC2C 1KD1W 4DR6B 3JATB 2YICA 4JZ2A 1K7DA 4DV2O 3T1YO 4ZBMA 3OMAB 1MSWD 1WNSA 4AILC 3JATA 3N2KB 1VMGA 2EIMB 4FK5C 1K9MW 3ASNC 1B6QA 3N2KA 1S77D 1ROPA 3RVYA 4KHPO 3O65A 3L73H 2B9ZA 3OM3B 1MG1A 4PJ0Z 3AG2C 2Y69B 1QVGU 2JS3A 2MW2B 4JTCB 1RP3B 2IJJA 4L87A 5KAFZ 5LBQA 2Q0OC 1AR4A 3A0HZ 2DW4A 4FFBB 4DV1B 4BAYA 2JG3A 1OHHG 3N2GA 3F7VC 4FFBA 3UM7A 3SR2C 1M4UA 4UVCA 4LFBB 1OCOC 4DYLA 2A9HA 4JTDB 3OTFA 2UU9O 3SJBC 3ZRSA 1XNQB 3JALB 2ZXWB 2R9AA 3WB1A 3QO7A 5EZYB 1K4CC 3JALA 4UCTA 4K0KO 1K5SA 5H2FZ 4UVAA 5CMUA 2OWOA 5EZYA 2VRZA 2CTRA 1IBKB 2OYQA 3CCQV 3C3TA 2VQFB 3CRAA 4FLXA 4DR5B 2EINC 3CX5F 1N34O 3WB2A 4CH3A 1YDXA 4RO2A 4FM1A 4JI0O 4FJCC 1KC8W 3RYHB 4P9PA 2DQ3A 2DQ0A 3ZHQA 4OXSA 3RYCB 1H38A 2UUAO 3RYHA 2BCCH 1SQGA 4UB6Z 1Q43A 1OCZB 4LC1A 4LF7O 2F95B 3P3NA 3RYCA 2JS5A 4TQDA 3KCYA 2X0LA 4EEQA 3UT5A 5JWPA 2CH7B 3ZMTA 5GTIZ 4BW9A 2GDSA 1SZXA 1MMMA 1LR1A 3OMNB 5JCOA 2CH7A 1SQPH 4IL6Z 5BR8B 3L72H 3ZHTA 3T4ZA 2F23A 1GKFA 2Q5ZA 4O2BB 3CCRV 2Y4TA 3BY6A 5LP6C 4WFHA 4O2BA 3H1HH 3SPJA 1L8DA 5H6QA 1MOFA 2E74B 2FTKA 1Z5WA 1N4CA 3QF7A 5EIBD 2Q7GA 2GBOA 1IX9A 1FS0G 1R3JC 4JV5O 2A3QA 4DK0A 4PD4F 3ZHSA 4DV0B 3FX7A 1WPBA 2QWRB 1AP6A 2P90A 1T5EA 1S76D 2R72A 4DV7O 3RT3C 4DR3O 1AROP 4J80A 3CCMV 2QGNA 4PI0A 1HP8A 3U10A 4JI5B 2B5UA 3TJTA 2XOKG 2PYJA 4DV4B 4I4TB 3LUTB 1BMFG 3T1HB 2QJ1A 4NXMB 1M56C 1VQ7V 3E8HA 3CCJV 2IM9A 4I4TA 1TA8A 5JVDB 2WLJA 1URFA 1R3LC 3K79A 3X2QC 1KMIZ 4TUYB 5JVDA 4X62B 5B1BC 5IJ9A 3EXAA 2YC0A 3A2FA 5GTHZ 1HR0B 5H6RA 4DR4O 1A32A 1OCCB 2ZR3A 4TUYA 4JZGA 3K04A 2RDCA 1HNXB 4LF6B 2F43G 4LFAB 1L0NH 3U0ZA 2UXBO 1GMGA 2DMXA 4PDLA 1SRYA 4WFGA 1EN6A 2ATKC 3SJCC 5LHHA 1SF9A 3CRRA 1JR9A 4PV1B 1I5YA 1O9GA 1Y76B 2R9IA 4BIOA 4DK1A 2YS8A 4TQFA 2CTPA 2V7QG 1E79G 5KHKA 4YY3O 4J7KA 3CS5A 1Y76A 2Z0AA 3E8FA 2XAJA 1N36O 4DV3O 2ZE7A 3TXSA 4X66O 4DXWA 2KB1A 1FKAO 4O4HB 3JAKB 4JI6B 2H3OA 2UXDB 3P30A 1ZL8B 5KX5B 1SQXH 3ABKB 4O4HA 3D36C 3JAKA 1H8EG 2F1MA 1XHXA 1I7FA 1NI8A 5IJ0B 3AG3B 1ZL8A 1NU1H 2EILC 5KX5A 3ZHUA 3ZN0A 2Q6AA 1Y74B 3BCCH 1V55B 5IJ0A 4W4KA 1IURA 4FVMA 2IU0A 3T1YB 2F4VB 1I0HA 4R8CA 5CN0A 1G38A 1QLNA 2W6JG 1Z2GA 3CWBH 1AB3A 2IJIA 3ZRXA 2P7TC 3CB2A 4UXNA 5IE9A 2ZQMA 5AG2A 4KHPB 4OX9B 4I55B 4UCVA 1N33B 3RN4A 3F5TA 4KXRA 4I55A 1G1XB 1SERA 3FKSG 3P3PA 4JASA 4D7SA 3B8NA 1SZTA 3IC7A 1S5HC 1P7BA 3JYCA 2E5LO 3ZHVA 5DM6V 2OTJV 4Z1VA 3CPWU 2EZOA 1AR1B 4ZI7A 4K35A 4HNAB 4PELA 2HHHB 2UUCO 1VQKV 1K8AW 2RJZA 1F4MA 2ZIOA 4DV6O 1W59A 1WN7A 4G2KA 4HNAA 2GHYA 4YJ3B 2CK3G 2EIKC 4DO2A 3FAVB 1AJPA 2R70A 3GWOA 4EFEA 2AXTZ 4YJ3A 1JOYA 4U3FH 3APOA 5L3GA 1OCZC 2K1EA 4DR7O 3SPGA 4K0KB 3DTUB 1QLEB 1Q6UA 4JI4O 4GKKB 3FAVA 5LGNA 2DWEC 3AG4B 3HR0A 5GONB 3FB8C 2WLMA 4XDLA 2JGDB 3K08A 4N23A 3HKBB 5JCOC 2P67A 3E2EA 3JSNA 5GONA 3JASB 2ZKOA 2D3OW 1N0NA 1QHTA 2JGDA 1HDJA 1N32O 3HKBA 3QTCA 4DR2O 4JI1O 2EULA 1GN3A 5IWAB 2KG7B 3EFFK 5EK0A 4PA4A 3JASA 5LYJB 1Q81W 2PF4E 2EZPA 2LQTA 1Y4MA 3K0GA 3LDEA 1B04A 1SESA 2KG7A 2UUAB 4OGQB 5IY5B 5KLVH 3THOA 5LYJA 4CC6A 3CCVV 4QIWF 4MW8A 3W7TA 5E79Z 2X6BA 3OR6C 1I5XA 1AI5A 4C7UA 3ZHRA 4AHCA 3FYIB 3BA9A 2D2CB 3H1LH 3P32A 1OCRB 3K5NA 3K0DA 3Q4HB 3WB0A 3ABUA 1Q6HA 3KKYA 2CE4A 1QVFU 4PDMA 4U7NA 3Q4HA 5FLXN 1J95A 1AI6A 1QU7A 1S0VA 3RYIB 2FKXA 2QEXV 3CXCU 2OCCB 1AI7A 2K9PA 4K8ZA 2Q4PA 5A2QN 2A7WA 3ML0A 2JK5C 4JPRA 3OKGA 4JI3B 4JI8O 3K9SA 1ENVA 4X1YB 2XHBA 2LW7A 2BOBC 4YIOA 4DR3B 2QWPB 1ZSPA 4X1YA 1EN4A 4JAAA 3CCSV 1ZLZA 1R6KA 2LJ2A 2IH4A 1D5AA 2CTWA 1YEWA 1H2NA 1JJOA 2CGNA 4GX2A 3KG2A 2WA3A 2Q8VA 1EBOA 3ABTA 2UUBB 3ETGA 3KZIZ 2WA4A 3ABLC 2FL4A 4HAMA 1RFYA 1ZTEA 2QM8A 1Q3EA 1RSOB 3H1KH 3OMIB 2EIJC 2LFSA 4UCOA 2Q9LA 4NB5A 1WPXA 1K34A 1RSOA 2RCVA 2Z3YA 4LNUB 1VEWA 4DR4B 1YSCA 2NLJC 3FFQA 1SA0B 2DN9A 3BPZA 1QQCA 4LNUA 2JVDA 3TCUA 4BIUA 2P4KA 1KBHA 1SA0A 3AG3C 4QJFB 1NKDA 1ZUQA 5LGTA 1W2BU 1G8MA 2IH3C 1XL6A 1BS3A 3QVNA 1QBZA 1EM1A 1EZVH 4X64O 1VQ8V 2ZM6O 3K3WA 3CRCA 5LMUO 2YI8A 3BEHA 5L3DA 5LGUA 5K1PA 4DV3B 4WF9V 4X66B 1M57B 3OTOO 1GM8A 4JF3A 2XNDG 4JYAO 2RN9A 4QNHB 1V54C 3GB7C 3CHXA 1F51A 3GWKC 1JCHA 3OGCC 4QPJA 1X59A 4NR1A 2Q68A 3AG1C 4YHHO 3C3SA 1KKDA 1J5EO 4LWSB 3ZS8C 4GX1A 3JCZA 1R1BA 1US6A 3FB5C 2ZE8A 1PL0A 2Y0PA 2RQ6A 4FLYA 4LWSA 2JJ1G 4IIJB 1I94B 1HW7A 3J81N 3LSSA 3ICXA 1W0KG 4X1KB 4RUFA 3SYAA
chains in the Genus database with same CATH topology
3OKGA 1YF2A 1YDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKG A;  1YF2 A;  1YDX A; 
#chains in the Genus database with same CATH topology
 1YTF B;  5ITZ B;  4IIJ A;  1VQO V;  2HVK C;  4X1K A;  1MSD A;  1YJN V;  5B3S B;  3DC5 A;  5EBM C;  5ITZ A;  4X65 B;  1YF2 A;  4FLW A;  1H2M A;  4TWK A;  1VF6 A;  3VQX A;  3IAY A;  4CS3 A;  3FB7 C;  1SQF A;  2QE7 G;  2IBZ H;  5J2T B;  4KUM A;  1BQ0 A;  5KA5 A;  1F23 A;  3AG4 C;  4H37 A;  2YSU B;  5J2T A;  3MHS C;  4JI2 B;  4R7C A;  4LH7 A;  2ADM A;  2QM7 A;  3N27 A;  4UV8 A;  3CC4 V;  1K73 W;  5FPR A;  4KL1 A;  2UUC B;  1NJI W;  1FJG B;  1NVP B;  2QSA A;  2ZDI C;  4FLV A;  3ZMZ A;  4JI7 O;  2LGQ A;  4I7Z B;  3WG7 B;  3ZCC A;  4FLT A;  1FXK B;  1XNR O;  3KCX A;  4DR7 B;  5B1A C;  4LF5 O;  1HNZ O;  4FZ1 A;  1FXK A;  2W6I G;  1OZ0 A;  4G27 B;  4UFZ A;  4X88 A;  1EZJ A;  4WBN B;  4YXW G;  5CBF A;  2ZD9 A;  2IU3 A;  2NN4 A;  2YEV B;  1QNM A;  4DUZ B;  1LNQ A;  1OV9 A;  3ETD A;  1N32 B;  4RQE A;  3CE2 A;  4DR2 B;  4JI1 B;  5BMV B;  1P84 F;  1YCI A;  4ZKI A;  2YEV A;  1Q6I A;  1R3K C;  4UCU A;  3CC2 V;  1IZ3 A;  1VQL V;  4PA6 A;  3B8M A;  1XHZ A;  4AQY O;  2XAG A;  5BMV A;  3NR7 A;  4B3R B;  4MSW C;  5HFM A;  5F2V O;  1LUW A;  4MTX A;  4RQF A;  1RM1 B;  5KA6 A;  3SJA C;  2P5O A;  3CCE V;  3SJQ C;  4XBF A;  2CAZ C;  2QWN B;  1M5I A;  4I50 B;  3BAA A;  3CSX A;  3T4D A;  5CBH A;  2UXX A;  1KKC A;  3S3W A;  1X4T A;  4I50 A;  5KAI Z;  3TXQ A;  5KHI A;  5B66 Z;  2G38 A;  2Q0A A;  1CPY A;  2AGA A;  4DUY O;  1D2D A;  3EHB B;  3H01 A;  3M7M X;  2KKW A;  2Q7E A;  2XAS A;  3D8C A;  5L3B A;  5EYP B;  5IYC O;  3OAA G;  4JAU A;  1VAR A;  3B4S A;  2UXC B;  5EIB C;  4MVR A;  1QR9 A;  3OEE G;  1V9P A;  3C90 A;  2ARH A;  5EYP A;  1KP3 A;  5KUM A;  5B1O A;  1IBM O;  2YUA A;  1XMQ B;  1Q82 W;  1KU9 A;  4GYC B;  4GKJ O;  4LFC B;  3MAQ A;  5H9C A;  4LF4 O;  2DYS C;  4MVU A;  3JAM N;  2FYU H;  4LF9 B;  3LSU A;  2ETN A;  3W7S A;  2UXN A;  4UCR A;  4DR6 O;  1NR1 A;  1Z5V A;  4CS4 A;  1Q5O A;  2E75 B;  1PNL A;  1PNM A;  3JD0 A;  4BIZ A;  1NH2 D;  1VP7 A;  3UO3 A;  1WP8 A;  2EIM C;  3BFR A;  1GAX A;  5BXZ A;  1MNG A;  1YI2 V;  4O2A B;  4QPK A;  3ZMV A;  1YTF D;  3B40 A;  2VS0 A;  4LF8 B;  4O2A A;  3K57 A;  2JIZ G;  4CH4 A;  1XRE A;  2Y69 C;  4P2Z A;  1K4D C;  1FD9 A;  2QTO A;  3BHP A;  3W7U A;  5LOV B;  1THZ A;  2EJR A;  4LR3 A;  4DV1 O;  1NS1 A;  2WLH A;  2YXH A;  4UV9 A;  4DV2 B;  3B09 A;  1EN5 A;  1HWY A;  2XAF A;  2QDO A;  1DF4 A;  1Y74 A;  3SPH A;  5LOV A;  4JYB A;  2MK3 A;  4WFF A;  3LSQ A;  1R73 A;  4DV5 O;  1MZF A;  4HYO A;  4X64 B;  2GV9 A;  2OIG A;  4CBC A;  5KHJ A;  2ZM6 B;  1NVP D;  2PUS A;  2ZXW C;  4DR1 O;  1E1Q G;  5C8Y B;  4CH5 A;  1N8R W;  2Q69 A;  2CGO A;  3AG2 B;  4F4L A;  1FPO A;  3OT7 A;  4OPA A;  1WB8 A;  2JGU A;  3OTO B;  3HKD B;  5C8Y A;  1NR7 A;  4O4J B;  1YXB A;  4JYA B;  1IBL O;  1BT8 A;  1YHQ V;  4IT5 A;  3HKD A;  2B1I A;  4DW0 A;  2YIA A;  4FM2 A;  4O4J A;  3OUS A;  5LA6 B;  2ZCE A;  3DGE A;  2VQF O;  4YHH B;  4MTO A;  4DR5 O;  2UU9 B;  1PV0 A;  2DOS A;  5LA6 A;  2AHZ A;  4EB6 B;  2L6L A;  4K3A A;  3PJS K;  4PHZ A;  3E8B A;  5KHG A;  3STL C;  3JCU Z;  3RFR A;  4EB6 A;  3MDS A;  1JJ2 U;  3RBZ A;  4H44 B;  1Y67 A;  1M93 A;  3JSL A;  2QTS A;  4I5S A;  1KQS U;  5KMG B;  3CXH F;  4FLZ A;  1S5L Z;  4EFB A;  4MVO A;  3AK2 A;  4MS2 A;  1VQ9 V;  4OPH A;  4TT3 G;  5KMG A;  4IYH A;  3M8A A;  4X8A A;  1Y6X A;  2EIN B;  1N34 B;  4N21 A;  5CA1 B;  1AI4 A;  1XI1 A;  2DYR B;  3H9V A;  4MTG A;  3CP1 A;  4JI0 B;  4PDV A;  5B5E Z;  2QR4 A;  3UQ8 A;  4IHJ B;  5CA1 A;  2W0X A;  2GSM B;  1GTO A;  3RVZ A;  3G80 A;  3WFV A;  4LF7 B;  2ZR2 A;  4IHJ A;  1SQV H;  2ZT9 B;  3ASO B;  2N04 A;  2DJV A;  2WLL B;  2XT9 A;  1IVS A;  3OE7 G;  3ABM B;  5EBL C;  1XNR B;  1XQ8 A;  2M6Y A;  4QGP A;  2CTQ A;  4YIP A;  2X6A A;  2WLL A;  4DV0 O;  1DLB A;  1H2L A;  5EC1 C;  3F5W C;  1VQ4 V;  2Y0I A;  4EKW A;  4CC5 A;  2HG5 C;  1ZX3 A;  1R3I C;  2PYL A;  3CEI A;  1WLE A;  3ZN1 A;  2OTL V;  5K1X A;  5E1A C;  4I9Q A;  1Q8I A;  3W7X A;  3TET A;  4JI5 O;  2HJD A;  1PNK A;  1IXM A;  1JA8 A;  5LP6 B;  1M1K W;  3D3Q A;  2CDY A;  4B3T O;  1AQJ A;  4ASU G;  3ZIA G;  3T1H O;  4NXM O;  3I56 V;  5LP6 A;  2VQE O;  3RYI A;  3TGU H;  4PI2 A;  1GN4 A;  5BY1 A;  1ZAU A;  2P22 C;  2Y4U A;  4AQY B;  2IW5 A;  4JV5 B;  4GX0 A;  4JAV A;  3JAR B;  4B08 A;  3ZJZ A;  3AG7 A;  4U7O A;  4X62 O;  4DV7 B;  1HR0 O;  4UVB A;  2OT5 A;  4X1I B;  1OCC C;  2WLI B;  3G6E V;  3JAR A;  2ADQ B;  4E4E A;  1AQI A;  1W0J G;  1AJN A;  2P6J A;  3CRM A;  4ZIB A;  4LFA O;  2A79 B;  2ILM A;  2WLI A;  1JMK C;  3MHH C;  3BRC A;  4RAI A;  2Q7H A;  1FFX B;  4WFB V;  2HFE C;  1KYO F;  3E22 B;  4J11 A;  5L3C A;  2QKC A;  1M56 B;  4DUY B;  1FFX A;  4MW3 A;  2C2A A;  1BZK A;  3SYP A;  4TSF G;  2Z5U A;  3E22 A;  2VWK A;  4NVP A;  1TUE B;  3X2Q B;  2ZIM A;  4MTF A;  3SYC A;  4J7J A;  2AZ0 A;  5B1B B;  5JJJ B;  2AHY A;  3RYF B;  2PI5 A;  1VQ5 V;  4O4L B;  3GVM A;  1PKX A;  3VBB A;  3H1I H;  4UUJ C;  4TV9 B;  4JI6 O;  4JGS A;  2RMK B;  2V4D A;  3RYF A;  1MA1 A;  4O4L A;  3ABK C;  2UXB B;  5L3F A;  4TV9 A;  3A0R A;  4GX5 A;  1FXV A;  4RUE A;  4DW1 A;  4U3J B;  1SC5 B;  4CH6 A;  4LF4 B;  2JRI A;  1K3E A;  4PDR A;  1O9H A;  5LMN O;  1V55 C;  4FFK A;  5B1N A;  1VQM V;  4U3J A;  4YY3 B;  1UPG A;  3LDC A;  1G4Y B;  2F4V O;  3B2E E;  3B77 A;  4FM0 A;  2X7R B;  4GCZ A;  1N36 B;  2YXL A;  1VF7 A;  2WLK A;  1NBM G;  4B7K A;  3LDD A;  4OX9 O;  1D5N A;  3K03 A;  5J2U B;  1N33 O;  1Q90 D;  1IDS A;  5CBG A;  4NKG B;  2A06 H;  2JJ2 G;  2EIL B;  5J2U A;  3D36 A;  3N2G B;  1KUQ A;  3K58 A;  1UJW B;  1SET A;  4WCE V;  2LFR A;  4LCU C;  1K92 A;  1NH2 B;  4XDJ A;  4F6E A;  1AR5 A;  3ZRW B;  2PI4 A;  4X20 B;  2NR5 A;  2NNU A;  2OCH A;  1L0L H;  4TOI A;  3QNE A;  3T2M A;  4DV5 B;  2N05 A;  3ZRW A;  4X20 A;  2HHH O;  2V1D A;  2HP8 A;  4DR1 B;  2P06 A;  3ZRV A;  3JD4 A;  2AZ2 A;  4BWA A;  3IJ4 A;  1YVW A;  4H33 A;  3G4S V;  3QO5 A;  3UCS C;  2ZNJ A;  3HPL C;  2NP7 A;  4GZR B;  2PY5 A;  2XAH A;  1IBL B;  1QLE C;  4QE9 A;  1GRJ A;  4GKK O;  2XTA A;  5GW7 A;  2WPD G;  2E5L B;  3E83 A;  3CCL V;  1XL4 A;  1Y66 A;  3BAB A;  3SPI A;  1VF5 B;  3W7W A;  2E76 B;  3R66 A;  5EBW C;  3A0B Z;  4LH6 A;  4J7Z A;  3J80 N;  2E3C A;  3IFX A;  4DV6 B;  2DYR C;  3E86 A;  5IWA O;  2LGW A;  3JD2 A;  3OUF A;  4FIP C;  3OFN G;  2HVJ C;  1M9N A;  3CD6 V;  3BVO A;  2ODM A;  2EIK B;  2GUZ B;  3TK1 A;  4TV8 B;  5CA0 B;  4ABM A;  3K06 A;  3ZX6 A;  2Q67 A;  2WWW A;  5IY5 C;  3FYE B;  1XDC A;  2IH2 A;  4CS2 A;  5KUK A;  4JI4 B;  1YJ9 V;  2GUZ A;  3UT5 B;  4TV8 A;  5CA0 A;  3H1J H;  3ASO C;  3ZMS A;  4Z1M G;  5L3E A;  1PD3 A;  3RGB A;  1SKV A;  1NT2 B;  5IDJ A;  2PZS A;  3ABM C;  5H5N A;  4HBN A;  1OCR C;  4Q20 A;  4J42 A;  1TAE A;  1BHA A;  2W0F C;  1AJQ A;  1QR8 A;  3QO8 A;  1JQ0 A;  4WBN A;  1BE3 H;  1NZ6 A;  1U96 A;  2A0L A;  1DTO A;  2BOC C;  1H2K A;  4UCS A;  2GTS A;  4Q6G A;  5FPO A;  1H2S B;  1YJW V;  1WA8 B;  3NXS A;  2QWO B;  3OW2 U;  2OCC C;  2Y48 A;  3JD3 A;  3CYO A;  4GUN A;  4MVZ A;  1HNW O;  1WA8 A;  1SQQ H;  2KSD A;  1NTZ H;  1S72 V;  2LP7 A;  2YXY A;  1BQZ A;  5FL7 G;  1KB9 F;  4JI3 O;  1PPJ H;  1UFI A;  1K33 A;  2DE0 X;  1DF5 A;  1JPX A;  4PA9 A;  4D7T A;  1F7Y A;  4NTX A;  1COW G;  5IT9 N;  3SYQ A;  3K9A A;  2L35 A;  3U11 A;  2JDI G;  5J9P C;  5JJE B;  3ZMU A;  3VQY A;  2AW9 A;  1MZE A;  2ZE5 A;  4FPP A;  3CCU V;  2IH5 A;  2YID A;  3SGI A;  3WU2 Z;  2PGG A;  2QKA A;  4NXN O;  4B3T B;  1DK1 A;  2F66 C;  3K59 A;  4B3M O;  4PA7 A;  2UUB O;  1NTM H;  2VQE B;  3A8T A;  1RPO A;  2BSK B;  4XDK A;  5IJ9 B;  3JD1 A;  1XMO O;  4ZHQ B;  4JI8 B;  3CC7 V;  2XUM A;  1FFT B;  5D5P A;  4MT8 A;  2BSK A;  2IJK A;  3ZED A;  1P4R A;  1YIT V;  3VOU A;  4B3S O;  4ZHQ A;  1GM7 A;  2Q73 A;  4GT1 A;  2BTO A;  4JYY A;  5D5Q A;  2CUG A;  2BE3 A;  2JEX A;  1WAZ A;  1XEQ A;  3CME V;  1TVK B;  5FNV B;  3L71 H;  2R9R B;  1B06 A;  3E35 A;  2IBT A;  1FYJ A;  1YZB A;  3VQV A;  3ABL B;  2LO1 A;  1TVK A;  1FXH A;  5FNV A;  3RW0 A;  2EIJ B;  4R6Z A;  1S5J A;  2O57 A;  1BSM A;  3HKE B;  3M99 B;  1SS3 A;  1F4N A;  1CXZ B;  3DXR B;  5CB4 B;  1M57 C;  4MVQ A;  4FMT A;  3HKE A;  2ZNI A;  3RWR D;  3DXR A;  1NQT A;  1VIB A;  5CB4 A;  1CP9 A;  1NTK H;  1YIJ V;  4FZ0 A;  1L1F A;  4R50 A;  3OEH G;  2QA4 V;  4RWU A;  1I08 A;  4A5U B;  3O9O A;  4K8X A;  4J10 A;  5TIS Z;  1AIL A;  3E89 A;  4LFB O;  2YDE A;  1XUQ A;  2M7W A;  3LNM B;  4J41 A;  5IYZ B;  3ASN B;  5LMN B;  3L9D A;  3CRQ A;  5LMU B;  2EBO A;  1XNQ O;  4G28 B;  4DRX B;  5IYZ A;  1TUB B;  1XIL A;  4HZ3 A;  1K5Q A;  1KP2 A;  5BZB A;  1I94 O;  2YIB A;  2HEP A;  2ZIN A;  3CJH B;  3L75 H;  4LP8 A;  4DRX A;  3DC6 A;  1TUB A;  2X6C A;  4Z2W A;  5JJN B;  1BGY H;  1H8H G;  3T1C A;  5A9G A;  1VF6 C;  3CJH A;  2VWJ A;  5B3S C;  5JH7 B;  1E1R G;  1V54 B;  4P9O A;  3BA8 A;  1XOU A;  1IBK O;  4X65 O;  3PN1 A;  3QG5 A;  1GM9 A;  3ETQ A;  3SYO A;  5JH7 A;  3K5L A;  1EFR G;  2YI9 A;  1OCO B;  3AG1 B;  2P4V A;  1J5E B;  2IH1 C;  1OJH A;  1JVM A;  4KFM A;  1GO3 F;  5IYD O;  4ZI7 B;  2IJH A;  1ZWI C;  1Q7Y W;  3UKM A;  4H0L B;  3JAW B;  3CMA V;  4BR6 A;  3J7A U;  3EVK A;  2XAQ A;  4JI2 O;  4NTY A;  3JAW A;  3APQ A;  5CA3 A;  1FJG O;  4CZZ A;  4I0X B;  1WJZ A;  3R65 A;  1M90 W;  4KP4 A;  1BL8 A;  3G71 V;  2QM4 A;  4GLX A;  3WG7 C;  4LBE C;  4F6R B;  3SPC A;  4I0X A;  1GN2 A;  2HLD G;  1FXK C;  3UO2 A;  5DN6 G;  4H13 B;  2GTA A;  3K5O A;  4F6R A;  3L74 H;  3I55 V;  5BR8 O;  1P7G A;  4NTW A;  2WSS G;  4IGG A;  3AK3 A;  2IBS A;  4FLU A;  1AP5 A;  4I9W A;  4UB8 Z;  1WB7 A;  2DWD C;  1GH6 A;  4WFA V;  1MAB G;  4DUZ O;  1IXB A;  3HKC B;  2QWQ B;  1GK9 A;  1VQN V;  3L70 H;  4O4I B;  5LXT B;  4JI7 B;  4YJ2 B;  1GN6 A;  4ICG A;  3I5D A;  3F7Y C;  3HKC A;  3OGI B;  4AI8 A;  2WAM A;  2WLN A;  1PM9 A;  2OIE A;  2ZDI A;  1KEC A;  3HB3 B;  4W4L A;  2KQX A;  1Q86 W;  4B3R O;  1RM1 C;  4O4I A;  5LXT A;  4YJ2 A;  4P30 A;  3MD0 A;  4LF5 B;  1HNZ B;  5B1A B;  5HFL A;  2LW1 A;  3E8G A;  3VQW A;  4WFE A;  3DSQ A;  4QE7 A;  2H8P C;  2QKS A;  5KHH A;  2ITD C;  1DGS A;  2B1G A;  4BW5 A;  1VQP V;  4DV4 O;  4ZOL B;  1TGO A;  2ADP A;  4J9Z B;  2FML A;  3G6B A;  4ZOL A;  2JEU A;  1JX9 A;  2HR3 A;  2N74 A;  2FB5 A;  4IYI A;  2HKO A;  2HJF C;  2UXC O;  1HNW B;  3STZ C;  4PA3 A;  2EX3 A;  1XBL A;  3AEI A;  1HNX O;  3FB6 C;  5LHI A;  4LF6 O;  1XMQ O;  4JYC A;  4X1I A;  2RNB A;  2BTQ B;  1ORQ C;  5LL6 Y;  4LFC O;  1R6T A;  5JQG B;  3D3I A;  4X9Q A;  1PP9 H;  3ETE A;  1PL4 A;  2BTQ A;  2ZE6 A;  5DED A;  1BHB A;  1WP7 A;  4LF9 O;  4B7E A;  3LNN A;  5JQG A;  3ZBH A;  5IYB O;  5C93 A;  2ITC C;  2YIB D;  1H2G A;  3FD9 A;  2NP6 A;  3OR7 C;  1G6U A;  3K5M A;  1P49 A;  5DEC A;  4MVM A;  1AVM A;  4NXN B;  1JFF B;  1N0J A;  4X89 A;  4NYK A;  1LUV A;  1B3Q A;  1QCE A;  1SQB H;  4B3M B;  4J9Y B;  4L8J A;  3AK1 A;  1U97 A;  3IC9 A;  2EJ7 A;  1JFF A;  1S3J A;  2UXD O;  1FAF A;  1IBM B;  4MVS A;  1XMO B;  1BCC H;  2H94 A;  4LF8 O;  1VQ6 V;  2PTM A;  4GKJ B;  1CEZ A;  5LHG A;  3S3X A;  1RPR A;  4JTA B;  3G67 A;  3OD4 A;  4B3S B;  1K97 A;  3SDL A;  4E2L A;  2DYS B;  2F93 B;  4D6T H;  1R6N A;  3IGA C;  5EC2 C;  1KD1 W;  4DR6 B;  3JAT B;  2YIC A;  4JZ2 A;  1K7D A;  4DV2 O;  3T1Y O;  4ZBM A;  3OMA B;  1MSW D;  1WNS A;  4AIL C;  3JAT A;  3N2K B;  1VMG A;  2EIM B;  4FK5 C;  1K9M W;  3ASN C;  1B6Q A;  3N2K A;  1S77 D;  1ROP A;  3RVY A;  4KHP O;  3O65 A;  3L73 H;  2B9Z A;  3OM3 B;  1MG1 A;  4PJ0 Z;  3AG2 C;  2Y69 B;  1QVG U;  2JS3 A;  2MW2 B;  4JTC B;  1RP3 B;  2IJJ A;  4L87 A;  5KAF Z;  5LBQ A;  2Q0O C;  1AR4 A;  3A0H Z;  2DW4 A;  4FFB B;  4DV1 B;  4BAY A;  2JG3 A;  1OHH G;  3N2G A;  3F7V C;  4FFB A;  3UM7 A;  3SR2 C;  1M4U A;  4UVC A;  4LFB B;  1OCO C;  4DYL A;  2A9H A;  4JTD B;  3OTF A;  2UU9 O;  3SJB C;  3ZRS A;  1XNQ B;  3JAL B;  2ZXW B;  2R9A A;  3WB1 A;  3QO7 A;  5EZY B;  1K4C C;  3JAL A;  4UCT A;  4K0K O;  1K5S A;  5H2F Z;  4UVA A;  5CMU A;  2OWO A;  5EZY A;  2VRZ A;  2CTR A;  1IBK B;  2OYQ A;  3CCQ V;  3C3T A;  2VQF B;  3CRA A;  4FLX A;  4DR5 B;  2EIN C;  3CX5 F;  1N34 O;  3WB2 A;  4CH3 A;  1YDX A;  4RO2 A;  4FM1 A;  4JI0 O;  4FJC C;  1KC8 W;  3RYH B;  4P9P A;  2DQ3 A;  2DQ0 A;  3ZHQ A;  4OXS A;  3RYC B;  1H38 A;  2UUA O;  3RYH A;  2BCC H;  1SQG A;  4UB6 Z;  1Q43 A;  1OCZ B;  4LC1 A;  4LF7 O;  2F95 B;  3P3N A;  3RYC A;  2JS5 A;  4TQD A;  3KCY A;  2X0L A;  4EEQ A;  3UT5 A;  5JWP A;  2CH7 B;  3ZMT A;  5GTI Z;  4BW9 A;  2GDS A;  1SZX A;  1MMM A;  1LR1 A;  3OMN B;  5JCO A;  2CH7 A;  1SQP H;  4IL6 Z;  5BR8 B;  3L72 H;  3ZHT A;  3T4Z A;  2F23 A;  1GKF A;  2Q5Z A;  4O2B B;  3CCR V;  2Y4T A;  3BY6 A;  5LP6 C;  4WFH A;  4O2B A;  3H1H H;  3SPJ A;  1L8D A;  5H6Q A;  1MOF A;  2E74 B;  2FTK A;  1Z5W A;  1N4C A;  3QF7 A;  5EIB D;  2Q7G A;  2GBO A;  1IX9 A;  1FS0 G;  1R3J C;  4JV5 O;  2A3Q A;  4DK0 A;  4PD4 F;  3ZHS A;  4DV0 B;  3FX7 A;  1WPB A;  2QWR B;  1AP6 A;  2P90 A;  1T5E A;  1S76 D;  2R72 A;  4DV7 O;  3RT3 C;  4DR3 O;  1ARO P;  4J80 A;  3CCM V;  2QGN A;  4PI0 A;  1HP8 A;  3U10 A;  4JI5 B;  2B5U A;  3TJT A;  2XOK G;  2PYJ A;  4DV4 B;  4I4T B;  3LUT B;  1BMF G;  3T1H B;  2QJ1 A;  4NXM B;  1M56 C;  1VQ7 V;  3E8H A;  3CCJ V;  2IM9 A;  4I4T A;  1TA8 A;  5JVD B;  2WLJ A;  1URF A;  1R3L C;  3K79 A;  3X2Q C;  1KMI Z;  4TUY B;  5JVD A;  4X62 B;  5B1B C;  5IJ9 A;  3EXA A;  2YC0 A;  3A2F A;  5GTH Z;  1HR0 B;  5H6R A;  4DR4 O;  1A32 A;  1OCC B;  2ZR3 A;  4TUY A;  4JZG A;  3K04 A;  2RDC A;  1HNX B;  4LF6 B;  2F43 G;  4LFA B;  1L0N H;  3U0Z A;  2UXB O;  1GMG A;  2DMX A;  4PDL A;  1SRY A;  4WFG A;  1EN6 A;  2ATK C;  3SJC C;  5LHH A;  1SF9 A;  3CRR A;  1JR9 A;  4PV1 B;  1I5Y A;  1O9G A;  1Y76 B;  2R9I A;  4BIO A;  4DK1 A;  2YS8 A;  4TQF A;  2CTP A;  2V7Q G;  1E79 G;  5KHK A;  4YY3 O;  4J7K A;  3CS5 A;  1Y76 A;  2Z0A A;  3E8F A;  2XAJ A;  1N36 O;  4DV3 O;  2ZE7 A;  3TXS A;  4X66 O;  4DXW A;  2KB1 A;  1FKA O;  4O4H B;  3JAK B;  4JI6 B;  2H3O A;  2UXD B;  3P30 A;  1ZL8 B;  5KX5 B;  1SQX H;  3ABK B;  4O4H A;  3D36 C;  3JAK A;  1H8E G;  2F1M A;  1XHX A;  1I7F A;  1NI8 A;  5IJ0 B;  3AG3 B;  1ZL8 A;  1NU1 H;  2EIL C;  5KX5 A;  3ZHU A;  3ZN0 A;  2Q6A A;  1Y74 B;  3BCC H;  1V55 B;  5IJ0 A;  4W4K A;  1IUR A;  4FVM A;  2IU0 A;  3T1Y B;  2F4V B;  1I0H A;  4R8C A;  5CN0 A;  1G38 A;  1QLN A;  2W6J G;  1Z2G A;  3CWB H;  1AB3 A;  2IJI A;  3ZRX A;  2P7T C;  3CB2 A;  4UXN A;  5IE9 A;  2ZQM A;  5AG2 A;  4KHP B;  4OX9 B;  4I55 B;  4UCV A;  1N33 B;  3RN4 A;  3F5T A;  4KXR A;  4I55 A;  1G1X B;  1SER A;  3FKS G;  3P3P A;  4JAS A;  4D7S A;  3B8N A;  1SZT A;  3IC7 A;  1S5H C;  1P7B A;  3JYC A;  2E5L O;  3ZHV A;  5DM6 V;  2OTJ V;  4Z1V A;  3CPW U;  2EZO A;  1AR1 B;  4ZI7 A;  4K35 A;  4HNA B;  4PEL A;  2HHH B;  2UUC O;  1VQK V;  1K8A W;  2RJZ A;  1F4M A;  2ZIO A;  4DV6 O;  1W59 A;  1WN7 A;  4G2K A;  4HNA A;  2GHY A;  4YJ3 B;  2CK3 G;  2EIK C;  4DO2 A;  3FAV B;  1AJP A;  2R70 A;  3GWO A;  4EFE A;  2AXT Z;  4YJ3 A;  1JOY A;  4U3F H;  3APO A;  5L3G A;  1OCZ C;  2K1E A;  4DR7 O;  3SPG A;  4K0K B;  3DTU B;  1QLE B;  1Q6U A;  4JI4 O;  4GKK B;  3FAV A;  5LGN A;  2DWE C;  3AG4 B;  3HR0 A;  5GON B;  3FB8 C;  2WLM A;  4XDL A;  2JGD B;  3K08 A;  4N23 A;  3HKB B;  5JCO C;  2P67 A;  3E2E A;  3JSN A;  5GON A;  3JAS B;  2ZKO A;  2D3O W;  1N0N A;  1QHT A;  2JGD A;  1HDJ A;  1N32 O;  3HKB A;  3QTC A;  4DR2 O;  4JI1 O;  2EUL A;  1GN3 A;  5IWA B;  2KG7 B;  3EFF K;  5EK0 A;  4PA4 A;  3JAS A;  5LYJ B;  1Q81 W;  2PF4 E;  2EZP A;  2LQT A;  1Y4M A;  3K0G A;  3LDE A;  1B04 A;  1SES A;  2KG7 A;  2UUA B;  4OGQ B;  5IY5 B;  5KLV H;  3THO A;  5LYJ A;  4CC6 A;  3CCV V;  4QIW F;  4MW8 A;  3W7T A;  5E79 Z;  2X6B A;  3OR6 C;  1I5X A;  1AI5 A;  4C7U A;  3ZHR A;  4AHC A;  3FYI B;  3BA9 A;  2D2C B;  3H1L H;  3P32 A;  1OCR B;  3K5N A;  3K0D A;  3Q4H B;  3WB0 A;  3ABU A;  1Q6H A;  3KKY A;  2CE4 A;  1QVF U;  4PDM A;  4U7N A;  3Q4H A;  5FLX N;  1J95 A;  1AI6 A;  1QU7 A;  1S0V A;  3RYI B;  2FKX A;  2QEX V;  3CXC U;  2OCC B;  1AI7 A;  2K9P A;  4K8Z A;  2Q4P A;  5A2Q N;  2A7W A;  3ML0 A;  2JK5 C;  4JPR A;  3OKG A;  4JI3 B;  4JI8 O;  3K9S A;  1ENV A;  4X1Y B;  2XHB A;  2LW7 A;  2BOB C;  4YIO A;  4DR3 B;  2QWP B;  1ZSP A;  4X1Y A;  1EN4 A;  4JAA A;  3CCS V;  1ZLZ A;  1R6K A;  2LJ2 A;  2IH4 A;  1D5A A;  2CTW A;  1YEW A;  1H2N A;  1JJO A;  2CGN A;  4GX2 A;  3KG2 A;  2WA3 A;  2Q8V A;  1EBO A;  3ABT A;  2UUB B;  3ETG A;  3KZI Z;  2WA4 A;  3ABL C;  2FL4 A;  4HAM A;  1RFY A;  1ZTE A;  2QM8 A;  1Q3E A;  1RSO B;  3H1K H;  3OMI B;  2EIJ C;  2LFS A;  4UCO A;  2Q9L A;  4NB5 A;  1WPX A;  1K34 A;  1RSO A;  2RCV A;  2Z3Y A;  4LNU B;  1VEW A;  4DR4 B;  1YSC A;  2NLJ C;  3FFQ A;  1SA0 B;  2DN9 A;  3BPZ A;  1QQC A;  4LNU A;  2JVD A;  3TCU A;  4BIU A;  2P4K A;  1KBH A;  1SA0 A;  3AG3 C;  4QJF B;  1NKD A;  1ZUQ A;  5LGT A;  1W2B U;  1G8M A;  2IH3 C;  1XL6 A;  1BS3 A;  3QVN A;  1QBZ A;  1EM1 A;  1EZV H;  4X64 O;  1VQ8 V;  2ZM6 O;  3K3W A;  3CRC A;  5LMU O;  2YI8 A;  3BEH A;  5L3D A;  5LGU A;  5K1P A;  4DV3 B;  4WF9 V;  4X66 B;  1M57 B;  3OTO O;  1GM8 A;  4JF3 A;  2XND G;  4JYA O;  2RN9 A;  4QNH B;  1V54 C;  3GB7 C;  3CHX A;  1F51 A;  3GWK C;  1JCH A;  3OGC C;  4QPJ A;  1X59 A;  4NR1 A;  2Q68 A;  3AG1 C;  4YHH O;  3C3S A;  1KKD A;  1J5E O;  4LWS B;  3ZS8 C;  4GX1 A;  3JCZ A;  1R1B A;  1US6 A;  3FB5 C;  2ZE8 A;  1PL0 A;  2Y0P A;  2RQ6 A;  4FLY A;  4LWS A;  2JJ1 G;  4IIJ B;  1I94 B;  1HW7 A;  3J81 N;  3LSS A;  3ICX A;  1W0K G;  4X1K B;  4RUF A;  3SYA A; 
#chains in the Genus database with same CATH homology
 3OKG A;  1YF2 A;  1YDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...