1YDXA

Crystal structure of type-i restriction-modification system s subunit from m. genitalium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
374
structure length
374
Chain Sequence
b'MTPKLKLNNNINWTKRTIDSLFDLKKGEMLEKELITPEGKYEYFNGGVKNSGRTDKFNTFKNTISVIVGGSCGYVRLADKNFFCGQSNCTLNLLDPLELDLKFAYYALKSQQERIEALAFGTTIQNIRISDLKELEIPFTSNKNEQHAIANTLSVFDERLENLASLIEINRKLRDEYAHKLFSLDEAFLSHWKLEALQSQMHEITLGEIFNFKSGKYLKSEERLEEGKFPYYGAGIDNTGFVAEPNTEKDTISIISNGYSLGNIRYHEIPWFNGTGSIALEPMNNEIYVPFFYCALKYLQKDIKERMKSDDSPFLSLKLAGEIKVPYVKSFQLQRKAGKIVFLLDQKLDQYKKELSSLTVIRDTLLKKLFPDMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords type I restriction enzyme specificity protein MG438
publication title Crystal Structure of a Putative Type I Restriction-Modification S Subunit from Mycoplasma genitalium
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Dna binding protein
total genus 109
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2004-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01420 Methylase_S Type I restriction modification DNA specificity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1120 Mainly Alpha Orthogonal Bundle Helix Hairpins Bipartite methylase S protein 1ydxA02
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA03
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA01
1YF2A 3OKGA 1YDXA
chains in the Genus database with same CATH superfamily
4FM2A 1Y76B 5EC1C 1NR7A 3QF7A 4JI4O 2ZXWB 1Q6HA 1S5HC 2EIJB 3SPJA 4TQDA 4IGGA 4PI0A 3TXSA 3T1HO 4LF4O 2YICA 1AP5A 3EHBB 3QTCA 2IJJA 4JZ2A 1YF2A 3HB3B 4JI0B 1BQ0A 2YIDA 2A79B 4PDMA 5KUMA 3B77A 3SJBC 2ILMA 1T5EA 2YEVA 2EINC 3CCJV 1NTMH 3RYIA 3CX5F 2EULA 1GKFA 3CCQV 1XL4A 3ABMB 2VRZA 1QVFU 3B8NA 3AK3A 2YDEA 5K1PA 1ZSPA 2PUSA 3I56V 2BTQB 1U96A 3ZHTA 2Q67A 1E1RG 1AVMA 5CBGA 4X62B 3D3QA 3JATB 4BW5A 2JGDB 5CB4A 3FAVA 3BABA 3CCLV 4D6TH 1DK1A 4NXNB 2Q69A 4JTCB 3QO5A 4OX9O 5JVDA 2QEXV 2BCCH 4PDRA 2Y48A 3S3XA 1WB7A 3RYCB 3ASNC 1GMGA 3JASB 4JI4B 3LSQA 5L3DA 2QM8A 1M4UA 1EN4A 1AJPA 3T1HB 2QKCA 5KHJA 2UXBO 4TT3G 3K3WA 4TV9B 3ZN1A 3AG1B 3DXRB 2Y69C 4I7ZB 2CTWA 5IY5C 4CS4A 1CXZB 4X1YA 4Q20A 1PV0A 3OT7A 3LDDA 3T1CA 1VEWA 1V54C 2EX3A 4DW0A 2NP6A 2P4KA 2OYQA 2YS8A 1QVGU 3H1JH 4NTWA 3UKMA 4UB6Z 4ZBMA 2JGUA 3G80A 3HKCA 1XNQB 3J81N 4QE9A 4O2BA 3LDCA 1RFYA 5KA6A 1UFIA 5IJ0B 1SQGA 1LUWA 2ITCC 4Z2WA 1I5YA 4OX9B 4NXMO 4UCUA 1TGOA 4H0LB 5JQGB 3OUFA 2D2CB 2IM9A 2DQ0A 1R6KA 2F43G 4YY3O 1NH2D 1EZVH 3K9AA 3VQVA 5KUKA 3A0RA 3APOA 4FM0A 2UXBB 4IYHA 1FXHA 1OCCB 4YIOA 1AQJA 1DLBA 3CS5A 4DR7O 2HKOA 1YDXA 5EZYA 3MDSA 2IBSA 2YXLA 1FD9A 4X20B 1YI2V 4PA3A 1YJNV 3WG7B 1B3QA 2KG7B 3D3IA 4UV9A 2YUAA 4YJ3A 4ZI7A 1ORQC 1D5AA 3C3TA 3ZIAG 1VQPV 3ML0A 5LP6C 4JAVA 2EJRA 4L87A 1R3IC 2F66C 4UVAA 5LGTA 5BY1A 4O2AA 2HJFC 2HLDG 4U3JA 4X1IB 2XOKG 3IC9A 4RUEA 1FXKC 3K5MA 3CRQA 2EINB 3CWBH 2CTPA 3SPCA 3K06A 1D2DA 3HKDA 2IH2A 1CEZA 4LBEC 4NXMB 4QJFB 1F4NA 2QKSA 1KP3A 3SYAA 1KC8W 5LA6B 1Z2GA 3ASOC 2PI4A 2WLHA 4ZOLA 4WFGA 2BTOA 4YY3B 1Y67A 1ZL8B 5EIBD 3ZHRA 1EM1A 1ZAUA 2OTLV 1XMQO 2AZ2A 4I0XA 2IBTA 5JJNB 5JCOC 4N23A 2IJIA 3QNEA 5LXTB 1SQVH 1S72V 3ABKC 1GH6A 4DV6O 4DR7B 2ZDIC 5E1AC 1Q6UA 1N4CA 3BA9A 4GZRB 2QA4V 5LYJB 3BRCA 4LF5O 3B2EE 2DJVA 1H2MA 2CH7B 2GHYA 3ETDA 2V4DA 3VOUA 1KB9F 2XNDG 3OMAB 2R9RB 1AR1B 4IYIA 2Q7HA 4EKWA 3CCUV 3RVZA 1NJIW 4TUYA 1XUQA 3OEEG 4RAIA 4HNAB 1BQZA 2JEXA 2Q0OC 1Q8IA 4I9WA 5DECA 1BCCH 2QWPB 2GUZA 2YIBA 2GTSA 2JJ1G 3ZMZA 5H2FZ 2RMKB 3ZHVA 1KP2A 3ETQA 3HKEA 4GLXA 1I5XA 4YXWG 2F1MA 1ZTEA 4TV8B 4ZHQB 1Q7YW 2X7RB 2HVKC 4PELA 3OTFA 1AILA 4LNUB 1PL4A 2CTQA 1SETA 1XMQB 2UUCO 3IC7A 1WN7A 4MVUA 5JH7B 4F4LA 3L75H 1KU9A 2QM7A 4DV6B 4LF5B 3KCXA 1HR0O 3NXSA 1M93A 1P7GA 1SQFA 3SJCC 4UCTA 1GN3A 3QVNA 1IBMO 2IW5A 1XDCA 4MVOA 4EB6A 3CE2A 4CC5A 2QTSA 1NZ6A 3HR0A 2ZINA 3AG3C 5FLXN 3CEIA 3H1KH 4OPAA 3L74H 1G6UA 5GONA 5F2VO 4FK5C 1M90W 1N36O 1W0KG 1TVKA 1JFFA 2WLIA 1VQLV 2YSUB 1WAZA 4RWUA 3QG5A 1HP8A 1Y4MA 1M57B 3CD6V 1VQMV 2LJ2A 4CH6A 5GTHZ 2XAQA 3PJSK 3E86A 2DYSC 2HVJC 1R3LC 4AHCA 1GRJA 3OTOO 4DV4O 2EIJC 2K1EA 3P30A 4GKKB 1WA8A 1NVPB 4IHJB 1QHTA 4BIUA 1AP6A 3CHXA 1JA8A 1XBLA 1JMKC 4DK0A 1VQ6V 4DO2A 2Q5ZA 3M8AA 5B5EZ 4A5UB 1VF6A 2B1IA 1J5EO 1KKDA 3R66A 1FS0G 4W4LA 2UUCB 2WPDG 3PN1A 5C93A 3JALB 3OR6C 4I9QA 5L3GA 2F23A 2ZM6O 2QWNB 4UCOA 3ZHUA 1VF7A 2LW1A 1MG1A 3ABMC 1HR0B 1OHHG 3K59A 1OCRB 1ZX3A 3BFRA 1IBMB 2MW2B 3KG2A 3ASOB 1HNZO 2ZR3A 4FIPC 2H8PC 2ETNA 4DV1B 4DK1A 4X1KB 2AHZA 4OXSA 1SKVA 4CH4A 4EEQA 2X6AA 4JI5B 1N36B 2QWOB 2UUBB 1Y74A 1XNRO 3R65A 4BW9A 1BL8A 3GWKC 4XDLA 4J11A 3JARA 1LUVA 2E3CA 4IIJB 3N2GA 2IH4A 3CC2V 2QWRB 5L3CA 1KD1W 1L8DA 5IYCO 1VMGA 3BPZA 3OW2U 3GB7C 5DEDA 2DMXA 3JD0A 1M1KW 3OTOB 2YI9A 4UFZA 4DR6O 1XREA 4LP8A 3CRMA 3LUTB 3AG1C 1JX9A 4XDJA 2QDOA 3TCUA 1J5EB 5H6RA 3G6BA 3MHSC 3RWRD 3RYFA 5LHGA 3N2KA 4HBNA 5CA1A 3X2QC 1HNXO 1K8AW 5TISZ 4EFEA 3BHPA 4DRXA 3H9VA 2YIAA 2HEPA 3CCEV 2ZM6B 3RFRA 2V7QG 1P49A 1Y6XA 1MSWD 3SPHA 5LGNA 2ZQMA 1S77D 1XILA 3H1IH 4LWSA 2WLJA 1OV9A 2RQ6A 1HNZB 4KHPO 4MVSA 2A06H 3K03A 2GTAA 2FL4A 3S3WA 3OUSA 1NKDA 3ZMTA 4DW1A 1WP7A 3ZHQA 2YEVB 3OMNB 2Y4UA 2YC0A 3RYIB 2ZE5A 3VQWA 1XNRB 2UU9O 2BE3A 5J2TB 1ZLZA 1MSDA 4U7NA 4BIZA 3A0BZ 2Q68A 1IBKB 4LF8O 5IYBO 5JJJB 2LQTA 3FKSG 2BOCC 1NI8A 2DN9A 1L0LH 2P67A 4JTDB 2IH1C 3KZIZ 4DR6B 1GK9A 5CBFA 4K0KB 5J2UA 1XHXA 4MS2A 4FLXA 5CB4B 3K5NA 2CAZC 3VQYA 3FAVB 3AG4B 4LFAO 3SJQC 5IT9N 4YJ2A 2WAMA 5C8YA 3RYHA 1H38A 3B8MA 1MZEA 3CP1A 3EFFK 1HNXB 3WG7C 2A3QA 2QJ1A 2P7TC 4Q6GA 3DTUB 2LP7A 5EBWC 4UCRA 5DN6G 2DYSB 3Q4HA 1XHZA 2UXNA 4X65O 2FYUH 4QNHB 1GN2A 2YI8A 1KQSU 4KHPB 3SPGA 4FZ1A 1RM1C 4RO2A 1BSMA 1WLEA 5LHHA 2AW9A 4QE7A 1VF5B 4X1YB 2E76B 2GV9A 2W6IG 1QBZA 1S5LZ 3TETA 2UU9B 4P9PA 3SYOA 2MK3A 1HNWO 4LF8B 2AHYA 4NTYA 5D5QA 4X89A 4BAYA 4GCZA 3SGIA 4FLWA 3HKCB 2F4VO 2Q8VA 1E1QG 2UXDO 1YEWA 5KX5A 4O2BB 2VQFB 1YTFD 1VQ8V 3L73H 3UM7A 4LFAB 4O4JA 4X64O 2M7WA 1Z5VA 2EILB 1NH2B 3IAYA 1VQ4V 1JCHA 1F4MA 4R8CA 3KKYA 4FMTA 4K35A 3ZJZA 5BMVA 2UXCO 4BR6A 1QLEB 1FKAO 1F23A 2DWEC 4F6EA 1RSOB 4O4HA 5B3SB 4LF4B 3ZRXA 1G1XB 1PNMA 5BXZA 1IZ3A 5KLVH 4X9QA 2IH3C 1K3EA 5CMUA 2UUAO 5LBQA 4W4KA 5EZYB 1SF9A 2ZR2A 1O9GA 1G4YB 3JCUZ 3LNMB 3X2QB 4QPKA 1MABG 4WFBV 2ADMA 1GN4A 4PA4A 1RP3B 3CXHF 5EBMC 1KECA 1W59A 4YJ3B 4KXRA 4ZI7B 4E4EA 4B3MO 3TK1A 1HNWB 1H2NA 1MOFA 2ZCEA 1AJQA 2F4VB 3CXCU 5IYZA 2UXDB 4JPRA 2KQXA 5E79Z 3F5WC 3W7SA 2WLLB 2NNUA 1WB8A 1AR4A 2NN4A 2Y4TA 4J9YB 3CMAV 3CCMV 1AI5A 5H9CA 3JAKA 4PI2A 4ASUG 1VQNV 5FL7G 2ZKOA 2JG3A 3I5DA 2BTQA 2L35A 4X8AA 2QGNA 3JSLA 1GM9A 2UXCB 2H3OA 3JATA 1VQOV 4ZOLB 3L71H 2P06A 4I0XB 4PJ0Z 3T2MA 1VP7A 5A2QN 4WFAV 1K4DC 3ZMSA 2UUAB 1IVSA 3C3SA 3H1LH 4JF3A 4I50A 3WU2Z 5LMUO 3E2EA 3CRAA 3E35A 1NTZH 1BS3A 1M57C 4HZ3A 5IWAO 3UQ8A 4E2LA 4LC1A 1IDSA 4TSFG 4JI3O 4B3MB 5IJ9B 1PD3A 5A9GA 1Q81W 4MTFA 1P7BA 3K0GA 3IGAC 4TUYB 2OCHA 1RM1B 3J7AU 3O65A 1FFXA 1Q5OA 4H13B 1DF4A 3UT5A 2FTKA 1K4CC 5L3BA 1P4RA 1N32O 1N0NA 5B1AC 5KHKA 1KYOF 4LF6O 2GDSA 3QO7A 3H01A 1OCRC 3ZRWA 1YITV 2PTMA 4D7SA 3MAQA 3ZEDA 1AROP 3G71V 3JYCA 5CA3A 2XAHA 4FLYA 3STZC 5CBHA 2Q7GA 3CB2A 1K34A 4JI7O 1LNQA 3P32A 3SDLA 4QGPA 3D8CA 3F5TA 4PA9A 5JQGA 1JJ2U 1AR5A 1W2BU 4JV5O 4DR4O 2VWJA 3G67A 2Y0IA 5LMUB 1WP8A 5AG2A 4JAUA 4JYCA 4DYLA 5IWAB 4MT8A 4O4LA 5EYPA 1VARA 3BCCH 4JI3B 3L72H 4UCSA 2BSKB 4R6ZA 3VQXA 1L1FA 1BT8A 1KMIZ 5GONB 3OEHG 1KUQA 1EBOA 3OMIB 3K08A 1JFFB 3CRCA 1QCEA 4WFFA 3E8BA 4GYCB 2DQ3A 2WLIB 5KMGB 4AI8A 4YIPA 2K9PA 1FJGO 2R9AA 2XAJA 2CTRA 1N32B 1GM8A 2VQEO 2M6YA 4LF6B 4I55B 3RW0A 3JAMN 4FLUA 4B3SO 5K1XA 5CA0A 2CGNA 1WA8B 4UB8Z 3DSQA 4OGQB 1N8RW 5D5PA 4JI7B 3M7MX 3BVOA 4CH5A 2RN9A 3CPWU 1I08A 4JV5B 3UCSC 5FNVB 1SZTA 5HFLA 1EN5A 4K8ZA 2EBOA 3RT3C 3LNNA 3CJHA 2R72A 5ITZA 4N21A 4DR1O 3APQA 1K5QA 3D36A 2R9IA 2P90A 3AG4C 5KHGA 1Y74B 1F7YA 3E22A 1OCOC 2HG5C 1SA0A 3JARB 1JOYA 3N2GB 3OM3B 3IFXA 5IYDO 5FPOA 1K73W 1H8HG 2LGWA 1FJGB 4GT1A 4PV1B 3EVKA 5H6QA 5KAIZ 4Z1MG 4J7JA 3K58A 2VQEB 2AZ0A 4CZZA 1GO3F 4B3SB 4BWAA 2ZIOA 3SJAC 4TOIA 1B06A 2WSSG 2X6BA 4JI1O 3AG7A 4L8JA 4JI2O 3RYFB 4B3TO 2YXHA 5CA1B 3NR7A 2WA3A 3ICXA 1AI7A 3AK2A 4DRXB 5CN0A 4DUZO 3RBZA 5B1AB 3FD9A 4XBFA 1S3JA 1R6NA 1SQBH 3LSSA 1N33O 2IJKA 2RCVA 3RN4A 4RQFA 4LWSB 2Q73A 2FMLA 4P2ZA 4X66O 2LW7A 2A7WA 2JS3A 2EZPA 1MMMA 2RDCA 3LDEA 2QSAA 2XAFA 5LOVA 3TGUH 4CS3A 5LMNO 2PI5A 4DV2O 1SESA 3KCYA 1VQ7V 4KL1A 1AQIA 2EILC 2QWQB 1B04A 2CGOA 4FFBB 4DV0O 2HJDA 3G6EV 2XHBA 4FZ0A 1SQXH 1Y66A 1QLEC 3GVMA 4UVBA 5B1BB 3BY6A 4DV4B 1N0JA 5B3SC 1VQ9V 5J2UB 3FYIB 4JYBA 5HFMA 4DUYO 3K79A 3EXAA 3WB0A 1HDJA 3JD4A 1GAXA 4JI1B 2E5LO 2CE4A 4JI2B 5C8YB 4B3TB 1AI6A 3A8TA 3RYHB 1IURA 2ZD9A 3ZCCA 2JS5A 4DUZB 5LP6A 3Q4HB 2DYRB 5B66Z 3HKBA 3WFVA 3TJTA 1N33B 1OCZB 1XEQA 4IT5A 2JVDA 4X66B 1H2LA 1Q6IA 1FXKA 4FJCC 4P30A 1TUBA 3JALA 2ITDC 3BA8A 3ZS8C 2Q0AA 1WPBA 5KAFZ 4WFHA 4NR1A 1O9HA 3OD4A 4NYKA 4EFBA 5LMNB 1ZUQA 4DV2B 2UXXA 3J80N 4GX1A 2IU3A 3I55V 4MVZA 5DM6V 3U10A 3K57A 3QO8A 1AI4A 2KKWA 5EIBC 4DV0B 2FKXA 2W0FC 3B09A 1MA1A 4J9ZB 4WCEV 4JI0O 2ZE8A 4X88A 4J7KA 3CMEV 3MHHC 5JCOA 3ZMVA 2EIMB 1TA8A 1ROPA 2Q7EA 5L3EA 2OCCB 4R7CA 5KX5B 1GM7A 2ZDIA 2OIEA 4DUYB 4WBNA 3JAWA 1GTOA 1BE3H 1WJZA 1YVWA 4O4JB 1BHAA 2E5LB 1US6A 1THZA 5JVDB 1OCOB 5JJEB 4B3RO 4X62O 5BMVB 2HP8A 4BIOA 2P6JA 2Q4PA 4O4HB 4NXNO 2HFEC 2ATKC 3ABTA 3JCZA 4LFCO 2RNBA 4KP4A 2IH5A 3L9DA 3THOA 4F6RA 1SERA 1IXBA 1AJNA 4HYOA 4ABMA 4CS2A 1PPJH 5B1OA 1COWG 4J42A 4LCUC 1LR1A 2RJZA 4I5SA 2IBZH 4GX5A 2EIKB 4NVPA 2P4VA 1NS1A 1X4TA 4JI6O 3FB7C 2JK5C 2XTAA 4G2KA 4JI8O 3A2FA 5IYZB 4JZGA 1SRYA 1QNMA 4I4TA 3CC7V 4YHHO 4ZIBA 1J95A 3K9SA 4QPJA 5J2TA 2ZE7A 1NQTA 4PHZA 2OTJV 4G28B 4O4IA 1M56C 3JAKB 1U97A 2ADQB 3E89A 3W7WA 4J41A 1XNQO 4B3RB 1H2SB 5EC2C 3CYOA 1K9MW 1XI1A 2OIGA 2N04A 2F95B 1YHQV 1UJWB 4X65B 1EN6A 5FPRA 4DR3O 5KA5A 4JGSA 3D36C 4NTXA 4LFCB 1JR9A 2R70A 1Y76A 4I50B 2B5UA 2LFSA 2Z0AA 3E8GA 3CCSV 4J80A 2JDIG 1R1BA 3ZX6A 4DR2O 1K97A 2G38A 1D5NA 2IU0A 2N05A 3MD0A 3ABLB 1OJHA 3OE7G 4LF9O 1FPOA 1R3JC 3HPLC 3ZMUA 3OFNG 5EBLC 1HWYA 3ZBHA 1K7DA 3RVYA 1XMOO 4JI6B 4U7OA 1N34O 2OWOA 4JYAO 1DF5A 2W0XA 4O2AB 4JI8B 1VF6C 4GX2A 4U3JB 4PA6A 4YHHB 1FFXB 3K0DA 3T1YO 5EK0A 3UO2A 3UT5B 2Z3YA 3HKDB 4X64B 2IJHA 1QU7A 2WLMA 2WA4A 2DW4A 3ZRWB 2QR4A 3ZHSA 2JGDA 1XL6A 2Q9LA 2W6JG 1PNKA 4DR3B 3OR7C 4GUNA 1H2GA 2XAGA 1FAFA 1WNSA 4LFBO 1OZ0A 3RYCA 3A0HZ 1TAEA 3JASA 2B9ZA 4FLVA 3WB2A 2N74A 3IJ4A 1GN6A 4DR2B 4JAAA 1FXVA 1Q86W 1RSOA 2NP7A 4MVMA 4O4LB 1BMFG 3O9OA 1H8EG 3AG2C 5EYPB 1Z5WA 4LF9B 4TV9A 4MVQA 2LO1A 1PP9H 1XMOB 3DXRA 3ZRVA 1N34B 4JYAB 3CRRA 4LF7O 1UPGA 2ZT9B 1URFA 2EZOA 4AQYO 4OPHA 4UXNA 4MW8A 1JJOA 3VBBA 1PNLA 4UV8A 1DGSA 3LSUA 3T1YB 1E79G 1B6QA 2WLKA 2GUZB 5GW7A 1JPXA 4ICGA 1DTOA 2LGQA 4K3AA 2OT5A 4G27B 4RUFA 3HKEB 1SQPH 3JD3A 4UCVA 5BZBA 5CA0B 1YZBA 2WLLA 4H44B 5IE9A 5IJ0A 3L70H 3ABUA 2P22C 1V55C 4MW3A 1JVMA 2A9HA 1TUEB 2X0LA 4GKJO 1MZFA 5LGUA 4KUMA 4LFBB 1M56B 1RPRA 3AEIA 2LFRA 2Y0PA 1NTKH 3F7VC 3AK1A 1SQQH 5B1BC 3SR2C 4EB6B 3CJHB 1EFRG 5ITZB 2XUMA 4FLZA 2PGGA 3C90A 4LF7B 3B40A 1G38A 2EJ7A 4X20A 2WLNA 3T4ZA 4AQYB 1TVKB 1YXBA 3E22B 4C7UA 2KG7A 2O57A 3ASNB 1SA0B 1XQ8A 1FYJA 2XASA 1Q90D 1YCIA 2BOBC 3ETEA 5KHIA 5IJ9A 2ZE6A 1R73A 2D3OW 2HHHO 5KHHA 4B08A 2DYRC 4UUJC 1FFTB 2JRIA 5H5NA 1OCZC 4X1IA 2PZSA 3JSNA 2P5OA 2V1DA 4TQFA 4AILC 2Y69B 3FB5C 5IY5B 5BR8O 2KB1A 4JTAB 4GX0A 4H37A 2ODMA 5IDJA 4LH7A 4J7ZA 3WB1A 2JJ2G 1V54B 3DC5A 4GKJB 1SC5B 2YIBD 4PA7A 4GKKO 4WF9V 3T4DA 3OKGA 5LA6A 4DR4B 3CC4V 1NBMG 4FLTA 1XOUA 2DWDC 1ZL8A 2QE7G 1BZKA 1SZXA 2PF4E 3CCVV 1KKCA 4PD4F 4PDVA 3TXQA 2F93B 2AXTZ 1CPYA 1F51A 2HR3A 2EIMC 3P3PA 2VWKA 2JIZG 5LXTA 4H33A 2OCCC 2Q6AA 4MSWC 4K8XA 3U0ZA 1M5IA 2NLJC 5LYJA 5LOVB 1CP9A 2XT9A 3ZN0A 1Q43A 1P84F 3SYPA 2CH7A 3JD1A 1PM9A 1ENVA 3H1HH 2BSKA 5L3FA 1Q3EA 4DV1O 1I94O 4B7EA 4NKGB 3CSXA 1SS3A 1QLNA 3AG2B 1YJWV 2HHHB 1IBLO 3GWOA 4MTXA 1ZWIC 3P3NA 4LH6A 4JI5O 2UUBO 1I7FA 1NU1H 4HNAA 3SYCA 1Q82W 2X6CA 4DV5O 5KMGA 4DV3O 5BR8B 2GSMB 3OAAG 3JD2A 4XDKA 3FFQA 2ZXWC 3N2KB 1PL0A 2ZIMA 5JWPA 4I55A 2ARHA 1VQ5V 1L0NH 5LP6B 2EIKC 3FX7A 2C2AA 1YJ9V 1BHBA 4U3FH 3HKBB 4TV8A 4ZHQA 3E8HA 2KSDA 4DV7O 5GTIZ 2B1GA 4LNUA 4TWKA 4UVCA 2PY5A 1RPOA 4MVRA 4PDLA 1FXKB 1TUBB 5JH7A 1S0VA 1IXMA 2PYLA 1V55B 4FM1A 2L6LA 3OGIB 4CH3A 2ZNIA 3ZRSA 4JYYA 4DR1B 5FNVA 4P9OA 4DXWA 2AGAA 1V9PA 4FFKA 4DR5O 4ZKIA 1S5JA 1NT2B 2PYJA 4WFEA 4RQEA 5B1NA 2A0LA 4NB5A 3SYQA 1I94B 1G8MA 4JASA 1IBLB 1BGYH 2E74B 4KFMA 3E83A 4MTGA 3ABKB 4IL6Z 4HAMA 1A32A 3W7UA 4DV5B 2CK3G 3OGCC 2E75B 4WBNB 4DV3B 3JAWB 4QIWF 1QR9A 2Z5UA 1IBKO 1WPXA 4B7KA 4YJ2B 3E8FA 1W0JG 1R3KC 3BEHA 1X59A 2VS0A 1EZJA 4K0KO 3N27A 4IHJA 2DOSA 3ABLC 3UO3A 1VIBA 1KBHA 3STLC 1QR8A 1M9NA 1YSCA 4DV7B 1NVPD 4FPPA 1H2KA 3G4SV 2ADPA 2ZNJA 3DGEA 1YIJV 3K5OA 2QKAA 4J10A 4F6RB 3W7TA 1NR1A 1S76D 2FB5A 5LL6Y 4DR5B 2WWWA 3M99B 1HW7A 1AB3A 1K33A 3K5LA 3DC6A 4Z1VA 4X1KA 1QQCA 1YTFB 1K5SA 2GBOA 3ETGA 1K92A 2CDYA 3FB8C 3W7XA 1I0HA 2NR5A 4I4TB 2YXYA 3U11A 4D7TA 3F7YC 4IIJA 4FFBA 4O4IB 1MNGA 3FYEB 3RGBA 4LR3A 1IX9A 3BAAA 4MTOA 4CBCA 2CUGA 2H94A 3AG3B 3B4SA 1JQ0A 2QM4A 2VQFO 1R6TA 5LHIA 1OCCC 4R50A 4FVMA 2JEUA 3FB6C 2DE0X 3CCRV 1VQKV 5J9PC 3SPIA 2QTOA 1PKXA 3K04A 4CC6A
chains in the Genus database with same CATH topology
1YF2A 3OKGA 1YDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF2 A;  3OKG A;  1YDX A; 
#chains in the Genus database with same CATH topology
 4FM2 A;  1Y76 B;  5EC1 C;  1NR7 A;  3QF7 A;  4JI4 O;  2ZXW B;  1Q6H A;  1S5H C;  2EIJ B;  3SPJ A;  4TQD A;  4IGG A;  4PI0 A;  3TXS A;  3T1H O;  4LF4 O;  2YIC A;  1AP5 A;  3EHB B;  3QTC A;  2IJJ A;  4JZ2 A;  1YF2 A;  3HB3 B;  4JI0 B;  1BQ0 A;  2YID A;  2A79 B;  4PDM A;  5KUM A;  3B77 A;  3SJB C;  2ILM A;  1T5E A;  2YEV A;  2EIN C;  3CCJ V;  1NTM H;  3RYI A;  3CX5 F;  2EUL A;  1GKF A;  3CCQ V;  1XL4 A;  3ABM B;  2VRZ A;  1QVF U;  3B8N A;  3AK3 A;  2YDE A;  5K1P A;  1ZSP A;  2PUS A;  3I56 V;  2BTQ B;  1U96 A;  3ZHT A;  2Q67 A;  1E1R G;  1AVM A;  5CBG A;  4X62 B;  3D3Q A;  3JAT B;  4BW5 A;  2JGD B;  5CB4 A;  3FAV A;  3BAB A;  3CCL V;  4D6T H;  1DK1 A;  4NXN B;  2Q69 A;  4JTC B;  3QO5 A;  4OX9 O;  5JVD A;  2QEX V;  2BCC H;  4PDR A;  2Y48 A;  3S3X A;  1WB7 A;  3RYC B;  3ASN C;  1GMG A;  3JAS B;  4JI4 B;  3LSQ A;  5L3D A;  2QM8 A;  1M4U A;  1EN4 A;  1AJP A;  3T1H B;  2QKC A;  5KHJ A;  2UXB O;  4TT3 G;  3K3W A;  4TV9 B;  3ZN1 A;  3AG1 B;  3DXR B;  2Y69 C;  4I7Z B;  2CTW A;  5IY5 C;  4CS4 A;  1CXZ B;  4X1Y A;  4Q20 A;  1PV0 A;  3OT7 A;  3LDD A;  3T1C A;  1VEW A;  1V54 C;  2EX3 A;  4DW0 A;  2NP6 A;  2P4K A;  2OYQ A;  2YS8 A;  1QVG U;  3H1J H;  4NTW A;  3UKM A;  4UB6 Z;  4ZBM A;  2JGU A;  3G80 A;  3HKC A;  1XNQ B;  3J81 N;  4QE9 A;  4O2B A;  3LDC A;  1RFY A;  5KA6 A;  1UFI A;  5IJ0 B;  1SQG A;  1LUW A;  2ITC C;  4Z2W A;  1I5Y A;  4OX9 B;  4NXM O;  4UCU A;  1TGO A;  4H0L B;  5JQG B;  3OUF A;  2D2C B;  2IM9 A;  2DQ0 A;  1R6K A;  2F43 G;  4YY3 O;  1NH2 D;  1EZV H;  3K9A A;  3VQV A;  5KUK A;  3A0R A;  3APO A;  4FM0 A;  2UXB B;  4IYH A;  1FXH A;  1OCC B;  4YIO A;  1AQJ A;  1DLB A;  3CS5 A;  4DR7 O;  2HKO A;  1YDX A;  5EZY A;  3MDS A;  2IBS A;  2YXL A;  1FD9 A;  4X20 B;  1YI2 V;  4PA3 A;  1YJN V;  3WG7 B;  1B3Q A;  2KG7 B;  3D3I A;  4UV9 A;  2YUA A;  4YJ3 A;  4ZI7 A;  1ORQ C;  1D5A A;  3C3T A;  3ZIA G;  1VQP V;  3ML0 A;  5LP6 C;  4JAV A;  2EJR A;  4L87 A;  1R3I C;  2F66 C;  4UVA A;  5LGT A;  5BY1 A;  4O2A A;  2HJF C;  2HLD G;  4U3J A;  4X1I B;  2XOK G;  3IC9 A;  4RUE A;  1FXK C;  3K5M A;  3CRQ A;  2EIN B;  3CWB H;  2CTP A;  3SPC A;  3K06 A;  1D2D A;  3HKD A;  2IH2 A;  1CEZ A;  4LBE C;  4NXM B;  4QJF B;  1F4N A;  2QKS A;  1KP3 A;  3SYA A;  1KC8 W;  5LA6 B;  1Z2G A;  3ASO C;  2PI4 A;  2WLH A;  4ZOL A;  4WFG A;  2BTO A;  4YY3 B;  1Y67 A;  1ZL8 B;  5EIB D;  3ZHR A;  1EM1 A;  1ZAU A;  2OTL V;  1XMQ O;  2AZ2 A;  4I0X A;  2IBT A;  5JJN B;  5JCO C;  4N23 A;  2IJI A;  3QNE A;  5LXT B;  1SQV H;  1S72 V;  3ABK C;  1GH6 A;  4DV6 O;  4DR7 B;  2ZDI C;  5E1A C;  1Q6U A;  1N4C A;  3BA9 A;  4GZR B;  2QA4 V;  5LYJ B;  3BRC A;  4LF5 O;  3B2E E;  2DJV A;  1H2M A;  2CH7 B;  2GHY A;  3ETD A;  2V4D A;  3VOU A;  1KB9 F;  2XND G;  3OMA B;  2R9R B;  1AR1 B;  4IYI A;  2Q7H A;  4EKW A;  3CCU V;  3RVZ A;  1NJI W;  4TUY A;  1XUQ A;  3OEE G;  4RAI A;  4HNA B;  1BQZ A;  2JEX A;  2Q0O C;  1Q8I A;  4I9W A;  5DEC A;  1BCC H;  2QWP B;  2GUZ A;  2YIB A;  2GTS A;  2JJ1 G;  3ZMZ A;  5H2F Z;  2RMK B;  3ZHV A;  1KP2 A;  3ETQ A;  3HKE A;  4GLX A;  1I5X A;  4YXW G;  2F1M A;  1ZTE A;  4TV8 B;  4ZHQ B;  1Q7Y W;  2X7R B;  2HVK C;  4PEL A;  3OTF A;  1AIL A;  4LNU B;  1PL4 A;  2CTQ A;  1SET A;  1XMQ B;  2UUC O;  3IC7 A;  1WN7 A;  4MVU A;  5JH7 B;  4F4L A;  3L75 H;  1KU9 A;  2QM7 A;  4DV6 B;  4LF5 B;  3KCX A;  1HR0 O;  3NXS A;  1M93 A;  1P7G A;  1SQF A;  3SJC C;  4UCT A;  1GN3 A;  3QVN A;  1IBM O;  2IW5 A;  1XDC A;  4MVO A;  4EB6 A;  3CE2 A;  4CC5 A;  2QTS A;  1NZ6 A;  3HR0 A;  2ZIN A;  3AG3 C;  5FLX N;  3CEI A;  3H1K H;  4OPA A;  3L74 H;  1G6U A;  5GON A;  5F2V O;  4FK5 C;  1M90 W;  1N36 O;  1W0K G;  1TVK A;  1JFF A;  2WLI A;  1VQL V;  2YSU B;  1WAZ A;  4RWU A;  3QG5 A;  1HP8 A;  1Y4M A;  1M57 B;  3CD6 V;  1VQM V;  2LJ2 A;  4CH6 A;  5GTH Z;  2XAQ A;  3PJS K;  3E86 A;  2DYS C;  2HVJ C;  1R3L C;  4AHC A;  1GRJ A;  3OTO O;  4DV4 O;  2EIJ C;  2K1E A;  3P30 A;  4GKK B;  1WA8 A;  1NVP B;  4IHJ B;  1QHT A;  4BIU A;  1AP6 A;  3CHX A;  1JA8 A;  1XBL A;  1JMK C;  4DK0 A;  1VQ6 V;  4DO2 A;  2Q5Z A;  3M8A A;  5B5E Z;  4A5U B;  1VF6 A;  2B1I A;  1J5E O;  1KKD A;  3R66 A;  1FS0 G;  4W4L A;  2UUC B;  2WPD G;  3PN1 A;  5C93 A;  3JAL B;  3OR6 C;  4I9Q A;  5L3G A;  2F23 A;  2ZM6 O;  2QWN B;  4UCO A;  3ZHU A;  1VF7 A;  2LW1 A;  1MG1 A;  3ABM C;  1HR0 B;  1OHH G;  3K59 A;  1OCR B;  1ZX3 A;  3BFR A;  1IBM B;  2MW2 B;  3KG2 A;  3ASO B;  1HNZ O;  2ZR3 A;  4FIP C;  2H8P C;  2ETN A;  4DV1 B;  4DK1 A;  4X1K B;  2AHZ A;  4OXS A;  1SKV A;  4CH4 A;  4EEQ A;  2X6A A;  4JI5 B;  1N36 B;  2QWO B;  2UUB B;  1Y74 A;  1XNR O;  3R65 A;  4BW9 A;  1BL8 A;  3GWK C;  4XDL A;  4J11 A;  3JAR A;  1LUV A;  2E3C A;  4IIJ B;  3N2G A;  2IH4 A;  3CC2 V;  2QWR B;  5L3C A;  1KD1 W;  1L8D A;  5IYC O;  1VMG A;  3BPZ A;  3OW2 U;  3GB7 C;  5DED A;  2DMX A;  3JD0 A;  1M1K W;  3OTO B;  2YI9 A;  4UFZ A;  4DR6 O;  1XRE A;  4LP8 A;  3CRM A;  3LUT B;  3AG1 C;  1JX9 A;  4XDJ A;  2QDO A;  3TCU A;  1J5E B;  5H6R A;  3G6B A;  3MHS C;  3RWR D;  3RYF A;  5LHG A;  3N2K A;  4HBN A;  5CA1 A;  3X2Q C;  1HNX O;  1K8A W;  5TIS Z;  4EFE A;  3BHP A;  4DRX A;  3H9V A;  2YIA A;  2HEP A;  3CCE V;  2ZM6 B;  3RFR A;  2V7Q G;  1P49 A;  1Y6X A;  1MSW D;  3SPH A;  5LGN A;  2ZQM A;  1S77 D;  1XIL A;  3H1I H;  4LWS A;  2WLJ A;  1OV9 A;  2RQ6 A;  1HNZ B;  4KHP O;  4MVS A;  2A06 H;  3K03 A;  2GTA A;  2FL4 A;  3S3W A;  3OUS A;  1NKD A;  3ZMT A;  4DW1 A;  1WP7 A;  3ZHQ A;  2YEV B;  3OMN B;  2Y4U A;  2YC0 A;  3RYI B;  2ZE5 A;  3VQW A;  1XNR B;  2UU9 O;  2BE3 A;  5J2T B;  1ZLZ A;  1MSD A;  4U7N A;  4BIZ A;  3A0B Z;  2Q68 A;  1IBK B;  4LF8 O;  5IYB O;  5JJJ B;  2LQT A;  3FKS G;  2BOC C;  1NI8 A;  2DN9 A;  1L0L H;  2P67 A;  4JTD B;  2IH1 C;  3KZI Z;  4DR6 B;  1GK9 A;  5CBF A;  4K0K B;  5J2U A;  1XHX A;  4MS2 A;  4FLX A;  5CB4 B;  3K5N A;  2CAZ C;  3VQY A;  3FAV B;  3AG4 B;  4LFA O;  3SJQ C;  5IT9 N;  4YJ2 A;  2WAM A;  5C8Y A;  3RYH A;  1H38 A;  3B8M A;  1MZE A;  3CP1 A;  3EFF K;  1HNX B;  3WG7 C;  2A3Q A;  2QJ1 A;  2P7T C;  4Q6G A;  3DTU B;  2LP7 A;  5EBW C;  4UCR A;  5DN6 G;  2DYS B;  3Q4H A;  1XHZ A;  2UXN A;  4X65 O;  2FYU H;  4QNH B;  1GN2 A;  2YI8 A;  1KQS U;  4KHP B;  3SPG A;  4FZ1 A;  1RM1 C;  4RO2 A;  1BSM A;  1WLE A;  5LHH A;  2AW9 A;  4QE7 A;  1VF5 B;  4X1Y B;  2E76 B;  2GV9 A;  2W6I G;  1QBZ A;  1S5L Z;  3TET A;  2UU9 B;  4P9P A;  3SYO A;  2MK3 A;  1HNW O;  4LF8 B;  2AHY A;  4NTY A;  5D5Q A;  4X89 A;  4BAY A;  4GCZ A;  3SGI A;  4FLW A;  3HKC B;  2F4V O;  2Q8V A;  1E1Q G;  2UXD O;  1YEW A;  5KX5 A;  4O2B B;  2VQF B;  1YTF D;  1VQ8 V;  3L73 H;  3UM7 A;  4LFA B;  4O4J A;  4X64 O;  2M7W A;  1Z5V A;  2EIL B;  1NH2 B;  3IAY A;  1VQ4 V;  1JCH A;  1F4M A;  4R8C A;  3KKY A;  4FMT A;  4K35 A;  3ZJZ A;  5BMV A;  2UXC O;  4BR6 A;  1QLE B;  1FKA O;  1F23 A;  2DWE C;  4F6E A;  1RSO B;  4O4H A;  5B3S B;  4LF4 B;  3ZRX A;  1G1X B;  1PNM A;  5BXZ A;  1IZ3 A;  5KLV H;  4X9Q A;  2IH3 C;  1K3E A;  5CMU A;  2UUA O;  5LBQ A;  4W4K A;  5EZY B;  1SF9 A;  2ZR2 A;  1O9G A;  1G4Y B;  3JCU Z;  3LNM B;  3X2Q B;  4QPK A;  1MAB G;  4WFB V;  2ADM A;  1GN4 A;  4PA4 A;  1RP3 B;  3CXH F;  5EBM C;  1KEC A;  1W59 A;  4YJ3 B;  4KXR A;  4ZI7 B;  4E4E A;  4B3M O;  3TK1 A;  1HNW B;  1H2N A;  1MOF A;  2ZCE A;  1AJQ A;  2F4V B;  3CXC U;  5IYZ A;  2UXD B;  4JPR A;  2KQX A;  5E79 Z;  3F5W C;  3W7S A;  2WLL B;  2NNU A;  1WB8 A;  1AR4 A;  2NN4 A;  2Y4T A;  4J9Y B;  3CMA V;  3CCM V;  1AI5 A;  5H9C A;  3JAK A;  4PI2 A;  4ASU G;  1VQN V;  5FL7 G;  2ZKO A;  2JG3 A;  3I5D A;  2BTQ A;  2L35 A;  4X8A A;  2QGN A;  3JSL A;  1GM9 A;  2UXC B;  2H3O A;  3JAT A;  1VQO V;  4ZOL B;  3L71 H;  2P06 A;  4I0X B;  4PJ0 Z;  3T2M A;  1VP7 A;  5A2Q N;  4WFA V;  1K4D C;  3ZMS A;  2UUA B;  1IVS A;  3C3S A;  3H1L H;  4JF3 A;  4I50 A;  3WU2 Z;  5LMU O;  3E2E A;  3CRA A;  3E35 A;  1NTZ H;  1BS3 A;  1M57 C;  4HZ3 A;  5IWA O;  3UQ8 A;  4E2L A;  4LC1 A;  1IDS A;  4TSF G;  4JI3 O;  4B3M B;  5IJ9 B;  1PD3 A;  5A9G A;  1Q81 W;  4MTF A;  1P7B A;  3K0G A;  3IGA C;  4TUY B;  2OCH A;  1RM1 B;  3J7A U;  3O65 A;  1FFX A;  1Q5O A;  4H13 B;  1DF4 A;  3UT5 A;  2FTK A;  1K4C C;  5L3B A;  1P4R A;  1N32 O;  1N0N A;  5B1A C;  5KHK A;  1KYO F;  4LF6 O;  2GDS A;  3QO7 A;  3H01 A;  1OCR C;  3ZRW A;  1YIT V;  2PTM A;  4D7S A;  3MAQ A;  3ZED A;  1ARO P;  3G71 V;  3JYC A;  5CA3 A;  2XAH A;  4FLY A;  3STZ C;  5CBH A;  2Q7G A;  3CB2 A;  1K34 A;  4JI7 O;  1LNQ A;  3P32 A;  3SDL A;  4QGP A;  3D8C A;  3F5T A;  4PA9 A;  5JQG A;  1JJ2 U;  1AR5 A;  1W2B U;  4JV5 O;  4DR4 O;  2VWJ A;  3G67 A;  2Y0I A;  5LMU B;  1WP8 A;  5AG2 A;  4JAU A;  4JYC A;  4DYL A;  5IWA B;  4MT8 A;  4O4L A;  5EYP A;  1VAR A;  3BCC H;  4JI3 B;  3L72 H;  4UCS A;  2BSK B;  4R6Z A;  3VQX A;  1L1F A;  1BT8 A;  1KMI Z;  5GON B;  3OEH G;  1KUQ A;  1EBO A;  3OMI B;  3K08 A;  1JFF B;  3CRC A;  1QCE A;  4WFF A;  3E8B A;  4GYC B;  2DQ3 A;  2WLI B;  5KMG B;  4AI8 A;  4YIP A;  2K9P A;  1FJG O;  2R9A A;  2XAJ A;  2CTR A;  1N32 B;  1GM8 A;  2VQE O;  2M6Y A;  4LF6 B;  4I55 B;  3RW0 A;  3JAM N;  4FLU A;  4B3S O;  5K1X A;  5CA0 A;  2CGN A;  1WA8 B;  4UB8 Z;  3DSQ A;  4OGQ B;  1N8R W;  5D5P A;  4JI7 B;  3M7M X;  3BVO A;  4CH5 A;  2RN9 A;  3CPW U;  1I08 A;  4JV5 B;  3UCS C;  5FNV B;  1SZT A;  5HFL A;  1EN5 A;  4K8Z A;  2EBO A;  3RT3 C;  3LNN A;  3CJH A;  2R72 A;  5ITZ A;  4N21 A;  4DR1 O;  3APQ A;  1K5Q A;  3D36 A;  2R9I A;  2P90 A;  3AG4 C;  5KHG A;  1Y74 B;  1F7Y A;  3E22 A;  1OCO C;  2HG5 C;  1SA0 A;  3JAR B;  1JOY A;  3N2G B;  3OM3 B;  3IFX A;  5IYD O;  5FPO A;  1K73 W;  1H8H G;  2LGW A;  1FJG B;  4GT1 A;  4PV1 B;  3EVK A;  5H6Q A;  5KAI Z;  4Z1M G;  4J7J A;  3K58 A;  2VQE B;  2AZ0 A;  4CZZ A;  1GO3 F;  4B3S B;  4BWA A;  2ZIO A;  3SJA C;  4TOI A;  1B06 A;  2WSS G;  2X6B A;  4JI1 O;  3AG7 A;  4L8J A;  4JI2 O;  3RYF B;  4B3T O;  2YXH A;  5CA1 B;  3NR7 A;  2WA3 A;  3ICX A;  1AI7 A;  3AK2 A;  4DRX B;  5CN0 A;  4DUZ O;  3RBZ A;  5B1A B;  3FD9 A;  4XBF A;  1S3J A;  1R6N A;  1SQB H;  3LSS A;  1N33 O;  2IJK A;  2RCV A;  3RN4 A;  4RQF A;  4LWS B;  2Q73 A;  2FML A;  4P2Z A;  4X66 O;  2LW7 A;  2A7W A;  2JS3 A;  2EZP A;  1MMM A;  2RDC A;  3LDE A;  2QSA A;  2XAF A;  5LOV A;  3TGU H;  4CS3 A;  5LMN O;  2PI5 A;  4DV2 O;  1SES A;  3KCY A;  1VQ7 V;  4KL1 A;  1AQI A;  2EIL C;  2QWQ B;  1B04 A;  2CGO A;  4FFB B;  4DV0 O;  2HJD A;  3G6E V;  2XHB A;  4FZ0 A;  1SQX H;  1Y66 A;  1QLE C;  3GVM A;  4UVB A;  5B1B B;  3BY6 A;  4DV4 B;  1N0J A;  5B3S C;  1VQ9 V;  5J2U B;  3FYI B;  4JYB A;  5HFM A;  4DUY O;  3K79 A;  3EXA A;  3WB0 A;  1HDJ A;  3JD4 A;  1GAX A;  4JI1 B;  2E5L O;  2CE4 A;  4JI2 B;  5C8Y B;  4B3T B;  1AI6 A;  3A8T A;  3RYH B;  1IUR A;  2ZD9 A;  3ZCC A;  2JS5 A;  4DUZ B;  5LP6 A;  3Q4H B;  2DYR B;  5B66 Z;  3HKB A;  3WFV A;  3TJT A;  1N33 B;  1OCZ B;  1XEQ A;  4IT5 A;  2JVD A;  4X66 B;  1H2L A;  1Q6I A;  1FXK A;  4FJC C;  4P30 A;  1TUB A;  3JAL A;  2ITD C;  3BA8 A;  3ZS8 C;  2Q0A A;  1WPB A;  5KAF Z;  4WFH A;  4NR1 A;  1O9H A;  3OD4 A;  4NYK A;  4EFB A;  5LMN B;  1ZUQ A;  4DV2 B;  2UXX A;  3J80 N;  4GX1 A;  2IU3 A;  3I55 V;  4MVZ A;  5DM6 V;  3U10 A;  3K57 A;  3QO8 A;  1AI4 A;  2KKW A;  5EIB C;  4DV0 B;  2FKX A;  2W0F C;  3B09 A;  1MA1 A;  4J9Z B;  4WCE V;  4JI0 O;  2ZE8 A;  4X88 A;  4J7K A;  3CME V;  3MHH C;  5JCO A;  3ZMV A;  2EIM B;  1TA8 A;  1ROP A;  2Q7E A;  5L3E A;  2OCC B;  4R7C A;  5KX5 B;  1GM7 A;  2ZDI A;  2OIE A;  4DUY B;  4WBN A;  3JAW A;  1GTO A;  1BE3 H;  1WJZ A;  1YVW A;  4O4J B;  1BHA A;  2E5L B;  1US6 A;  1THZ A;  5JVD B;  1OCO B;  5JJE B;  4B3R O;  4X62 O;  5BMV B;  2HP8 A;  4BIO A;  2P6J A;  2Q4P A;  4O4H B;  4NXN O;  2HFE C;  2ATK C;  3ABT A;  3JCZ A;  4LFC O;  2RNB A;  4KP4 A;  2IH5 A;  3L9D A;  3THO A;  4F6R A;  1SER A;  1IXB A;  1AJN A;  4HYO A;  4ABM A;  4CS2 A;  1PPJ H;  5B1O A;  1COW G;  4J42 A;  4LCU C;  1LR1 A;  2RJZ A;  4I5S A;  2IBZ H;  4GX5 A;  2EIK B;  4NVP A;  2P4V A;  1NS1 A;  1X4T A;  4JI6 O;  3FB7 C;  2JK5 C;  2XTA A;  4G2K A;  4JI8 O;  3A2F A;  5IYZ B;  4JZG A;  1SRY A;  1QNM A;  4I4T A;  3CC7 V;  4YHH O;  4ZIB A;  1J95 A;  3K9S A;  4QPJ A;  5J2T A;  2ZE7 A;  1NQT A;  4PHZ A;  2OTJ V;  4G28 B;  4O4I A;  1M56 C;  3JAK B;  1U97 A;  2ADQ B;  3E89 A;  3W7W A;  4J41 A;  1XNQ O;  4B3R B;  1H2S B;  5EC2 C;  3CYO A;  1K9M W;  1XI1 A;  2OIG A;  2N04 A;  2F95 B;  1YHQ V;  1UJW B;  4X65 B;  1EN6 A;  5FPR A;  4DR3 O;  5KA5 A;  4JGS A;  3D36 C;  4NTX A;  4LFC B;  1JR9 A;  2R70 A;  1Y76 A;  4I50 B;  2B5U A;  2LFS A;  2Z0A A;  3E8G A;  3CCS V;  4J80 A;  2JDI G;  1R1B A;  3ZX6 A;  4DR2 O;  1K97 A;  2G38 A;  1D5N A;  2IU0 A;  2N05 A;  3MD0 A;  3ABL B;  1OJH A;  3OE7 G;  4LF9 O;  1FPO A;  1R3J C;  3HPL C;  3ZMU A;  3OFN G;  5EBL C;  1HWY A;  3ZBH A;  1K7D A;  3RVY A;  1XMO O;  4JI6 B;  4U7O A;  1N34 O;  2OWO A;  4JYA O;  1DF5 A;  2W0X A;  4O2A B;  4JI8 B;  1VF6 C;  4GX2 A;  4U3J B;  4PA6 A;  4YHH B;  1FFX B;  3K0D A;  3T1Y O;  5EK0 A;  3UO2 A;  3UT5 B;  2Z3Y A;  3HKD B;  4X64 B;  2IJH A;  1QU7 A;  2WLM A;  2WA4 A;  2DW4 A;  3ZRW B;  2QR4 A;  3ZHS A;  2JGD A;  1XL6 A;  2Q9L A;  2W6J G;  1PNK A;  4DR3 B;  3OR7 C;  4GUN A;  1H2G A;  2XAG A;  1FAF A;  1WNS A;  4LFB O;  1OZ0 A;  3RYC A;  3A0H Z;  1TAE A;  3JAS A;  2B9Z A;  4FLV A;  3WB2 A;  2N74 A;  3IJ4 A;  1GN6 A;  4DR2 B;  4JAA A;  1FXV A;  1Q86 W;  1RSO A;  2NP7 A;  4MVM A;  4O4L B;  1BMF G;  3O9O A;  1H8E G;  3AG2 C;  5EYP B;  1Z5W A;  4LF9 B;  4TV9 A;  4MVQ A;  2LO1 A;  1PP9 H;  1XMO B;  3DXR A;  3ZRV A;  1N34 B;  4JYA B;  3CRR A;  4LF7 O;  1UPG A;  2ZT9 B;  1URF A;  2EZO A;  4AQY O;  4OPH A;  4UXN A;  4MW8 A;  1JJO A;  3VBB A;  1PNL A;  4UV8 A;  1DGS A;  3LSU A;  3T1Y B;  1E79 G;  1B6Q A;  2WLK A;  2GUZ B;  5GW7 A;  1JPX A;  4ICG A;  1DTO A;  2LGQ A;  4K3A A;  2OT5 A;  4G27 B;  4RUF A;  3HKE B;  1SQP H;  3JD3 A;  4UCV A;  5BZB A;  5CA0 B;  1YZB A;  2WLL A;  4H44 B;  5IE9 A;  5IJ0 A;  3L70 H;  3ABU A;  2P22 C;  1V55 C;  4MW3 A;  1JVM A;  2A9H A;  1TUE B;  2X0L A;  4GKJ O;  1MZF A;  5LGU A;  4KUM A;  4LFB B;  1M56 B;  1RPR A;  3AEI A;  2LFR A;  2Y0P A;  1NTK H;  3F7V C;  3AK1 A;  1SQQ H;  5B1B C;  3SR2 C;  4EB6 B;  3CJH B;  1EFR G;  5ITZ B;  2XUM A;  4FLZ A;  2PGG A;  3C90 A;  4LF7 B;  3B40 A;  1G38 A;  2EJ7 A;  4X20 A;  2WLN A;  3T4Z A;  4AQY B;  1TVK B;  1YXB A;  3E22 B;  4C7U A;  2KG7 A;  2O57 A;  3ASN B;  1SA0 B;  1XQ8 A;  1FYJ A;  2XAS A;  1Q90 D;  1YCI A;  2BOB C;  3ETE A;  5KHI A;  5IJ9 A;  2ZE6 A;  1R73 A;  2D3O W;  2HHH O;  5KHH A;  4B08 A;  2DYR C;  4UUJ C;  1FFT B;  2JRI A;  5H5N A;  1OCZ C;  4X1I A;  2PZS A;  3JSN A;  2P5O A;  2V1D A;  4TQF A;  4AIL C;  2Y69 B;  3FB5 C;  5IY5 B;  5BR8 O;  2KB1 A;  4JTA B;  4GX0 A;  4H37 A;  2ODM A;  5IDJ A;  4LH7 A;  4J7Z A;  3WB1 A;  2JJ2 G;  1V54 B;  3DC5 A;  4GKJ B;  1SC5 B;  2YIB D;  4PA7 A;  4GKK O;  4WF9 V;  3T4D A;  3OKG A;  5LA6 A;  4DR4 B;  3CC4 V;  1NBM G;  4FLT A;  1XOU A;  2DWD C;  1ZL8 A;  2QE7 G;  1BZK A;  1SZX A;  2PF4 E;  3CCV V;  1KKC A;  4PD4 F;  4PDV A;  3TXQ A;  2F93 B;  2AXT Z;  1CPY A;  1F51 A;  2HR3 A;  2EIM C;  3P3P A;  2VWK A;  2JIZ G;  5LXT A;  4H33 A;  2OCC C;  2Q6A A;  4MSW C;  4K8X A;  3U0Z A;  1M5I A;  2NLJ C;  5LYJ A;  5LOV B;  1CP9 A;  2XT9 A;  3ZN0 A;  1Q43 A;  1P84 F;  3SYP A;  2CH7 A;  3JD1 A;  1PM9 A;  1ENV A;  3H1H H;  2BSK A;  5L3F A;  1Q3E A;  4DV1 O;  1I94 O;  4B7E A;  4NKG B;  3CSX A;  1SS3 A;  1QLN A;  3AG2 B;  1YJW V;  2HHH B;  1IBL O;  3GWO A;  4MTX A;  1ZWI C;  3P3N A;  4LH6 A;  4JI5 O;  2UUB O;  1I7F A;  1NU1 H;  4HNA A;  3SYC A;  1Q82 W;  2X6C A;  4DV5 O;  5KMG A;  4DV3 O;  5BR8 B;  2GSM B;  3OAA G;  3JD2 A;  4XDK A;  3FFQ A;  2ZXW C;  3N2K B;  1PL0 A;  2ZIM A;  5JWP A;  4I55 A;  2ARH A;  1VQ5 V;  1L0N H;  5LP6 B;  2EIK C;  3FX7 A;  2C2A A;  1YJ9 V;  1BHB A;  4U3F H;  3HKB B;  4TV8 A;  4ZHQ A;  3E8H A;  2KSD A;  4DV7 O;  5GTI Z;  2B1G A;  4LNU A;  4TWK A;  4UVC A;  2PY5 A;  1RPO A;  4MVR A;  4PDL A;  1FXK B;  1TUB B;  5JH7 A;  1S0V A;  1IXM A;  2PYL A;  1V55 B;  4FM1 A;  2L6L A;  3OGI B;  4CH3 A;  2ZNI A;  3ZRS A;  4JYY A;  4DR1 B;  5FNV A;  4P9O A;  4DXW A;  2AGA A;  1V9P A;  4FFK A;  4DR5 O;  4ZKI A;  1S5J A;  1NT2 B;  2PYJ A;  4WFE A;  4RQE A;  5B1N A;  2A0L A;  4NB5 A;  3SYQ A;  1I94 B;  1G8M A;  4JAS A;  1IBL B;  1BGY H;  2E74 B;  4KFM A;  3E83 A;  4MTG A;  3ABK B;  4IL6 Z;  4HAM A;  1A32 A;  3W7U A;  4DV5 B;  2CK3 G;  3OGC C;  2E75 B;  4WBN B;  4DV3 B;  3JAW B;  4QIW F;  1QR9 A;  2Z5U A;  1IBK O;  1WPX A;  4B7K A;  4YJ2 B;  3E8F A;  1W0J G;  1R3K C;  3BEH A;  1X59 A;  2VS0 A;  1EZJ A;  4K0K O;  3N27 A;  4IHJ A;  2DOS A;  3ABL C;  3UO3 A;  1VIB A;  1KBH A;  3STL C;  1QR8 A;  1M9N A;  1YSC A;  4DV7 B;  1NVP D;  4FPP A;  1H2K A;  3G4S V;  2ADP A;  2ZNJ A;  3DGE A;  1YIJ V;  3K5O A;  2QKA A;  4J10 A;  4F6R B;  3W7T A;  1NR1 A;  1S76 D;  2FB5 A;  5LL6 Y;  4DR5 B;  2WWW A;  3M99 B;  1HW7 A;  1AB3 A;  1K33 A;  3K5L A;  3DC6 A;  4Z1V A;  4X1K A;  1QQC A;  1YTF B;  1K5S A;  2GBO A;  3ETG A;  1K92 A;  2CDY A;  3FB8 C;  3W7X A;  1I0H A;  2NR5 A;  4I4T B;  2YXY A;  3U11 A;  4D7T A;  3F7Y C;  4IIJ A;  4FFB A;  4O4I B;  1MNG A;  3FYE B;  3RGB A;  4LR3 A;  1IX9 A;  3BAA A;  4MTO A;  4CBC A;  2CUG A;  2H94 A;  3AG3 B;  3B4S A;  1JQ0 A;  2QM4 A;  2VQF O;  1R6T A;  5LHI A;  1OCC C;  4R50 A;  4FVM A;  2JEU A;  3FB6 C;  2DE0 X;  3CCR V;  1VQK V;  5J9P C;  3SPI A;  2QTO A;  1PKX A;  3K04 A;  4CC6 A; 
#chains in the Genus database with same CATH homology
 1YF2 A;  3OKG A;  1YDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...