1YDXA

Crystal structure of type-i restriction-modification system s subunit from m. genitalium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
374
structure length
374
Chain Sequence
MTPKLKLNNNINWTKRTIDSLFDLKKGEMLEKELITPEGKYEYFNGGVKNSGRTDKFNTFKNTISVIVGGSCGYVRLADKNFFCGQSNCTLNLLDPLELDLKFAYYALKSQQERIEALAFGTTIQNIRISDLKELEIPFTSNKNEQHAIANTLSVFDERLENLASLIEINRKLRDEYAHKLFSLDEAFLSHWKLEALQSQMHEITLGEIFNFKSGKYLKSEERLEEGKFPYYGAGIDNTGFVAEPNTEKDTISIISNGYSLGNIRYHEIPWFNGTGSIALEPMNNEIYVPFFYCALKYLQKDIKERMKSDDSPFLSLKLAGEIKVPYVKSFQLQRKAGKIVFLLDQKLDQYKKELSSLTVIRDTLLKKLFPDMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords type I restriction enzyme specificity protein MG438
publication title Crystal Structure of a Putative Type I Restriction-Modification S Subunit from Mycoplasma genitalium
pubmed doi rcsb
source organism Mycoplasma genitalium
total genus 109
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2004-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01420 Methylase_S Type I restriction modification DNA specificity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1120 Mainly Alpha Orthogonal Bundle Helix Hairpins Bipartite methylase S protein 1ydxA02
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA03
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA01
1YF2A 1YDXA 3OKGA
chains in the Genus database with same CATH superfamily
1U96A 2JS3A 3BA8A 3VQYA 3ZRWA 4Z2WA 5JWPA 1VMGA 2ZCEA 2Y69C 1KC8W 4IT5A 4F6EA 4DW1A 4BR6A 1YDXA 1GTOA 3T1HB 4NKGB 3UM7A 4DV2B 4DRXA 5H2FZ 2CAZC 3JD2A 4X89A 1M9NA 1JFFA 4UB6Z 1QLEC 3OMAB 1WLEA 2PUSA 4X88A 3ZN0A 2QE7G 5KAFZ 3CCQV 4LF4O 3WU2Z 2JK5C 4O2BA 4WFBV 3LDDA 3NXSA 4J7JA 4DR5O 2P22C 2DYRC 3OR6C 4PA6A 1PKXA 2IH2A 5IJ0B 1FFTB 1NH2B 3FB5C 4Z1VA 1OCOC 1ORQC 5IY5B 1NR1A 4DR4O 2E3CA 2VQFB 2ZXWC 1ZLZA 4E4EA 5KHHA 1FJGO 3GWOA 3IC7A 4TUYA 4UCTA 4KXRA 2Q7GA 4HZ3A 1MZEA 4H13B 5IJ9B 4CC6A 3OMNB 1JMKC 1QVFU 3E89A 1QVGU 3CCMV 4LWSA 1COWG 4I55B 3QO8A 5CB4A 1N32O 4R8CA 2OCHA 3M99B 4LF5O 3N2KA 4YHHB 2AZ0A 1K97A 2CH7B 5KHIA 3K79A 5LA6A 2LGQA 4JYBA 2ZM6O 4X66B 3OMIB 4MS2A 5LYJB 2PYJA 3HKBA 3FAVB 5GONA 4FJCC 1H2NA 1PNKA 2RN9A 4IYHA 4KP4A 2F66C 4DR1O 2VS0A 4GX1A 2YXHA 3BHPA 4JV5B 3VQWA 3KKYA 1NVPD 1Q90D 1XMOO 2N05A 3D3QA 4L87A 1H2MA 5IWAB 1OCZB 3CCSV 1ZSPA 4BIZA 3DC6A 3ZIAG 2YI9A 3GB7C 1SQXH 2UUAO 4MSWC 3OE7G 1AJPA 4O2AA 3CPWU 2HHHB 1K3EA 1H38A 1NTZH 4TV8A 5B3SC 4YXWG 4FM1A 3J80N 4XDJA 1QCEA 4B3MO 4FLWA 1MZFA 4TSFG 5BR8B 1Q7YW 2YDEA 1SZTA 4MTXA 4O4LA 4WBNB 4B3SB 2LO1A 2FB5A 3SYQA 2PI5A 3D36A 2OWOA 5J2UB 1AP5A 3U11A 4DV6O 4CC5A 1FXKA 2P4VA 2H94A 4QPJA 3L73H 2DMXA 3TGUH 4G2KA 3LDCA 5EIBC 4JI8B 2XNDG 5E79Z 3ZEDA 1MMMA 4LFCB 1S77D 2YIAA 2Z5UA 3JAWA 2ZR2A 4FZ1A 2Q9LA 1F4MA 4J9YB 1V9PA 1F23A 1BQZA 3W7XA 1R3IC 4FLVA 2WWWA 1MG1A 3U0ZA 1YJWV 1RSOB 3OUSA 4YIOA 1HWYA 4I50A 3CJHB 3JARB 3TXSA 1IBLO 4LF9B 1X4TA 2DOSA 5LHGA 4NB5A 1N36B 3EFFK 3B40A 3CB2A 4XBFA 4JYCA 2YUAA 3ZN1A 1NU1H 3CXHF 3BFRA 3W7UA 2ZDIC 2DWEC 3HKCB 3BY6A 1S76D 5EYPB 1P7BA 1TVKA 2DYRB 1IBKO 1I5XA 4Q20A 4W4LA 2Q68A 4QGPA 1SQVH 3OTFA 1AR5A 4DV5B 3AG2B 1Y74B 4EFBA 3ABKB 3AG3B 1XNQO 4I4TA 1HNXO 3ETEA 4LFBB 4DR7B 3N2GB 3HKDB 3ABUA 3EHBB 3K08A 1JCHA 3UQ8A 1NR7A 3S3XA 1YHQV 4MVRA 1PM9A 2P4KA 2WLJA 2YIDA 2F23A 4UVBA 1VQOV 3LNMB 2AW9A 2ADPA 4GKJB 4RO2A 1X59A 1SC5B 4A5UB 1P4RA 1HR0O 3H1KH 4G28B 4AI8A 3IFXA 2VQEO 5LP6A 1JQ0A 3JD4A 1VF6C 5CBGA 4WFEA 3DSQA 4N21A 2A9HA 4GKKB 2LW7A 3A0BZ 3X2QC 2MW2B 3CCJV 1TUEB 4I0XA 5FLXN 2UXCB 3K5LA 2CTRA 2PYLA 2ZNIA 2WLLA 2LFRA 4R6ZA 1VF5B 3E22A 4PELA 3ZJZA 3T1HO 2Q8VA 3QO5A 3RBZA 5FNVB 2EX3A 1M57B 5LHHA 2YICA 1SQPH 3OD4A 4X1YB 3WG7C 1RM1C 5H9CA 3IJ4A 4DUYO 2CE4A 2LP7A 4DO2A 1AI5A 4DYLA 2ITCC 1AQJA 2IJJA 5DECA 1H2SB 2NNUA 5JCOC 2E5LB 4H0LB 3L9DA 2V4DA 1Y4MA 4MVZA 4UCRA 3M7MX 1AI4A 5K1PA 1NTKH 1WJZA 3JCUZ 1VEWA 2MK3A 5IT9N 1Y6XA 5KAIZ 1R3JC 3RYCB 1J95A 4UCUA 1G1XB 2Q4PA 1B04A 3ETGA 5KHKA 3HR0A 3D3IA 2W0FC 5KMGA 5JQGA 4W4KA 1FFXB 5IYZB 2ZQMA 1KD1W 4O4JB 2XTAA 2BSKB 4MTGA 4YHHO 3K9SA 2X7RB 4DK1A 2PZSA 5GTHZ 4ZHQA 4X66O 3F5TA 4GX2A 3SPIA 1YTFB 4ABMA 1IX9A 2P7TC 3OT7A 4J7ZA 3CRRA 3JALB 3ASOB 2F93B 2RJZA 5ITZA 1VARA 5KHGA 5CA0A 4XDLA 5HFLA 1SF9A 2ZE5A 1Q81W 4TV9B 4JV5O 3H1JH 1N4CA 4UV8A 4X1IB 2VWKA 4EFEA 4NTYA 4J7KA 3CSXA 2CTQA 2VRZA 2ZE8A 1QBZA 1XQ8A 1WP8A 1SA0B 4EKWA 1F4NA 2ODMA 2CTWA 2UXBO 5EC1C 1Q8IA 4GUNA 3B77A 2B1IA 2X6BA 4PV1B 2HHHO 2K1EA 4CZZA 4JYYA 4K3AA 1I0HA 4YJ3A 3RVZA 1EZVH 1Y67A 1NT2B 3K5MA 1DF5A 4FLZA 2L6LA 4U3FH 4MT8A 4X1KA 2WLIA 5DM6V 1RPOA 1N33B 4MVUA 4B3SO 5LOVA 1EZJA 1K7DA 4F6RB 3CEIA 1XREA 1JJ2U 2Y48A 1SQFA 3ZBHA 1JVMA 1M1KW 2IJIA 4JAUA 1GN3A 2ZE7A 1HP8A 1WPBA 5LXTA 3ABTA 4JI1O 2G38A 3X2QB 4PD4F 4LFCO 4X64B 1IDSA 1KQSU 5B5EZ 1OCZC 3F7YC 3O9OA 4HNAA 3CCLV 5GTIZ 3F7VC 2JS5A 5L3GA 5F2VO 3I56V 3NR7A 2JGUA 4U3JB 2ZIMA 2LGWA 1TUBA 1YF2A 4BWAA 3K3WA 1VIBA 4I9QA 2JJ1G 3ABMB 3ZRSA 4FM2A 4LF9O 1S5LZ 3G80A 4D6TH 3L74H 3H1HH 4EB6B 1YVWA 1Q43A 1H2KA 1M93A 3CRQA 3ZRVA 1E1RG 1ZL8A 2ZIOA 1WA8A 3JD0A 1OHHG 2P5OA 5C8YB 1NS1A 4DW0A 2OT5A 3E83A 4DV5O 3GWKC 2YI8A 1ZTEA 1YI2V 2OTLV 4DV7O 4YIPA 4ZI7B 4LF7B 1R1BA 1SZXA 4B3RB 1XDCA 5LBQA 2JGDA 1VQPV 2KG7B 3JASB 2IH1C 5IYBO 1DK1A 2HP8A 1CXZB 4GKJO 5BXZA 1G6UA 3HPLC 4JI5B 3OGIB 1ZAUA 3MHSC 4J10A 3K57A 4GX0A 3M8AA 1M5IA 4P2ZA 1JOYA 3B8NA 4RAIA 2Q73A 3Q4HA 5L3CA 3ZHUA 4GT1A 5JJNB 1FKAO 2XAJA 2DWDC 2UUCB 4P9OA 4CH3A 1EM1A 3RYFB 4IHJB 3S3WA 1FD9A 5KX5A 3HKDA 2UXCO 4O4HA 4MVMA 1WP7A 1I94B 2IU3A 3J7AU 2C2AA 2QWOB 2IBTA 2IW5A 5H6QA 3I5DA 3AG2C 3BEHA 1K5QA 3HKEA 3ZHRA 3LSSA 4ZBMA 3ABKC 1GN4A 1IBMB 3AG3C 4IIJA 4ZOLA 2NP7A 3F5WC 1H2GA 4PA3A 3P30A 3HB3B 2F95B 4XDKA 1ZUQA 2DYSC 4TQFA 3RYIA 4D7TA 2HVKC 1Y76B 3CD6V 1ZX3A 5DEDA 5B1OA 5JH7A 3DTUB 5CA1A 4QE7A 1L0NH 3ICXA 4LNUA 2Z3YA 4KHPB 3SGIA 3G6BA 1ROPA 3BCCH 2BTQA 4Q6GA 1K8AW 3A2FA 3OEEG 3VOUA 4RQFA 4PDMA 4I9WA 5KLVH 3ZMZA 4GCZA 1S72V 1B06A 5JVDB 4YJ2A 2CUGA 3QG5A 1FXVA 1A32A 1JPXA 5EBWC 4DUZO 1NTMH 1G4YB 1BL8A 5KA6A 4UB8Z 5J2TA 4DV1B 1M57C 4QNHB 2WPDG 2RMKB 4B3TB 2JEUA 5CBFA 3SYAA 3QNEA 2RQ6A 1ZWIC 2OIEA 2UXDB 1ENVA 3P32A 2AHZA 2ZT9B 3BABA 3K0DA 5EBLC 1AR1B 4C7UA 4JGSA 1YXBA 1MNGA 1P7GA 3CRAA 3DXRB 4B7KA 1VQ8V 2ARHA 4OX9B 1KUQA 2PGGA 4LBEC 4MTFA 2K9PA 2IH4A 4DR2B 2M7WA 1XMQB 1O9HA 4B08A 2GDSA 3K5NA 1S0VA 2Q7HA 2Q69A 4FFBB 2FL4A 4AQYB 3K9AA 4JTDB 5D5PA 4LR3A 3A8TA 3ZHTA 2QKCA 2EINC 3B8MA 2OYQA 4LF6B 2GUZB 3JATB 1AQIA 1GM7A 5EZYB 1KKCA 4O4IA 2KKWA 1SERA 1E1QG 3OAAG 2QWNB 2Q6AA 5LMUB 3RYHA 1Q3EA 5LGNA 2QM4A 2XT9A 3O65A 4NTWA 1K4CC 2QJ1A 1Q6HA 3ETQA 3WB0A 2BE3A 5KUMA 3D36C 2E74B 2O57A 3KZIZ 5FL7G 1HNZO 5B1BB 1KYOF 1YJNV 5EBMC 1XEQA 3ASOC 1GM9A 4D7SA 1WB8A 3UCSC 4J41A 1PP9H 1BHAA 3FB7C 2L35A 4LH7A 2HG5C 4X64O 3SJAC 3ZRWB 2X6AA 3G67A 2UXNA 2ITDC 3C90A 3JAKA 2DQ0A 5HFMA 1M90W 3P3PA 4ZKIA 3ABLB 2Y4TA 4I5SA 3FD9A 4DV4B 1US6A 1XHZA 2GV9A 3E2EA 1QR8A 2HKOA 2DYSB 5L3FA 1JFFB 3RGBA 4K8XA 1UPGA 4FFKA 2IJKA 4DR3B 4JI4B 4X20A 1GAXA 4FLUA 4O2BB 2ATKC 2GBOA 2IBSA 4JI0B 1VF6A 3K06A 4K0KB 2XUMA 2M6YA 1W59A 1S5HC 4DXWA 5LHIA 1K4DC 3W7SA 3JCZA 4K35A 1BHBA 2Y0IA 3OGCC 4B3RO 4TUYB 3EXAA 5K1XA 1K33A 1LR1A 3ZRXA 5FPOA 3ZX6A 5A9GA 5AG2A 3BAAA 2Q0OC 1P49A 1EN5A 2YS8A 3SJQC 2ZD9A 1RFYA 4LWSB 5CB4B 3ASNC 1G38A 3L72H 1VQKV 2KB1A 1PPJH 1O9GA 1XBLA 1L0LH 1UJWB 3K0GA 3E8GA 3IC9A 1F51A 3N2KB 4DV2O 3ABMC 3H9VA 3L71H 4DR5B 5C8YA 2F1MA 1QHTA 5JCOA 1LNQA 5LGTA 2HR3A 4NXNB 1H8EG 3R65A 3HKBB 3FYIB 1I94O 2R70A 1FJGB 5GONB 4JYAB 3CE2A 2UUBB 1WPXA 3QF7A 1IXBA 2KG7A 1XNRB 4FM0A 2VQFO 4JTCB 3G4SV 1NVPB 1JR9A 1QLNA 1D5NA 1N32B 1WN7A 2EIMC 3FB6C 3RWRD 3THOA 3CC4V 4BIUA 5E1AC 4KHPO 2AXTZ 1KU9A 3CC2V 2FMLA 4O2AB 2YEVB 2EINB 1LUWA 3SPJA 3K58A 4QE9A 2E75B 4TV8B 5KHJA 2W0XA 2IH3C 3TETA 3E8BA 3D8CA 5IDJA 1FS0G 2P90A 2HEPA 5IJ0A 5KA5A 2XHBA 1NBMG 2ILMA 1KECA 1MOFA 1XUQA 4O4LB 1Q5OA 2Q7EA 3ZMSA 4DR1B 1NH2D 5LL6Y 3RVYA 3BRCA 3SYPA 4WFAV 2A7WA 1UFIA 1BE3H 2AGAA 1GH6A 2A06H 3QO7A 2XAQA 1BS3A 1FXKB 5IJ9A 4I55A 1IURA 1KB9F 2QTSA 2D3OW 5IWAO 2OTJV 5L3BA 3OR7C 3JAWB 4UCVA 4IGGA 1VQNV 1AVMA 1PNMA 3DGEA 2B9ZA 2HJDA 3SYCA 3OTOB 2UXDO 2CH7A 1M56B 1T5EA 1CEZA 4FIPC 1XL6A 4UV9A 1GK9A 2CTPA 1VQ7V 2JJ2G 1PL0A 4I50B 5LYJA 2QKAA 3CCEV 2Z0AA 2W6IG 1FYJA 4ICGA 3FAVA 4OX9O 3KG2A 1TAEA 5BR8O 2GHYA 4QJFB 3J81N 1AB3A 1VQ6V 1GMGA 3CS5A 2EILC 4CS4A 4BIOA 1L8DA 1XMQO 1TVKB 1DTOA 3AK3A 4LCUC 1NKDA 4X62B 2QSAA 2JEXA 3E8HA 2ETNA 4AQYO 5L3EA 1AILA 3BA9A 1YJ9V 3JSNA 1TA8A 4TWKA 2ADMA 2QEXV 4I4TB 4WFGA 2CGNA 2B5UA 3L70H 3SPGA 4JI8O 4RUEA 4JZ2A 4PI2A 3OKGA 3ZHQA 2WLMA 1MSWD 3IGAC 1BSMA 2R9RB 2JG3A 5CBHA 3C3TA 2QWQB 2ADQB 2HFEC 3JD3A 2QR4A 2QWRB 1N34B 3A0HZ 4IL6Z 4PHZA 1IBLB 3ASNB 1MABG 4E2LA 1I08A 1YITV 2EZPA 3CWBH 1N0JA 2W6JG 4PJ0Z 1IXMA 4WBNA 3T4ZA 5JJJB 3JD1A 3KCXA 3FFQA 2UXXA 1EN6A 1N36O 4UCOA 4LF8B 4FFBA 5J2UA 5D5QA 1IVSA 4CS2A 3SR2C 4JI3B 3JAMN 1HNXB 1OJHA 3LSQA 4I0XB 2GUZA 3MHHC 2IM9A 1SQGA 5J9PC 4J9ZB 4UFZA 2WLLB 2V7QG 1L1FA 3E22B 2IU0A 1R6TA 3JSLA 2CDYA 4DV4O 4MVOA 4LFBO 4DR7O 3ZS8C 4FK5C 3BVOA 3ZHVA 2N74A 2EIMB 3ZHSA 3QTCA 3VBBA 4KL1A 3ZMVA 2GSMB 2ZKOA 5TISZ 1RSOA 1V55C 3CRCA 3AEIA 4JI4O 3CHXA 4ASUG 2WLHA 2Y0PA 2YSUB 3CJHA 2YIBA 3JARA 3SJBC 1HW7A 4JI0O 1V54B 4K0KO 4TOIA 3E86A 3TCUA 2YIBD 3AG1B 2BOBC 4CH4A 3LDEA 2PF4E 3MD0A 1BT8A 4RUFA 1URFA 3LUTB 4HYOA 4UVAA 5B1BC 3G6EV 4UUJC 3HKCA 4DR6B 5EYPA 1SQQH 5KUKA 4P9PA 4YY3B 3VQVA 4GKKO 2UU9B 2OIGA 1JX9A 4J42A 1Y74A 2QA4V 4TT3G 3N2GA 1VQ4V 4MW8A 3ABLC 2X0LA 5KMGB 1D2DA 4JI6B 1EBOA 2HVJC 4H37A 5B1AB 4TQDA 5JQGB 1GM8A 1AROP 5CA3A 5B66Z 1XI1A 3MAQA 3OW2U 2R9AA 4QIWF 4DUYB 3PJSK 4NXMB 3W7TA 4R7CA 4F4LA 4PDVA 5BMVB 1AP6A 4UVCA 4OPHA 4NXNO 2P67A 4ZHQB 5LMNB 4DK0A 2FYUH 2DJVA 4UCSA 3B4SA 2LJ2A 4JYAO 2GTSA 2UUBO 2OCCB 1H2LA 3LSUA 2PTMA 2E5LO 1XNRO 3STLC 5ITZB 4U7NA 1S5JA 5CA0B 2JVDA 4JI2B 1FPOA 3WFVA 4OPAA 1I7FA 2F4VB 3WB2A 1VQ5V 2IH5A 1K34A 2EILB 4MVSA 4BW5A 2DN9A 2ZR3A 5FNVA 1Q6IA 2XAFA 1KP2A 1PD3A 3H01A 2QKSA 1VQMV 1OCRC 4X1YA 1W2BU 3WB1A 3CC7V 1F7YA 2R72A 4JTAB 1PV0A 4YJ3B 2QTOA 1NZ6A 3ZMUA 1SRYA 4JF3A 2WA3A 1OCCC 1JA8A 5IE9A 1EN4A 2RNBA 4X1KB 2WLIB 1THZA 1SKVA 1CPYA 2P06A 3K5OA 5H6RA 4CH6A 5LOVB 2RCVA 3APOA 5FPRA 1Q82W 4DV3B 3T1YB 4H33A 2DW4A 1KMIZ 1R6NA 3RYCA 5LXTB 1QNMA 2UXBB 1YZBA 1DF4A 4PI0A 2NR5A 2NLJC 1XHXA 1P84F 3H1LH 2V1DA 3CX5F 3JYCA 1FFXA 1DLBA 2YEVA 1NJIW 4DV0B 4H44B 2GTAA 4HNAB 3GVMA 2P6JA 1AJNA 1Q6UA 5IYZA 4O4JA 2BSKA 4FVMA 3SPCA 3OTOO 1Z5VA 3RW0A 2Q67A 5EIBD 1TUBB 1VP7A 1VF7A 3APQA 3CMEV 3PN1A 2WLKA 4KUMA 3CYOA 1N8RW 1FAFA 1OZ0A 4RWUA 3UT5B 2EULA 3FB8C 4WFHA 4N23A 4CBCA 5EC2C 1J5EB 1YTFD 1YSCA 4JAAA 3QVNA 3A0RA 4MW3A 1V55B 2BCCH 1N33O 3JALA 1Y66A 2EIKC 1ZL8B 1BZKA 2WA4A 1BCCH 1WA8B 4FPPA 1QR9A 4K8ZA 3W7WA 2KSDA 4TV9A 4JI1B 1R6KA 4X62O 4X1IA 1R3KC 2ZDIA 3P3NA 1VQLV 4I7ZB 5BY1A 1LUVA 1B6QA 1FXKC 2YXLA 3U10A 4FMTA 1SA0A 3EVKA 2JGDB 2Y69B 1TGOA 1B3QA 3H1IH 2XOKG 4CH5A 1N34O 2PY5A 4ZIBA 3ML0A 4QPKA 1M56C 1K92A 1QLEB 4EEQA 4FLTA 5IYCO 1YIJV 4WFFA 2F43G 4BAYA 1XL4A 4HAMA 4DRXB 3BPZA 2X6CA 1N0NA 4F6RA 4PDLA 3IAYA 2R9IA 4NR1A 3Q4HB 4LFAB 4X65B 1OV9A 4NYKA 4LF8O 1HNWB 4JPRA 1HDJA 4HBNA 1OCOB 4DV7B 4JI3O 2ZXWB 4BW9A 5KX5B 1GO3F 4JI7B 4FLXA 4O4HB 4AILC 1GKFA 3C3SA 3E35A 2YXYA 4J80A 3CP1A 3DC5A 1EFRG 3K03A 4GLXA 2YC0A 3HKEB 4LF7O 2Y4UA 1R3LC 2AHYA 2JRIA 1Z5WA 2QDOA 4IIJB 4ZOLB 2WSSG 3K59A 3FX7A 2XASA 1KBHA 3RYIB 4U3JA 4CS3A 4JZGA 3L75H 5C93A 2VWJA 5JH7B 3SYOA 5CA1B 4LNUB 4JI5O 2CK3G 1WNSA 1R73A 2ZE6A 1OCRB 1D5AA 2LW1A 2HLDG 4EB6A 2BTQB 3G71V 2EIJC 2KQXA 4LF4B 5IYDO 3TJTA 3AG4C 2A0LA 1BQ0A 1H8HG 4DR6O 1QQCA 2CGOA 4U7OA 5LP6C 1OCCB 1SQBH 4UXNA 2QM7A 2DE0X 5LA6B 4YY3O 2UUCO 4KFMA 3AK2A 2UU9O 5CMUA 1KP3A 2Q0AA 1U97A 4ZI7A 4DR4B 4YJ2B 3ETDA 1S3JA 4JASA 3FKSG 2EJRA 3UKMA 4JI6O 3E8FA 4PA4A 5A2QN 4NVPA 3JASA 1IBMO 1NQTA 3FYEB 5DN6G 5J2TB 1WB7A 1K5SA 2WAMA 1BGYH 3MDSA 4NXMO 1E79G 4FZ0A 1QU7A 3SDLA 3CRMA 2IJHA 4LF5B 1CP9A 4NTXA 2A3QA 5B3SB 5LMNO 1KKDA 2AZ2A 2XAHA 3AG7A 1MSDA 1V54C 3CCRV 3B09A 3RN4A 3AG1C 4LP8A 1JJOA 3B2EE 1SETA 3RYFA 4IHJA 2ZM6B 1M4UA 3VQXA 4JI2O 1K9MW 3UO3A 1W0KG 3RFRA 3T4DA 2F4VO 3SPHA 3CCUV 4DUZB 4MTOA 3ZCCA 1AI6A 5L3DA 2EIKB 4X8AA 4IYIA 4GZRB 5LGUA 1YEWA 1WAZA 2QGNA 2QM8A 4OXSA 4GYCB 1XMOB 1G8MA 2LQTA 2JIZG 1Y76A 5B1AC 5BMVA 4DV1O 2FKXA 5EK0A 4L8JA 2D2CB 4O4IB 4PA9A 5BZBA 2UUAB 1GN2A 2ZINA 4B3TO 2NP6A 3R66A 1RPRA 4WCEV 3RYHB 1Z2GA 3TK1A 5IY5C 2PI4A 2FTKA 4B7EA 3I55V 1FXHA 4B3MB 4DV3O 3KCYA 3T1YO 4OGQB 2IBZH 2OCCC 3UO2A 1W0JG 4RQEA 2EBOA 5JVDA 4GX5A 4MVQA 4X9QA 2HJFC 3CCVV 3ZMTA 5GW7A 4AHCA 2Q5ZA 4J11A 2N04A 4DV6B 2H3OA 5JJEB 2BTOA 4DR2O 1NI8A 3LNNA 4DV0O 1I5YA 3STZC 2H8PC 4P30A 3JAKB 3K04A 4PDRA 1YCIA 1BMFG 1MA1A 4LF6O 1SS3A 2QWPB 5B1NA 2JDIG 4Z1MG 4JAVA 3OUFA 1J5EO 4LH6A 5LMUO 1HNZB 4WF9V 4X20B 4G27B 1VQ9V 2EJ7A 1GN6A 1XOUA 2A79B 2B1GA 3DXRA 2NN4A 2ZNJA 2EIJB 3AG4B 4FLYA 3T2MA 5LP6B 1PNLA 1IBKB 1XILA 2RDCA 3CMAV 1XNQB 3JATA 3SJCC 1PL4A 3UT5A 5EZYA 1GRJA 1Q86W 2EZOA 2WLNA 4LC1A 3WG7B 4R50A 3TXQA 1AI7A 1RP3B 2XAGA 3CXCU 1RM1B 2DQ3A 1AJQA 3OM3B 4PA7A 1IZ3A 5H5NA 5CN0A 2BOCC 1DGSA 1K73W 4LFAO 3OFNG 4X65O 1HNWO 4DR3O 3RT3C 1HR0B 3T1CA 3AK1A 2LFSA 3OEHG 2VQEB 1SESA 4JI7O 3N27A 1AR4A 2E76B
chains in the Genus database with same CATH topology
1YF2A 1YDXA 3OKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF2 A;  1YDX A;  3OKG A; 
#chains in the Genus database with same CATH topology
 1U96 A;  2JS3 A;  3BA8 A;  3VQY A;  3ZRW A;  4Z2W A;  5JWP A;  1VMG A;  2ZCE A;  2Y69 C;  1KC8 W;  4IT5 A;  4F6E A;  4DW1 A;  4BR6 A;  1YDX A;  1GTO A;  3T1H B;  4NKG B;  3UM7 A;  4DV2 B;  4DRX A;  5H2F Z;  2CAZ C;  3JD2 A;  4X89 A;  1M9N A;  1JFF A;  4UB6 Z;  1QLE C;  3OMA B;  1WLE A;  2PUS A;  4X88 A;  3ZN0 A;  2QE7 G;  5KAF Z;  3CCQ V;  4LF4 O;  3WU2 Z;  2JK5 C;  4O2B A;  4WFB V;  3LDD A;  3NXS A;  4J7J A;  4DR5 O;  2P22 C;  2DYR C;  3OR6 C;  4PA6 A;  1PKX A;  2IH2 A;  5IJ0 B;  1FFT B;  1NH2 B;  3FB5 C;  4Z1V A;  1OCO C;  1ORQ C;  5IY5 B;  1NR1 A;  4DR4 O;  2E3C A;  2VQF B;  2ZXW C;  1ZLZ A;  4E4E A;  5KHH A;  1FJG O;  3GWO A;  3IC7 A;  4TUY A;  4UCT A;  4KXR A;  2Q7G A;  4HZ3 A;  1MZE A;  4H13 B;  5IJ9 B;  4CC6 A;  3OMN B;  1JMK C;  1QVF U;  3E89 A;  1QVG U;  3CCM V;  4LWS A;  1COW G;  4I55 B;  3QO8 A;  5CB4 A;  1N32 O;  4R8C A;  2OCH A;  3M99 B;  4LF5 O;  3N2K A;  4YHH B;  2AZ0 A;  1K97 A;  2CH7 B;  5KHI A;  3K79 A;  5LA6 A;  2LGQ A;  4JYB A;  2ZM6 O;  4X66 B;  3OMI B;  4MS2 A;  5LYJ B;  2PYJ A;  3HKB A;  3FAV B;  5GON A;  4FJC C;  1H2N A;  1PNK A;  2RN9 A;  4IYH A;  4KP4 A;  2F66 C;  4DR1 O;  2VS0 A;  4GX1 A;  2YXH A;  3BHP A;  4JV5 B;  3VQW A;  3KKY A;  1NVP D;  1Q90 D;  1XMO O;  2N05 A;  3D3Q A;  4L87 A;  1H2M A;  5IWA B;  1OCZ B;  3CCS V;  1ZSP A;  4BIZ A;  3DC6 A;  3ZIA G;  2YI9 A;  3GB7 C;  1SQX H;  2UUA O;  4MSW C;  3OE7 G;  1AJP A;  4O2A A;  3CPW U;  2HHH B;  1K3E A;  1H38 A;  1NTZ H;  4TV8 A;  5B3S C;  4YXW G;  4FM1 A;  3J80 N;  4XDJ A;  1QCE A;  4B3M O;  4FLW A;  1MZF A;  4TSF G;  5BR8 B;  1Q7Y W;  2YDE A;  1SZT A;  4MTX A;  4O4L A;  4WBN B;  4B3S B;  2LO1 A;  2FB5 A;  3SYQ A;  2PI5 A;  3D36 A;  2OWO A;  5J2U B;  1AP5 A;  3U11 A;  4DV6 O;  4CC5 A;  1FXK A;  2P4V A;  2H94 A;  4QPJ A;  3L73 H;  2DMX A;  3TGU H;  4G2K A;  3LDC A;  5EIB C;  4JI8 B;  2XND G;  5E79 Z;  3ZED A;  1MMM A;  4LFC B;  1S77 D;  2YIA A;  2Z5U A;  3JAW A;  2ZR2 A;  4FZ1 A;  2Q9L A;  1F4M A;  4J9Y B;  1V9P A;  1F23 A;  1BQZ A;  3W7X A;  1R3I C;  4FLV A;  2WWW A;  1MG1 A;  3U0Z A;  1YJW V;  1RSO B;  3OUS A;  4YIO A;  1HWY A;  4I50 A;  3CJH B;  3JAR B;  3TXS A;  1IBL O;  4LF9 B;  1X4T A;  2DOS A;  5LHG A;  4NB5 A;  1N36 B;  3EFF K;  3B40 A;  3CB2 A;  4XBF A;  4JYC A;  2YUA A;  3ZN1 A;  1NU1 H;  3CXH F;  3BFR A;  3W7U A;  2ZDI C;  2DWE C;  3HKC B;  3BY6 A;  1S76 D;  5EYP B;  1P7B A;  1TVK A;  2DYR B;  1IBK O;  1I5X A;  4Q20 A;  4W4L A;  2Q68 A;  4QGP A;  1SQV H;  3OTF A;  1AR5 A;  4DV5 B;  3AG2 B;  1Y74 B;  4EFB A;  3ABK B;  3AG3 B;  1XNQ O;  4I4T A;  1HNX O;  3ETE A;  4LFB B;  4DR7 B;  3N2G B;  3HKD B;  3ABU A;  3EHB B;  3K08 A;  1JCH A;  3UQ8 A;  1NR7 A;  3S3X A;  1YHQ V;  4MVR A;  1PM9 A;  2P4K A;  2WLJ A;  2YID A;  2F23 A;  4UVB A;  1VQO V;  3LNM B;  2AW9 A;  2ADP A;  4GKJ B;  4RO2 A;  1X59 A;  1SC5 B;  4A5U B;  1P4R A;  1HR0 O;  3H1K H;  4G28 B;  4AI8 A;  3IFX A;  2VQE O;  5LP6 A;  1JQ0 A;  3JD4 A;  1VF6 C;  5CBG A;  4WFE A;  3DSQ A;  4N21 A;  2A9H A;  4GKK B;  2LW7 A;  3A0B Z;  3X2Q C;  2MW2 B;  3CCJ V;  1TUE B;  4I0X A;  5FLX N;  2UXC B;  3K5L A;  2CTR A;  2PYL A;  2ZNI A;  2WLL A;  2LFR A;  4R6Z A;  1VF5 B;  3E22 A;  4PEL A;  3ZJZ A;  3T1H O;  2Q8V A;  3QO5 A;  3RBZ A;  5FNV B;  2EX3 A;  1M57 B;  5LHH A;  2YIC A;  1SQP H;  3OD4 A;  4X1Y B;  3WG7 C;  1RM1 C;  5H9C A;  3IJ4 A;  4DUY O;  2CE4 A;  2LP7 A;  4DO2 A;  1AI5 A;  4DYL A;  2ITC C;  1AQJ A;  2IJJ A;  5DEC A;  1H2S B;  2NNU A;  5JCO C;  2E5L B;  4H0L B;  3L9D A;  2V4D A;  1Y4M A;  4MVZ A;  4UCR A;  3M7M X;  1AI4 A;  5K1P A;  1NTK H;  1WJZ A;  3JCU Z;  1VEW A;  2MK3 A;  5IT9 N;  1Y6X A;  5KAI Z;  1R3J C;  3RYC B;  1J95 A;  4UCU A;  1G1X B;  2Q4P A;  1B04 A;  3ETG A;  5KHK A;  3HR0 A;  3D3I A;  2W0F C;  5KMG A;  5JQG A;  4W4K A;  1FFX B;  5IYZ B;  2ZQM A;  1KD1 W;  4O4J B;  2XTA A;  2BSK B;  4MTG A;  4YHH O;  3K9S A;  2X7R B;  4DK1 A;  2PZS A;  5GTH Z;  4ZHQ A;  4X66 O;  3F5T A;  4GX2 A;  3SPI A;  1YTF B;  4ABM A;  1IX9 A;  2P7T C;  3OT7 A;  4J7Z A;  3CRR A;  3JAL B;  3ASO B;  2F93 B;  2RJZ A;  5ITZ A;  1VAR A;  5KHG A;  5CA0 A;  4XDL A;  5HFL A;  1SF9 A;  2ZE5 A;  1Q81 W;  4TV9 B;  4JV5 O;  3H1J H;  1N4C A;  4UV8 A;  4X1I B;  2VWK A;  4EFE A;  4NTY A;  4J7K A;  3CSX A;  2CTQ A;  2VRZ A;  2ZE8 A;  1QBZ A;  1XQ8 A;  1WP8 A;  1SA0 B;  4EKW A;  1F4N A;  2ODM A;  2CTW A;  2UXB O;  5EC1 C;  1Q8I A;  4GUN A;  3B77 A;  2B1I A;  2X6B A;  4PV1 B;  2HHH O;  2K1E A;  4CZZ A;  4JYY A;  4K3A A;  1I0H A;  4YJ3 A;  3RVZ A;  1EZV H;  1Y67 A;  1NT2 B;  3K5M A;  1DF5 A;  4FLZ A;  2L6L A;  4U3F H;  4MT8 A;  4X1K A;  2WLI A;  5DM6 V;  1RPO A;  1N33 B;  4MVU A;  4B3S O;  5LOV A;  1EZJ A;  1K7D A;  4F6R B;  3CEI A;  1XRE A;  1JJ2 U;  2Y48 A;  1SQF A;  3ZBH A;  1JVM A;  1M1K W;  2IJI A;  4JAU A;  1GN3 A;  2ZE7 A;  1HP8 A;  1WPB A;  5LXT A;  3ABT A;  4JI1 O;  2G38 A;  3X2Q B;  4PD4 F;  4LFC O;  4X64 B;  1IDS A;  1KQS U;  5B5E Z;  1OCZ C;  3F7Y C;  3O9O A;  4HNA A;  3CCL V;  5GTI Z;  3F7V C;  2JS5 A;  5L3G A;  5F2V O;  3I56 V;  3NR7 A;  2JGU A;  4U3J B;  2ZIM A;  2LGW A;  1TUB A;  1YF2 A;  4BWA A;  3K3W A;  1VIB A;  4I9Q A;  2JJ1 G;  3ABM B;  3ZRS A;  4FM2 A;  4LF9 O;  1S5L Z;  3G80 A;  4D6T H;  3L74 H;  3H1H H;  4EB6 B;  1YVW A;  1Q43 A;  1H2K A;  1M93 A;  3CRQ A;  3ZRV A;  1E1R G;  1ZL8 A;  2ZIO A;  1WA8 A;  3JD0 A;  1OHH G;  2P5O A;  5C8Y B;  1NS1 A;  4DW0 A;  2OT5 A;  3E83 A;  4DV5 O;  3GWK C;  2YI8 A;  1ZTE A;  1YI2 V;  2OTL V;  4DV7 O;  4YIP A;  4ZI7 B;  4LF7 B;  1R1B A;  1SZX A;  4B3R B;  1XDC A;  5LBQ A;  2JGD A;  1VQP V;  2KG7 B;  3JAS B;  2IH1 C;  5IYB O;  1DK1 A;  2HP8 A;  1CXZ B;  4GKJ O;  5BXZ A;  1G6U A;  3HPL C;  4JI5 B;  3OGI B;  1ZAU A;  3MHS C;  4J10 A;  3K57 A;  4GX0 A;  3M8A A;  1M5I A;  4P2Z A;  1JOY A;  3B8N A;  4RAI A;  2Q73 A;  3Q4H A;  5L3C A;  3ZHU A;  4GT1 A;  5JJN B;  1FKA O;  2XAJ A;  2DWD C;  2UUC B;  4P9O A;  4CH3 A;  1EM1 A;  3RYF B;  4IHJ B;  3S3W A;  1FD9 A;  5KX5 A;  3HKD A;  2UXC O;  4O4H A;  4MVM A;  1WP7 A;  1I94 B;  2IU3 A;  3J7A U;  2C2A A;  2QWO B;  2IBT A;  2IW5 A;  5H6Q A;  3I5D A;  3AG2 C;  3BEH A;  1K5Q A;  3HKE A;  3ZHR A;  3LSS A;  4ZBM A;  3ABK C;  1GN4 A;  1IBM B;  3AG3 C;  4IIJ A;  4ZOL A;  2NP7 A;  3F5W C;  1H2G A;  4PA3 A;  3P30 A;  3HB3 B;  2F95 B;  4XDK A;  1ZUQ A;  2DYS C;  4TQF A;  3RYI A;  4D7T A;  2HVK C;  1Y76 B;  3CD6 V;  1ZX3 A;  5DED A;  5B1O A;  5JH7 A;  3DTU B;  5CA1 A;  4QE7 A;  1L0N H;  3ICX A;  4LNU A;  2Z3Y A;  4KHP B;  3SGI A;  3G6B A;  1ROP A;  3BCC H;  2BTQ A;  4Q6G A;  1K8A W;  3A2F A;  3OEE G;  3VOU A;  4RQF A;  4PDM A;  4I9W A;  5KLV H;  3ZMZ A;  4GCZ A;  1S72 V;  1B06 A;  5JVD B;  4YJ2 A;  2CUG A;  3QG5 A;  1FXV A;  1A32 A;  1JPX A;  5EBW C;  4DUZ O;  1NTM H;  1G4Y B;  1BL8 A;  5KA6 A;  4UB8 Z;  5J2T A;  4DV1 B;  1M57 C;  4QNH B;  2WPD G;  2RMK B;  4B3T B;  2JEU A;  5CBF A;  3SYA A;  3QNE A;  2RQ6 A;  1ZWI C;  2OIE A;  2UXD B;  1ENV A;  3P32 A;  2AHZ A;  2ZT9 B;  3BAB A;  3K0D A;  5EBL C;  1AR1 B;  4C7U A;  4JGS A;  1YXB A;  1MNG A;  1P7G A;  3CRA A;  3DXR B;  4B7K A;  1VQ8 V;  2ARH A;  4OX9 B;  1KUQ A;  2PGG A;  4LBE C;  4MTF A;  2K9P A;  2IH4 A;  4DR2 B;  2M7W A;  1XMQ B;  1O9H A;  4B08 A;  2GDS A;  3K5N A;  1S0V A;  2Q7H A;  2Q69 A;  4FFB B;  2FL4 A;  4AQY B;  3K9A A;  4JTD B;  5D5P A;  4LR3 A;  3A8T A;  3ZHT A;  2QKC A;  2EIN C;  3B8M A;  2OYQ A;  4LF6 B;  2GUZ B;  3JAT B;  1AQI A;  1GM7 A;  5EZY B;  1KKC A;  4O4I A;  2KKW A;  1SER A;  1E1Q G;  3OAA G;  2QWN B;  2Q6A A;  5LMU B;  3RYH A;  1Q3E A;  5LGN A;  2QM4 A;  2XT9 A;  3O65 A;  4NTW A;  1K4C C;  2QJ1 A;  1Q6H A;  3ETQ A;  3WB0 A;  2BE3 A;  5KUM A;  3D36 C;  2E74 B;  2O57 A;  3KZI Z;  5FL7 G;  1HNZ O;  5B1B B;  1KYO F;  1YJN V;  5EBM C;  1XEQ A;  3ASO C;  1GM9 A;  4D7S A;  1WB8 A;  3UCS C;  4J41 A;  1PP9 H;  1BHA A;  3FB7 C;  2L35 A;  4LH7 A;  2HG5 C;  4X64 O;  3SJA C;  3ZRW B;  2X6A A;  3G67 A;  2UXN A;  2ITD C;  3C90 A;  3JAK A;  2DQ0 A;  5HFM A;  1M90 W;  3P3P A;  4ZKI A;  3ABL B;  2Y4T A;  4I5S A;  3FD9 A;  4DV4 B;  1US6 A;  1XHZ A;  2GV9 A;  3E2E A;  1QR8 A;  2HKO A;  2DYS B;  5L3F A;  1JFF B;  3RGB A;  4K8X A;  1UPG A;  4FFK A;  2IJK A;  4DR3 B;  4JI4 B;  4X20 A;  1GAX A;  4FLU A;  4O2B B;  2ATK C;  2GBO A;  2IBS A;  4JI0 B;  1VF6 A;  3K06 A;  4K0K B;  2XUM A;  2M6Y A;  1W59 A;  1S5H C;  4DXW A;  5LHI A;  1K4D C;  3W7S A;  3JCZ A;  4K35 A;  1BHB A;  2Y0I A;  3OGC C;  4B3R O;  4TUY B;  3EXA A;  5K1X A;  1K33 A;  1LR1 A;  3ZRX A;  5FPO A;  3ZX6 A;  5A9G A;  5AG2 A;  3BAA A;  2Q0O C;  1P49 A;  1EN5 A;  2YS8 A;  3SJQ C;  2ZD9 A;  1RFY A;  4LWS B;  5CB4 B;  3ASN C;  1G38 A;  3L72 H;  1VQK V;  2KB1 A;  1PPJ H;  1O9G A;  1XBL A;  1L0L H;  1UJW B;  3K0G A;  3E8G A;  3IC9 A;  1F51 A;  3N2K B;  4DV2 O;  3ABM C;  3H9V A;  3L71 H;  4DR5 B;  5C8Y A;  2F1M A;  1QHT A;  5JCO A;  1LNQ A;  5LGT A;  2HR3 A;  4NXN B;  1H8E G;  3R65 A;  3HKB B;  3FYI B;  1I94 O;  2R70 A;  1FJG B;  5GON B;  4JYA B;  3CE2 A;  2UUB B;  1WPX A;  3QF7 A;  1IXB A;  2KG7 A;  1XNR B;  4FM0 A;  2VQF O;  4JTC B;  3G4S V;  1NVP B;  1JR9 A;  1QLN A;  1D5N A;  1N32 B;  1WN7 A;  2EIM C;  3FB6 C;  3RWR D;  3THO A;  3CC4 V;  4BIU A;  5E1A C;  4KHP O;  2AXT Z;  1KU9 A;  3CC2 V;  2FML A;  4O2A B;  2YEV B;  2EIN B;  1LUW A;  3SPJ A;  3K58 A;  4QE9 A;  2E75 B;  4TV8 B;  5KHJ A;  2W0X A;  2IH3 C;  3TET A;  3E8B A;  3D8C A;  5IDJ A;  1FS0 G;  2P90 A;  2HEP A;  5IJ0 A;  5KA5 A;  2XHB A;  1NBM G;  2ILM A;  1KEC A;  1MOF A;  1XUQ A;  4O4L B;  1Q5O A;  2Q7E A;  3ZMS A;  4DR1 B;  1NH2 D;  5LL6 Y;  3RVY A;  3BRC A;  3SYP A;  4WFA V;  2A7W A;  1UFI A;  1BE3 H;  2AGA A;  1GH6 A;  2A06 H;  3QO7 A;  2XAQ A;  1BS3 A;  1FXK B;  5IJ9 A;  4I55 A;  1IUR A;  1KB9 F;  2QTS A;  2D3O W;  5IWA O;  2OTJ V;  5L3B A;  3OR7 C;  3JAW B;  4UCV A;  4IGG A;  1VQN V;  1AVM A;  1PNM A;  3DGE A;  2B9Z A;  2HJD A;  3SYC A;  3OTO B;  2UXD O;  2CH7 A;  1M56 B;  1T5E A;  1CEZ A;  4FIP C;  1XL6 A;  4UV9 A;  1GK9 A;  2CTP A;  1VQ7 V;  2JJ2 G;  1PL0 A;  4I50 B;  5LYJ A;  2QKA A;  3CCE V;  2Z0A A;  2W6I G;  1FYJ A;  4ICG A;  3FAV A;  4OX9 O;  3KG2 A;  1TAE A;  5BR8 O;  2GHY A;  4QJF B;  3J81 N;  1AB3 A;  1VQ6 V;  1GMG A;  3CS5 A;  2EIL C;  4CS4 A;  4BIO A;  1L8D A;  1XMQ O;  1TVK B;  1DTO A;  3AK3 A;  4LCU C;  1NKD A;  4X62 B;  2QSA A;  2JEX A;  3E8H A;  2ETN A;  4AQY O;  5L3E A;  1AIL A;  3BA9 A;  1YJ9 V;  3JSN A;  1TA8 A;  4TWK A;  2ADM A;  2QEX V;  4I4T B;  4WFG A;  2CGN A;  2B5U A;  3L70 H;  3SPG A;  4JI8 O;  4RUE A;  4JZ2 A;  4PI2 A;  3OKG A;  3ZHQ A;  2WLM A;  1MSW D;  3IGA C;  1BSM A;  2R9R B;  2JG3 A;  5CBH A;  3C3T A;  2QWQ B;  2ADQ B;  2HFE C;  3JD3 A;  2QR4 A;  2QWR B;  1N34 B;  3A0H Z;  4IL6 Z;  4PHZ A;  1IBL B;  3ASN B;  1MAB G;  4E2L A;  1I08 A;  1YIT V;  2EZP A;  3CWB H;  1N0J A;  2W6J G;  4PJ0 Z;  1IXM A;  4WBN A;  3T4Z A;  5JJJ B;  3JD1 A;  3KCX A;  3FFQ A;  2UXX A;  1EN6 A;  1N36 O;  4UCO A;  4LF8 B;  4FFB A;  5J2U A;  5D5Q A;  1IVS A;  4CS2 A;  3SR2 C;  4JI3 B;  3JAM N;  1HNX B;  1OJH A;  3LSQ A;  4I0X B;  2GUZ A;  3MHH C;  2IM9 A;  1SQG A;  5J9P C;  4J9Z B;  4UFZ A;  2WLL B;  2V7Q G;  1L1F A;  3E22 B;  2IU0 A;  1R6T A;  3JSL A;  2CDY A;  4DV4 O;  4MVO A;  4LFB O;  4DR7 O;  3ZS8 C;  4FK5 C;  3BVO A;  3ZHV A;  2N74 A;  2EIM B;  3ZHS A;  3QTC A;  3VBB A;  4KL1 A;  3ZMV A;  2GSM B;  2ZKO A;  5TIS Z;  1RSO A;  1V55 C;  3CRC A;  3AEI A;  4JI4 O;  3CHX A;  4ASU G;  2WLH A;  2Y0P A;  2YSU B;  3CJH A;  2YIB A;  3JAR A;  3SJB C;  1HW7 A;  4JI0 O;  1V54 B;  4K0K O;  4TOI A;  3E86 A;  3TCU A;  2YIB D;  3AG1 B;  2BOB C;  4CH4 A;  3LDE A;  2PF4 E;  3MD0 A;  1BT8 A;  4RUF A;  1URF A;  3LUT B;  4HYO A;  4UVA A;  5B1B C;  3G6E V;  4UUJ C;  3HKC A;  4DR6 B;  5EYP A;  1SQQ H;  5KUK A;  4P9P A;  4YY3 B;  3VQV A;  4GKK O;  2UU9 B;  2OIG A;  1JX9 A;  4J42 A;  1Y74 A;  2QA4 V;  4TT3 G;  3N2G A;  1VQ4 V;  4MW8 A;  3ABL C;  2X0L A;  5KMG B;  1D2D A;  4JI6 B;  1EBO A;  2HVJ C;  4H37 A;  5B1A B;  4TQD A;  5JQG B;  1GM8 A;  1ARO P;  5CA3 A;  5B66 Z;  1XI1 A;  3MAQ A;  3OW2 U;  2R9A A;  4QIW F;  4DUY B;  3PJS K;  4NXM B;  3W7T A;  4R7C A;  4F4L A;  4PDV A;  5BMV B;  1AP6 A;  4UVC A;  4OPH A;  4NXN O;  2P67 A;  4ZHQ B;  5LMN B;  4DK0 A;  2FYU H;  2DJV A;  4UCS A;  3B4S A;  2LJ2 A;  4JYA O;  2GTS A;  2UUB O;  2OCC B;  1H2L A;  3LSU A;  2PTM A;  2E5L O;  1XNR O;  3STL C;  5ITZ B;  4U7N A;  1S5J A;  5CA0 B;  2JVD A;  4JI2 B;  1FPO A;  3WFV A;  4OPA A;  1I7F A;  2F4V B;  3WB2 A;  1VQ5 V;  2IH5 A;  1K34 A;  2EIL B;  4MVS A;  4BW5 A;  2DN9 A;  2ZR3 A;  5FNV A;  1Q6I A;  2XAF A;  1KP2 A;  1PD3 A;  3H01 A;  2QKS A;  1VQM V;  1OCR C;  4X1Y A;  1W2B U;  3WB1 A;  3CC7 V;  1F7Y A;  2R72 A;  4JTA B;  1PV0 A;  4YJ3 B;  2QTO A;  1NZ6 A;  3ZMU A;  1SRY A;  4JF3 A;  2WA3 A;  1OCC C;  1JA8 A;  5IE9 A;  1EN4 A;  2RNB A;  4X1K B;  2WLI B;  1THZ A;  1SKV A;  1CPY A;  2P06 A;  3K5O A;  5H6R A;  4CH6 A;  5LOV B;  2RCV A;  3APO A;  5FPR A;  1Q82 W;  4DV3 B;  3T1Y B;  4H33 A;  2DW4 A;  1KMI Z;  1R6N A;  3RYC A;  5LXT B;  1QNM A;  2UXB B;  1YZB A;  1DF4 A;  4PI0 A;  2NR5 A;  2NLJ C;  1XHX A;  1P84 F;  3H1L H;  2V1D A;  3CX5 F;  3JYC A;  1FFX A;  1DLB A;  2YEV A;  1NJI W;  4DV0 B;  4H44 B;  2GTA A;  4HNA B;  3GVM A;  2P6J A;  1AJN A;  1Q6U A;  5IYZ A;  4O4J A;  2BSK A;  4FVM A;  3SPC A;  3OTO O;  1Z5V A;  3RW0 A;  2Q67 A;  5EIB D;  1TUB B;  1VP7 A;  1VF7 A;  3APQ A;  3CME V;  3PN1 A;  2WLK A;  4KUM A;  3CYO A;  1N8R W;  1FAF A;  1OZ0 A;  4RWU A;  3UT5 B;  2EUL A;  3FB8 C;  4WFH A;  4N23 A;  4CBC A;  5EC2 C;  1J5E B;  1YTF D;  1YSC A;  4JAA A;  3QVN A;  3A0R A;  4MW3 A;  1V55 B;  2BCC H;  1N33 O;  3JAL A;  1Y66 A;  2EIK C;  1ZL8 B;  1BZK A;  2WA4 A;  1BCC H;  1WA8 B;  4FPP A;  1QR9 A;  4K8Z A;  3W7W A;  2KSD A;  4TV9 A;  4JI1 B;  1R6K A;  4X62 O;  4X1I A;  1R3K C;  2ZDI A;  3P3N A;  1VQL V;  4I7Z B;  5BY1 A;  1LUV A;  1B6Q A;  1FXK C;  2YXL A;  3U10 A;  4FMT A;  1SA0 A;  3EVK A;  2JGD B;  2Y69 B;  1TGO A;  1B3Q A;  3H1I H;  2XOK G;  4CH5 A;  1N34 O;  2PY5 A;  4ZIB A;  3ML0 A;  4QPK A;  1M56 C;  1K92 A;  1QLE B;  4EEQ A;  4FLT A;  5IYC O;  1YIJ V;  4WFF A;  2F43 G;  4BAY A;  1XL4 A;  4HAM A;  4DRX B;  3BPZ A;  2X6C A;  1N0N A;  4F6R A;  4PDL A;  3IAY A;  2R9I A;  4NR1 A;  3Q4H B;  4LFA B;  4X65 B;  1OV9 A;  4NYK A;  4LF8 O;  1HNW B;  4JPR A;  1HDJ A;  4HBN A;  1OCO B;  4DV7 B;  4JI3 O;  2ZXW B;  4BW9 A;  5KX5 B;  1GO3 F;  4JI7 B;  4FLX A;  4O4H B;  4AIL C;  1GKF A;  3C3S A;  3E35 A;  2YXY A;  4J80 A;  3CP1 A;  3DC5 A;  1EFR G;  3K03 A;  4GLX A;  2YC0 A;  3HKE B;  4LF7 O;  2Y4U A;  1R3L C;  2AHY A;  2JRI A;  1Z5W A;  2QDO A;  4IIJ B;  4ZOL B;  2WSS G;  3K59 A;  3FX7 A;  2XAS A;  1KBH A;  3RYI B;  4U3J A;  4CS3 A;  4JZG A;  3L75 H;  5C93 A;  2VWJ A;  5JH7 B;  3SYO A;  5CA1 B;  4LNU B;  4JI5 O;  2CK3 G;  1WNS A;  1R73 A;  2ZE6 A;  1OCR B;  1D5A A;  2LW1 A;  2HLD G;  4EB6 A;  2BTQ B;  3G71 V;  2EIJ C;  2KQX A;  4LF4 B;  5IYD O;  3TJT A;  3AG4 C;  2A0L A;  1BQ0 A;  1H8H G;  4DR6 O;  1QQC A;  2CGO A;  4U7O A;  5LP6 C;  1OCC B;  1SQB H;  4UXN A;  2QM7 A;  2DE0 X;  5LA6 B;  4YY3 O;  2UUC O;  4KFM A;  3AK2 A;  2UU9 O;  5CMU A;  1KP3 A;  2Q0A A;  1U97 A;  4ZI7 A;  4DR4 B;  4YJ2 B;  3ETD A;  1S3J A;  4JAS A;  3FKS G;  2EJR A;  3UKM A;  4JI6 O;  3E8F A;  4PA4 A;  5A2Q N;  4NVP A;  3JAS A;  1IBM O;  1NQT A;  3FYE B;  5DN6 G;  5J2T B;  1WB7 A;  1K5S A;  2WAM A;  1BGY H;  3MDS A;  4NXM O;  1E79 G;  4FZ0 A;  1QU7 A;  3SDL A;  3CRM A;  2IJH A;  4LF5 B;  1CP9 A;  4NTX A;  2A3Q A;  5B3S B;  5LMN O;  1KKD A;  2AZ2 A;  2XAH A;  3AG7 A;  1MSD A;  1V54 C;  3CCR V;  3B09 A;  3RN4 A;  3AG1 C;  4LP8 A;  1JJO A;  3B2E E;  1SET A;  3RYF A;  4IHJ A;  2ZM6 B;  1M4U A;  3VQX A;  4JI2 O;  1K9M W;  3UO3 A;  1W0K G;  3RFR A;  3T4D A;  2F4V O;  3SPH A;  3CCU V;  4DUZ B;  4MTO A;  3ZCC A;  1AI6 A;  5L3D A;  2EIK B;  4X8A A;  4IYI A;  4GZR B;  5LGU A;  1YEW A;  1WAZ A;  2QGN A;  2QM8 A;  4OXS A;  4GYC B;  1XMO B;  1G8M A;  2LQT A;  2JIZ G;  1Y76 A;  5B1A C;  5BMV A;  4DV1 O;  2FKX A;  5EK0 A;  4L8J A;  2D2C B;  4O4I B;  4PA9 A;  5BZB A;  2UUA B;  1GN2 A;  2ZIN A;  4B3T O;  2NP6 A;  3R66 A;  1RPR A;  4WCE V;  3RYH B;  1Z2G A;  3TK1 A;  5IY5 C;  2PI4 A;  2FTK A;  4B7E A;  3I55 V;  1FXH A;  4B3M B;  4DV3 O;  3KCY A;  3T1Y O;  4OGQ B;  2IBZ H;  2OCC C;  3UO2 A;  1W0J G;  4RQE A;  2EBO A;  5JVD A;  4GX5 A;  4MVQ A;  4X9Q A;  2HJF C;  3CCV V;  3ZMT A;  5GW7 A;  4AHC A;  2Q5Z A;  4J11 A;  2N04 A;  4DV6 B;  2H3O A;  5JJE B;  2BTO A;  4DR2 O;  1NI8 A;  3LNN A;  4DV0 O;  1I5Y A;  3STZ C;  2H8P C;  4P30 A;  3JAK B;  3K04 A;  4PDR A;  1YCI A;  1BMF G;  1MA1 A;  4LF6 O;  1SS3 A;  2QWP B;  5B1N A;  2JDI G;  4Z1M G;  4JAV A;  3OUF A;  1J5E O;  4LH6 A;  5LMU O;  1HNZ B;  4WF9 V;  4X20 B;  4G27 B;  1VQ9 V;  2EJ7 A;  1GN6 A;  1XOU A;  2A79 B;  2B1G A;  3DXR A;  2NN4 A;  2ZNJ A;  2EIJ B;  3AG4 B;  4FLY A;  3T2M A;  5LP6 B;  1PNL A;  1IBK B;  1XIL A;  2RDC A;  3CMA V;  1XNQ B;  3JAT A;  3SJC C;  1PL4 A;  3UT5 A;  5EZY A;  1GRJ A;  1Q86 W;  2EZO A;  2WLN A;  4LC1 A;  3WG7 B;  4R50 A;  3TXQ A;  1AI7 A;  1RP3 B;  2XAG A;  3CXC U;  1RM1 B;  2DQ3 A;  1AJQ A;  3OM3 B;  4PA7 A;  1IZ3 A;  5H5N A;  5CN0 A;  2BOC C;  1DGS A;  1K73 W;  4LFA O;  3OFN G;  4X65 O;  1HNW O;  4DR3 O;  3RT3 C;  1HR0 B;  3T1C A;  3AK1 A;  2LFS A;  3OEH G;  2VQE B;  1SES A;  4JI7 O;  3N27 A;  1AR4 A;  2E76 B; 
#chains in the Genus database with same CATH homology
 1YF2 A;  1YDX A;  3OKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...