1YDXA

Crystal structure of type-i restriction-modification system s subunit from m. genitalium
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
374
structure length
374
Chain Sequence
MTPKLKLNNNINWTKRTIDSLFDLKKGEMLEKELITPEGKYEYFNGGVKNSGRTDKFNTFKNTISVIVGGSCGYVRLADKNFFCGQSNCTLNLLDPLELDLKFAYYALKSQQERIEALAFGTTIQNIRISDLKELEIPFTSNKNEQHAIANTLSVFDERLENLASLIEINRKLRDEYAHKLFSLDEAFLSHWKLEALQSQMHEITLGEIFNFKSGKYLKSEERLEEGKFPYYGAGIDNTGFVAEPNTEKDTISIISNGYSLGNIRYHEIPWFNGTGSIALEPMNNEIYVPFFYCALKYLQKDIKERMKSDDSPFLSLKLAGEIKVPYVKSFQLQRKAGKIVFLLDQKLDQYKKELSSLTVIRDTLLKKLFPDMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Putative Type I Restriction-Modification S Subunit from Mycoplasma genitalium
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Dna binding protein
molecule keywords type I restriction enzyme specificity protein MG438
total genus 109
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2004-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01420 Methylase_S Type I restriction modification DNA specificity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1120 Mainly Alpha Orthogonal Bundle Helix Hairpins Bipartite methylase S protein 1ydxA02
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA03
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 1ydxA01
1YDXA 3OKGA 1YF2A
chains in the Genus database with same CATH superfamily
1LUVA 2BOCC 3T1CA 1PV0A 2F66C 3ZS8C 1FYJA 1Q81W 3CRMA 4AQYO 4IYHA 2KQXA 5TISZ 4XBFA 5H5NA 1KD1W 1PP9H 1YSCA 5BXZA 3ZMTA 2Q7EA 4DR5B 4JI2O 1ROPA 4FK5C 4B3RO 3FB5C 1F4MA 4J10A 3APOA 1RSOA 1Y74A 3JARA 3EVKA 4J9ZB 5FL7G 1XHZA 1VP7A 1LNQA 4UXNA 4J9YB 4F4LA 3UT5A 1NTKH 3GWOA 4W4KA 1BZKA 2MK3A 2UXCO 5IY5B 1Z5VA 1PM9A 2AGAA 4X62O 1I5YA 4JPRA 4FFBB 4FZ0A 2JG3A 4LF7B 1KP2A 2OIEA 3D36A 3CCQV 2N74A 1KUQA 3OD4A 4O4LA 1US6A 2UXNA 2F23A 1K9MW 2VQEB 3CCLV 5IYBO 4P2ZA 3B09A 3TCUA 3ABUA 2PY5A 1IZ3A 1WB8A 4IIJA 4JZGA 2ADPA 4LF8B 5L3FA 1S0VA 3ZCCA 4CC6A 3CCUV 3SYPA 2QM7A 1ZLZA 2CK3G 5CA0A 3OTOO 4PV1B 3T4DA 4X89A 1JPXA 3RYFB 2P4KA 1VQOV 1X4TA 2Z5UA 3OUFA 2YIBD 3ZEDA 1R6TA 4K8XA 1I5XA 1PD3A 3H1HH 1UPGA 3VQXA 2Q5ZA 4CH5A 1KKDA 2IM9A 2JIZG 3C3TA 1Y76A 5IJ0B 1XNRB 4OPAA 1QBZA 2F4VB 1OCCB 4OX9O 2BCCH 2A9HA 2WLLA 1IBLB 3L75H 5C8YA 1K34A 3CCJV 1FFXA 1VQ6V 4DR6B 2OT5A 2H3OA 4G27B 3FB7C 4LP8A 2PF4E 5FNVA 5IJ9B 4I50B 4WCEV 3W7TA 3BAAA 3U10A 3CSXA 1CPYA 4P9OA 3E22A 5JCOC 5CN0A 5GW7A 3T1YO 1L1FA 2YIDA 1N4CA 2LGQA 4IYIA 3K03A 3CXHF 1PL0A 2EIJC 4QNHB 2XOKG 1PNLA 3EXAA 3AG1C 1FFTB 2KB1A 3SDLA 1NZ6A 1VQNV 1S5JA 1VF6C 4LF5O 1NVPD 3STZC 1NR7A 2YEVA 3OAAG 2RMKB 4RWUA 2CUGA 5LP6B 5KUKA 2JS5A 3E83A 3BA8A 1K5SA 1P84F 4PI2A 1N36B 5EC2C 1V9PA 3GVMA 2HLDG 2UXDB 3UM7A 4K8ZA 1OCOC 3RT3C 2BSKB 1Y76B 2LJ2A 4ICGA 3CHXA 4FLXA 5IWAO 3DXRB 4GUNA 5DEDA 2X0LA 3ZMZA 4UCTA 4N23A 4LFCO 3DC6A 3J7AU 3C3SA 1W59A 3GB7C 2NLJC 1Q82W 4TUYB 4GX0A 1MMMA 4EFEA 4I9WA 2BTOA 3SYQA 5J2UB 4LWSB 4CH4A 4LFAB 2WA3A 4YJ2A 4X1IB 4WBNA 5J2TB 2F95B 2ZR2A 4UFZA 2RJZA 4FZ1A 2HJDA 4O4LB 5CBFA 1ZAUA 1BQZA 2B1IA 4LF9B 3ZMUA 5LXTA 1AP5A 1JJOA 4MVRA 2FYUH 4LFBO 4Z1MG 1YEWA 3SPIA 3N2GA 4DV1B 3D3QA 3BHPA 1HNXO 2K1EA 3RN4A 1NH2D 2X6CA 1N8RW 1G6UA 1J5EO 1XNQB 3SJAC 1R1BA 3AG1B 2CE4A 1XEQA 3Q4HA 1N34O 2AZ0A 2JDIG 1CXZB 3JAWB 3WB2A 1HNWO 2WLKA 4UCUA 4CS3A 5J2TA 2F93B 3STLC 1N33O 1GM7A 4FVMA 5JWPA 4XDKA 4PA7A 3T2MA 3FX7A 4UB8Z 1YIJV 4DUYB 2XAHA 3JAKB 1QLEC 4RAIA 1BHAA 3R66A 1R6KA 2IU3A 2QM4A 1VARA 2R72A 2UXXA 3HKEA 4X1YA 3K59A 3ZRXA 4LNUB 5B1BC 1B06A 3DC5A 2G38A 2NNUA 1GAXA 1QU7A 4FLUA 2BSKA 5B3SB 3CXCU 1AILA 1EFRG 5KX5A 1MNGA 3CCSV 1FXKC 3AG2B 2R9IA 2IJKA 1AI4A 4DYLA 2AXTZ 2E3CA 3R65A 2QE7G 4DUZB 4YHHB 3ZJZA 3LUTB 4GT1A 3K5MA 4B3RB 3ABMC 2P22C 3IC7A 4PDVA 5A2QN 1ZUQA 4GKJO 2ZINA 4YY3O 5B3SC 2PI4A 1WP7A 2GUZB 2CGOA 4GYCB 2UXCB 1S5HC 2GHYA 5LL6Y 2E5LB 4J7JA 3OUSA 3DGEA 4X62B 3H01A 3UO2A 3PJSK 4JI3O 2FMLA 2ILMA 2VQEO 1XHXA 4FLVA 1S3JA 2P7TC 1JFFA 3K5NA 1OJHA 4K0KB 1OHHG 4DV0O 1JA8A 3SJBC 4GLXA 4X66O 2ZD9A 2XUMA 1XOUA 3JATA 1P7BA 4I5SA 1WA8A 4XDLA 3HKCB 4DR3O 2JJ1G 4TT3G 1R3IC 3RYIB 4K3AA 3BABA 4YIPA 2YXYA 2NN4A 3BVOA 3L72H 4GZRB 4JYAO 4TWKA 1G1XB 4NTWA 2CAZC 1KECA 4DV7B 1IBLO 2ZR3A 4B08A 4WFFA 5AG2A 4P9PA 1M57C 4YIOA 3ZHUA 1PKXA 2WLMA 4B3TO 5L3GA 4LF4B 2Y4UA 5BMVA 2X6AA 4D7TA 2JEUA 1QVGU 3DSQA 4HAMA 4LWSA 3CMAV 3KCYA 1TUEB 5H9CA 2DW4A 1PNKA 3H9VA 2OYQA 2FTKA 4JI8B 3WU2Z 1AI7A 4JGSA 1AB3A 3F5WC 3JD4A 1SRYA 3H1KH 1S5LZ 2A3QA 3MHHC 5LYJB 2E76B 4FPPA 4DRXA 1XMQB 4ZIBA 2XAJA 1BE3H 1R3LC 2RDCA 2UXDO 3RBZA 3SJCC 4D6TH 1F23A 5IY5C 4E4EA 1JX9A 1VF6A 4NXNB 2V7QG 4LCUC 1THZA 4ASUG 1H2MA 4ZOLB 3C90A 3ICXA 2UUAB 3IC9A 5KHGA 2WLNA 3HKBB 5LMNO 2PTMA 3G6EV 4WF9V 4KHPB 2Q73A 1GKFA 1R3KC 4JZ2A 1Q8IA 5EBLC 2GUZA 3MAQA 5EK0A 1VQPV 1GN4A 2ZE6A 2IBTA 1NBMG 5H6RA 4DR1B 1XUQA 1PL4A 2Y0PA 5BMVB 4PJ0Z 1VQKV 1QR8A 3FB8C 4IHJA 2EJRA 2YUAA 3PN1A 1E79G 1K73W 3AK2A 1SZXA 1FPOA 1SQQH 3VQVA 4XDJA 2ZE8A 4TQDA 2QR4A 1EN6A 4DO2A 4P30A 4DV1O 2CTPA 2F1MA 1HNXB 2OWOA 4DV2B 1HNZB 1TGOA 1W0JG 1O9HA 4JI7B 4U3FH 3G6BA 4B7EA 3P3PA 3EHBB 1XNQO 1N34B 1SF9A 3NR7A 4O2AB 4MT8A 2CDYA 1E1RG 1SS3A 3THOA 1ZL8B 4OPHA 4DV3B 1N33B 1VMGA 3CRQA 3VBBA 3ZRVA 5LMUO 1YVWA 1SQBH 1OV9A 4PA9A 3ZRSA 4NVPA 2BTQA 4Q20A 2QA4V 1G4YB 2YICA 3FFQA 2CTRA 3AG3B 3SR2C 2HJFC 1SA0B 4ZHQB 1SQFA 4DR5O 5CA1A 3G80A 4QPKA 4TV8A 3Q4HB 4BIUA 4J7KA 4X1IA 4O4JB 4LC1A 3OT7A 5DM6V 1YXBA 1DF4A 1HP8A 2CH7B 3LDDA 2B1GA 1YF2A 3JASA 2ZNJA 3SGIA 1RPOA 4MVQA 3W7WA 1WP8A 4I0XB 3APQA 3LSUA 5K1XA 4U7NA 2IJIA 1AR4A 3FKSG 2P67A 4TUYA 3E35A 3JSLA 2W0XA 3AG3C 3EFFK 4LF7O 2EINB 1TVKB 1SESA 3OMNB 4JI1B 1N32B 2BE3A 2GDSA 1Q6UA 2WLIA 2LQTA 4Z2WA 4YHHO 2OIGA 4O2BB 2PGGA 4MW3A 1GMGA 4UCVA 4AILC 4B3MB 5CBHA 2KKWA 5HFLA 3RVZA 3JATB 3BRCA 5IYDO 5IYZB 1K33A 1M93A 2VS0A 3K0DA 1DK1A 3QTCA 2E5LO 2QWOB 1H2GA 1EM1A 5D5PA 5CA3A 3DTUB 1FD9A 1Z2GA 2EZPA 4FFKA 1QR9A 1A32A 4BR6A 4HNAA 4H44B 2UXBB 5FNVB 4JF3A 1WLEA 5IYCO 3BEHA 2ZDIC 4BIZA 5KMGB 1EZVH 2VWKA 5LOVA 4CH6A 3A2FA 4R8CA 4Q6GA 4HZ3A 3QO8A 1URFA 4J42A 2ZM6O 3BY6A 1YI2V 3KKYA 3ZMSA 1MA1A 5LOVB 2P90A 2ZE7A 1TVKA 2XAGA 4DV7O 4RO2A 2CGNA 2DYRB 3ZN1A 4I55A 2Q9LA 3ZIAG 1BSMA 2WLJA 4MTOA 5F2VO 2OCHA 1XL6A 3QO5A 2ZCEA 3JASB 4B3TB 4WFHA 3E8HA 3ETQA 3JYCA 1F7YA 4LF6O 3K5OA 3ZHTA 4O4IB 5KHHA 1E1QG 1QQCA 4WBNB 5EYPB 1FXKB 4X20B 4NR1A 3L74H 5LHIA 5EBWC 1J95A 3WG7C 3ABLC 5IWAB 4JI8O 4ZKIA 3X2QB 2JGDB 5JJJB 4LFCB 4ZI7A 3CS5A 2ITCC 2ZIMA 2XNDG 1K4CC 4MVUA 2LFRA 4PDMA 2X6BA 5CB4A 4J7ZA 1Q86W 1RP3B 4I0XA 4YXWG 1AR1B 3ABMB 3WG7B 5KAFZ 4RQEA 4FLWA 1MZEA 1QLEB 4ZI7B 1COWG 1ENVA 1EBOA 1Q3EA 1FXHA 5KAIZ 3CMEV 1IXBA 1GRJA 3AG7A 1AJPA 5L3EA 2EIMB 1Z5WA 2JGUA 1Y6XA 3NXSA 2HVKC 3J81N 2VWJA 1AROP 4L8JA 3MDSA 1Y66A 4WFAV 3UT5B 1AI6A 1YJNV 1SKVA 4LBEC 1UJWB 4TV9B 2ITDC 1M1KW 1K8AW 4U3JB 3M7MX 3E22B 3G4SV 2QM8A 3D36C 4JAAA 1I08A 2LP7A 1HNWB 2AHZA 1U96A 3BFRA 1Q6HA 1WPBA 4KP4A 3M8AA 4NTYA 1IDSA 4O4HB 2KSDA 4I55B 2DOSA 1KU9A 3FB6C 3SPGA 2ODMA 3GWKC 4DW1A 2WLLB 2B9ZA 3ML0A 1HNZO 1V54C 4X65B 3VQWA 3CPWU 3RW0A 3F5TA 1B6QA 3A0BZ 4DW0A 2QKCA 4BW5A 2Q8VA 1W2BU 2Q7HA 3FYEB 2A06H 2V4DA 4F6EA 3LSSA 3HKDB 2L35A 1NTZH 1FAFA 2EIKB 4DXWA 5LMUB 4QJFB 1OCOB 1XREA 4UVAA 3K06A 2Q67A 5DN6G 3E8GA 2H94A 4B7KA 2DN9A 4IIJB 4NXMO 4DV5B 1IVSA 4JASA 3CCRV 4B3SO 1EZJA 3SYAA 4DR7O 2LW7A 4ABMA 2D2CB 1TA8A 2WLIB 4I50A 1R73A 4YY3B 4NYKA 4PD4F 2EZOA 4E2LA 4RUEA 3P30A 1M4UA 4FJCC 4D7SA 4LH6A 4FLZA 1VQ9V 4JI3B 1ORQC 3K08A 1YITV 4JYBA 2XAFA 2HHHB 4UV8A 3SJQC 1VQ8V 4EEQA 2JVDA 4X64O 1H2SB 5KHJA 1AP6A 1K97A 1VQLV 4JV5B 5FPRA 2M7WA 1YZBA 3RYIA 5L3DA 1AJNA 1MSWD 4K0KO 1T5EA 1SETA 4DK0A 4X66B 2UU9B 2UUBB 1VF5B 3LDCA 5KHKA 5L3BA 1S77D 1P49A 1NU1H 4DR3B 4GX2A 4O4JA 4DR2O 5IT9N 2PI5A 1HWYA 1ZL8A 4ZHQA 2EJ7A 4DR4B 1CP9A 4O4IA 3I55V 1ZWIC 3OR7C 3ZHVA 5KUMA 2IH1C 3CCVV 4X1KA 5EZYB 1VQ5V 1YCIA 4CS4A 5E79Z 2V1DA 1NH2B 2XHBA 1I94O 3U0ZA 2KG7B 1BGYH 1LUWA 1SZTA 3ABLB 1F4NA 4NKGB 3ZN0A 4GKKB 3B2EE 1H2NA 1RSOB 2ETNA 4RQFA 4ZOLA 3ZHQA 2LGWA 2MW2B 5GTIZ 2YI8A 3OTFA 2X7RB 2ZM6B 1NT2B 5JQGA 1B3QA 2HVJC 4JI6B 4X88A 1VQ4V 1OZ0A 1GO3F 4JAUA 4OXSA 5D5QA 1SC5B 5JQGB 3T4ZA 3RYCB 3CC4V 3RWRD 4X9QA 3F7VC 3J80N 4J11A 5B1AC 4X1YB 2PYLA 5FPOA 3RYHB 1QVFU 2DWDC 1WB7A 1IXMA 4TV9A 1NJIW 5L3CA 1XMQO 1GN6A 3IAYA 1FJGO 1I0HA 3ASNC 1DF5A 4FLYA 4JTAB 3HKBA 3BCCH 5LBQA 2UUCB 4YJ3A 2DQ0A 2ZKOA 3QNEA 4JI5O 1JOYA 2EILC 4DRXB 1BCCH 5LP6C 2CTWA 5B66Z 4NXNO 2Q7GA 2YS8A 4O2BA 4TQFA 2A7WA 2EINC 1KQSU 4FM1A 5JVDA 2YXHA 2Q0AA 2DYRC 4KHPO 1MABG 1ZTEA 4H33A 1TAEA 2Y69C 5CB4B 3HR0A 3O65A 3UO3A 4DV6O 4WFGA 5LA6B 3T1HB 3L73H 2ZXWC 3ETDA 4JTDB 1H8EG 5CA1B 2YIAA 2WWWA 3LNNA 2FL4A 1IBKO 2N05A 5ITZB 3S3XA 2LO1A 2JRIA 2BTQB 1OCRC 4BW9A 4LH7A 4IGGA 1GN3A 1PPJH 4MVMA 3ZHRA 1L8DA 1H38A 4JI7O 5EC1C 4KL1A 5BR8B 1GN2A 2W6IG 3KCXA 2QKAA 3JAMN 4GCZA 4I4TB 3UQ8A 5KA6A 1H8HG 4JI0B 4EB6A 2M6YA 4DV3O 2YXLA 1MZFA 4CBCA 5B1NA 3B40A 1WN7A 2IW5A 2WSSG 4MVOA 3ZHSA 3I56V 3W7UA 1AQJA 3HKCA 3JCZA 5JH7A 3A0RA 2R9AA 1Q6IA 4X65O 1BL8A 4C7UA 2WPDG 4RUFA 5LXTB 2E75B 3QO7A 3B8MA 4NTXA 1RM1B 1V54B 2A0LA 4ZBMA 3ZRWA 1G38A 4H37A 5LP6A 4JI4O 2QWQB 1MSDA 4UVCA 2EILB 2YDEA 1Q7YW 5IE9A 2Q6AA 3D3IA 3QVNA 4PA3A 3OKGA 4QE9A 5KLVH 5LGUA 4H13B 5LGTA 2DJVA 3LSQA 3O9OA 3F7YC 4J41A 1JFFB 2ATKC 4AQYB 3TXSA 1K4DC 2ADMA 3E89A 3W7SA 3CD6V 2Q0OC 4LNUA 4JI1O 1N32O 2NR5A 4NXMB 5EIBD 4DV5O 4PI0A 3ZMVA 1N0JA 4JI2B 5LHGA 1JQ0A 3OE7G 2Q69A 3CJHB 1KMIZ 1FXVA 3W7XA 4B3MO 2IH4A 5KHIA 2PZSA 3ASOC 1XQ8A 3JSNA 3OGIB 1HR0O 3K58A 1SQGA 1SQPH 2XAQA 1QHTA 3ABKB 1M9NA 3AG2C 2GTAA 5C8YB 2XT9A 1VF7A 3OW2U 4MW8A 2CTQA 2QKSA 2VQFO 3CWBH 3L71H 4X64B 1R3JC 2IH2A 3FAVB 3S3WA 2AHYA 3L70H 1AVMA 2QWPB 3E8FA 1WAZA 4LF8O 3IGAC 4PELA 4A5UB 2H8PC 2RNBA 4PDRA 2UXBO 1N0NA 3N2GB 5B5EZ 5JJNB 2HR3A 4EKWA 2UUBO 3OTOB 3RVYA 5BZBA 4KUMA 2DMXA 4HBNA 5EZYA 3MD0A 4DR2B 2YI9A 3HKEB 1YTFD 1MG1A 4JYYA 4DR4O 3X2QC 4PDLA 1XI1A 1SA0A 4DK1A 3E8BA 1XNRO 2WAMA 1DTOA 2F4VO 3ZBHA 2HP8A 3SYOA 1I94B 3K9SA 4GX1A 4DR6O 1FFXB 1FXKA 4X20A 4MTGA 4TSFG 2AW9A 2RQ6A 3JD1A 3G71V 4GKKO 1GK9A 4WFBV 2Q68A 3AK3A 2D3OW 2R9RB 3OMAB 1Y74B 3JARB 2BOBC 3QF7A 2Q4PA 4LF6B 3CP1A 3RFRA 3UCSC 2QSAA 4PHZA 3DXRA 5LA6A 3T1YB 4BAYA 1EN5A 4CC5A 4TOIA 2NP6A 4F6RB 1V55B 1IBMO 1BT8A 1ZSPA 1Q43A 3QG5A 1H2LA 5J2UA 3M99B 2EIKC 2VRZA 3CCMV 3FAVA 1VQMV 5DECA 4AI8A 3K04A 3FYIB 4IHJB 2QTSA 3ETGA 4JYCA 4LR3A 2P4VA 5CBGA 2L6LA 1YHQV 1GH6A 1VEWA 1FJGB 2C2AA 3TETA 4KXRA 4NB5A 2IBZH 3HKDA 3IJ4A 1GM9A 3CJHA 3KG2A 4JI5B 4K35A 2ADQB 1NKDA 4W4LA 3VOUA 3OEEG 4R50A 3UKMA 1H2KA 4X8AA 1K92A 2IH3C 3AK1A 1K3EA 5EIBC 5BY1A 2YEVB 2IH5A 3H1JH 5HFMA 3WB0A 3AG4B 5KX5B 4DV4O 5LHHA 2PYJA 4O4HA 1RM1C 3OMIB 4PA6A 5JCOA 5IJ0A 5JJEB 2Y69B 4HNAB 4QIWF 5LYJA 3T1HO 1DGSA 1WPXA 4CS2A 5C93A 5J9PC 2FB5A 3A0HZ 4R6ZA 3H1IH 2EBOA 3K0GA 1IBKB 3FD9A 3ABTA 4I9QA 3RYFA 3JAKA 4UCOA 1JR9A 4QGPA 1OCCC 5IYZA 4X1KB 1KYOF 5CMUA 1SQVH 3SPJA 5BR8O 4H0LB 1RPRA 2IJJA 5H6QA 1XMOO 2LFSA 1XL4A 3JAWA 1K7DA 3LDEA 1GTOA 2OTLV 4FM0A 1IX9A 5IJ9A 4GX5A 3SPHA 3CC7V 4JTCB 2QEXV 1LR1A 2IU0A 5B1OA 4F6RA 4J80A 4FLTA 2QJ1A 5JH7B 5ITZA 2PUSA 3L9DA 2HKOA 4MVZA 1RFYA 2ZXWB 2CH7A 3B4SA 2P06A 1AI5A 4G2KA 4B3SB 1MOFA 3OGCC 4DR7B 4UCRA 4EFBA 3ASNB 1AR5A 1NTMH 2QDOA 4UCSA 2B5UA 3B8NA 2GV9A 1M90W 1P4RA 4FFBA 1YDXA 1XDCA 1BQ0A 3JD3A 2HHHO 2HEPA 3VQYA 4DUZO 4O2AA 1NVPB 4WFEA 3K9AA 4JV5O 1GM8A 4FM2A 3SYCA 1W0KG 2EIMC 3HPLC 3SPCA 2DQ3A 2DWEC 4UUJC 1HW7A 4GKJB 2DYSC 4BWAA 4IL6Z 4I7ZB 1NI8A 2HFEC 1HR0B 2UU9O 2QGNA 2Y48A 3CE2A 1AJQA 3JALA 3CC2V 1FKAO 3RYHA 3ABKC 4OGQB 2N04A 2VQFB 5JVDB 1XILA 3P3NA 1OCRB 2A79B 5A9GA 1Q90D 3ZRWB 5B1AB 2R70A 5GONA 4N21A 3CEIA 2QTOA 2DYSB 2XASA 1YTFB 5KMGA 3TGUH 2OCCB 4DV0B 4OX9B 4YJ3B 5GTHZ 2GSMB 3AG4C 1R6NA 2W0FC 3K79A 1HDJA 3G67A 4KFMA 2ZNIA 4MVSA 1NR1A 3JCUZ 1F51A 3ETEA 1X59A 3U11A 1JVMA 4MTXA 3MHSC 4R7CA 2P6JA 4G28B 3TXQA 3CB2A 4I4TA 4JYAB 2OTJV 4JI6O 3RYCA 2EIJB 1WNSA 1IURA 1AQIA 1VIBA 4HYOA 3HB3B 1P7GA 1YJ9V 2GTSA 2KG7A 3P32A 1S76D 4QE7A 4CH3A 1KKCA 1D5AA 2YIBA 3WB1A 3JD0A 2F43G 4QPJA 1KP3A 3CYOA 3H1LH 4UVBA 4LF5B 1YJWV 3JD2A 2FKXA 5FLXN 4LF4O 2JJ2G 1B04A 1U97A 2JS3A 1N36O 3LNMB 3KZIZ 5LGNA 3JALB 3N2KB 3OEHG 1TUBA 2AZ2A 5CA0B 1SQXH 2QWRB 1S72V 1IBMB 1CEZA 1KBHA 4AHCA 2UUCO 1Q5OA 1XBLA 2IJHA 3CX5F 1D2DA 4EB6B 2WA4A 4TV8B 4PA4A 2EULA 3I5DA 2JGDA 1QCEA 2EX3A 2Y0IA 1QNMA 1NS1A 2ZT9B 3CCEV 1M56C 2YSUB 1WA8B 4JAVA 4YJ2B 2Z3YA 3BPZA 3IFXA 4LFAO 1OCZC 5EYPA 3WFVA 1G8MA 2RN9A 5K1PA 4DV6B 2ARHA 2HG5C 3A8TA 3AEIA 4CZZA 2Z0AA 4FMTA 3OM3B 1DLBA 1UFIA 5IDJA 3RGBA 4BIOA 1SERA 1VQ7V 1KB9F 2ZQMA 2E74B 1M56B 3CRCA 1KC8W 4LF9O 2UUAO 5B1BB 5E1AC 3BA9A 2XTAA 5LMNB 2YC0A 4LFBB 3E2EA 1D5NA 1TUBB 3N2KA 5KA5A 3ZX6A 1PNMA 4DV4B 2JEXA 1ZX3A 3TJTA 2RCVA 2Y4TA 4U7OA 1M5IA 1L0NH 5EBMC 1FS0G 1L0LH 1J5EB 2W6JG 3K57A 2WLHA 5GONB 4DR1O 1Y4MA 1Y67A 1O9GA 4MS2A 3OFNG 1NQTA 3K5LA 5H2FZ 4MTFA 4JI0O 2NP7A 2JK5C 3OR6C 2ZDIA 4MSWC 1M57B 2OCCC 1BMFG 1QLNA 3TK1A 1BS3A 1BHBA 2IBSA 4UV9A 2K9PA 3ASOB 1JCHA 4DUYO 2ZE5A 4FIPC 1JMKC 1K5QA 2O57A 3B77A 4DV2O 2LW1A 3E86A 2ZIOA 1I7FA 4L87A 3K3WA 1WJZA 1XMOB 2DE0X 3D8CA 4Z1VA 4JI4B 4IT5A 3N27A 3CRAA 4U3JA 4UB6Z 2GBOA 2P5OA 1V55C 1OCZB 2QWNB 3CRRA 1JJ2U 1EN4A
chains in the Genus database with same CATH topology
1YDXA 3OKGA 1YF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDX A;  3OKG A;  1YF2 A; 
#chains in the Genus database with same CATH topology
 1LUV A;  2BOC C;  3T1C A;  1PV0 A;  2F66 C;  3ZS8 C;  1FYJ A;  1Q81 W;  3CRM A;  4AQY O;  4IYH A;  2KQX A;  5TIS Z;  4XBF A;  5H5N A;  1KD1 W;  1PP9 H;  1YSC A;  5BXZ A;  3ZMT A;  2Q7E A;  4DR5 B;  4JI2 O;  1ROP A;  4FK5 C;  4B3R O;  3FB5 C;  1F4M A;  4J10 A;  3APO A;  1RSO A;  1Y74 A;  3JAR A;  3EVK A;  4J9Z B;  5FL7 G;  1XHZ A;  1VP7 A;  1LNQ A;  4UXN A;  4J9Y B;  4F4L A;  3UT5 A;  1NTK H;  3GWO A;  4W4K A;  1BZK A;  2MK3 A;  2UXC O;  5IY5 B;  1Z5V A;  1PM9 A;  2AGA A;  4X62 O;  1I5Y A;  4JPR A;  4FFB B;  4FZ0 A;  2JG3 A;  4LF7 B;  1KP2 A;  2OIE A;  3D36 A;  3CCQ V;  2N74 A;  1KUQ A;  3OD4 A;  4O4L A;  1US6 A;  2UXN A;  2F23 A;  1K9M W;  2VQE B;  3CCL V;  5IYB O;  4P2Z A;  3B09 A;  3TCU A;  3ABU A;  2PY5 A;  1IZ3 A;  1WB8 A;  4IIJ A;  4JZG A;  2ADP A;  4LF8 B;  5L3F A;  1S0V A;  3ZCC A;  4CC6 A;  3CCU V;  3SYP A;  2QM7 A;  1ZLZ A;  2CK3 G;  5CA0 A;  3OTO O;  4PV1 B;  3T4D A;  4X89 A;  1JPX A;  3RYF B;  2P4K A;  1VQO V;  1X4T A;  2Z5U A;  3OUF A;  2YIB D;  3ZED A;  1R6T A;  4K8X A;  1I5X A;  1PD3 A;  3H1H H;  1UPG A;  3VQX A;  2Q5Z A;  4CH5 A;  1KKD A;  2IM9 A;  2JIZ G;  3C3T A;  1Y76 A;  5IJ0 B;  1XNR B;  4OPA A;  1QBZ A;  2F4V B;  1OCC B;  4OX9 O;  2BCC H;  2A9H A;  2WLL A;  1IBL B;  3L75 H;  5C8Y A;  1K34 A;  3CCJ V;  1FFX A;  1VQ6 V;  4DR6 B;  2OT5 A;  2H3O A;  4G27 B;  3FB7 C;  4LP8 A;  2PF4 E;  5FNV A;  5IJ9 B;  4I50 B;  4WCE V;  3W7T A;  3BAA A;  3U10 A;  3CSX A;  1CPY A;  4P9O A;  3E22 A;  5JCO C;  5CN0 A;  5GW7 A;  3T1Y O;  1L1F A;  2YID A;  1N4C A;  2LGQ A;  4IYI A;  3K03 A;  3CXH F;  1PL0 A;  2EIJ C;  4QNH B;  2XOK G;  1PNL A;  3EXA A;  3AG1 C;  1FFT B;  2KB1 A;  3SDL A;  1NZ6 A;  1VQN V;  1S5J A;  1VF6 C;  4LF5 O;  1NVP D;  3STZ C;  1NR7 A;  2YEV A;  3OAA G;  2RMK B;  4RWU A;  2CUG A;  5LP6 B;  5KUK A;  2JS5 A;  3E83 A;  3BA8 A;  1K5S A;  1P84 F;  4PI2 A;  1N36 B;  5EC2 C;  1V9P A;  3GVM A;  2HLD G;  2UXD B;  3UM7 A;  4K8Z A;  1OCO C;  3RT3 C;  2BSK B;  1Y76 B;  2LJ2 A;  4ICG A;  3CHX A;  4FLX A;  5IWA O;  3DXR B;  4GUN A;  5DED A;  2X0L A;  3ZMZ A;  4UCT A;  4N23 A;  4LFC O;  3DC6 A;  3J7A U;  3C3S A;  1W59 A;  3GB7 C;  2NLJ C;  1Q82 W;  4TUY B;  4GX0 A;  1MMM A;  4EFE A;  4I9W A;  2BTO A;  3SYQ A;  5J2U B;  4LWS B;  4CH4 A;  4LFA B;  2WA3 A;  4YJ2 A;  4X1I B;  4WBN A;  5J2T B;  2F95 B;  2ZR2 A;  4UFZ A;  2RJZ A;  4FZ1 A;  2HJD A;  4O4L B;  5CBF A;  1ZAU A;  1BQZ A;  2B1I A;  4LF9 B;  3ZMU A;  5LXT A;  1AP5 A;  1JJO A;  4MVR A;  2FYU H;  4LFB O;  4Z1M G;  1YEW A;  3SPI A;  3N2G A;  4DV1 B;  3D3Q A;  3BHP A;  1HNX O;  2K1E A;  3RN4 A;  1NH2 D;  2X6C A;  1N8R W;  1G6U A;  1J5E O;  1XNQ B;  3SJA C;  1R1B A;  3AG1 B;  2CE4 A;  1XEQ A;  3Q4H A;  1N34 O;  2AZ0 A;  2JDI G;  1CXZ B;  3JAW B;  3WB2 A;  1HNW O;  2WLK A;  4UCU A;  4CS3 A;  5J2T A;  2F93 B;  3STL C;  1N33 O;  1GM7 A;  4FVM A;  5JWP A;  4XDK A;  4PA7 A;  3T2M A;  3FX7 A;  4UB8 Z;  1YIJ V;  4DUY B;  2XAH A;  3JAK B;  1QLE C;  4RAI A;  1BHA A;  3R66 A;  1R6K A;  2IU3 A;  2QM4 A;  1VAR A;  2R72 A;  2UXX A;  3HKE A;  4X1Y A;  3K59 A;  3ZRX A;  4LNU B;  5B1B C;  1B06 A;  3DC5 A;  2G38 A;  2NNU A;  1GAX A;  1QU7 A;  4FLU A;  2BSK A;  5B3S B;  3CXC U;  1AIL A;  1EFR G;  5KX5 A;  1MNG A;  3CCS V;  1FXK C;  3AG2 B;  2R9I A;  2IJK A;  1AI4 A;  4DYL A;  2AXT Z;  2E3C A;  3R65 A;  2QE7 G;  4DUZ B;  4YHH B;  3ZJZ A;  3LUT B;  4GT1 A;  3K5M A;  4B3R B;  3ABM C;  2P22 C;  3IC7 A;  4PDV A;  5A2Q N;  1ZUQ A;  4GKJ O;  2ZIN A;  4YY3 O;  5B3S C;  2PI4 A;  1WP7 A;  2GUZ B;  2CGO A;  4GYC B;  2UXC B;  1S5H C;  2GHY A;  5LL6 Y;  2E5L B;  4J7J A;  3OUS A;  3DGE A;  4X62 B;  3H01 A;  3UO2 A;  3PJS K;  4JI3 O;  2FML A;  2ILM A;  2VQE O;  1XHX A;  4FLV A;  1S3J A;  2P7T C;  1JFF A;  3K5N A;  1OJH A;  4K0K B;  1OHH G;  4DV0 O;  1JA8 A;  3SJB C;  4GLX A;  4X66 O;  2ZD9 A;  2XUM A;  1XOU A;  3JAT A;  1P7B A;  4I5S A;  1WA8 A;  4XDL A;  3HKC B;  4DR3 O;  2JJ1 G;  4TT3 G;  1R3I C;  3RYI B;  4K3A A;  3BAB A;  4YIP A;  2YXY A;  2NN4 A;  3BVO A;  3L72 H;  4GZR B;  4JYA O;  4TWK A;  1G1X B;  4NTW A;  2CAZ C;  1KEC A;  4DV7 B;  1IBL O;  2ZR3 A;  4B08 A;  4WFF A;  5AG2 A;  4P9P A;  1M57 C;  4YIO A;  3ZHU A;  1PKX A;  2WLM A;  4B3T O;  5L3G A;  4LF4 B;  2Y4U A;  5BMV A;  2X6A A;  4D7T A;  2JEU A;  1QVG U;  3DSQ A;  4HAM A;  4LWS A;  3CMA V;  3KCY A;  1TUE B;  5H9C A;  2DW4 A;  1PNK A;  3H9V A;  2OYQ A;  2FTK A;  4JI8 B;  3WU2 Z;  1AI7 A;  4JGS A;  1AB3 A;  3F5W C;  3JD4 A;  1SRY A;  3H1K H;  1S5L Z;  2A3Q A;  3MHH C;  5LYJ B;  2E76 B;  4FPP A;  4DRX A;  1XMQ B;  4ZIB A;  2XAJ A;  1BE3 H;  1R3L C;  2RDC A;  2UXD O;  3RBZ A;  3SJC C;  4D6T H;  1F23 A;  5IY5 C;  4E4E A;  1JX9 A;  1VF6 A;  4NXN B;  2V7Q G;  4LCU C;  1THZ A;  4ASU G;  1H2M A;  4ZOL B;  3C90 A;  3ICX A;  2UUA B;  3IC9 A;  5KHG A;  2WLN A;  3HKB B;  5LMN O;  2PTM A;  3G6E V;  4WF9 V;  4KHP B;  2Q73 A;  1GKF A;  1R3K C;  4JZ2 A;  1Q8I A;  5EBL C;  2GUZ A;  3MAQ A;  5EK0 A;  1VQP V;  1GN4 A;  2ZE6 A;  2IBT A;  1NBM G;  5H6R A;  4DR1 B;  1XUQ A;  1PL4 A;  2Y0P A;  5BMV B;  4PJ0 Z;  1VQK V;  1QR8 A;  3FB8 C;  4IHJ A;  2EJR A;  2YUA A;  3PN1 A;  1E79 G;  1K73 W;  3AK2 A;  1SZX A;  1FPO A;  1SQQ H;  3VQV A;  4XDJ A;  2ZE8 A;  4TQD A;  2QR4 A;  1EN6 A;  4DO2 A;  4P30 A;  4DV1 O;  2CTP A;  2F1M A;  1HNX B;  2OWO A;  4DV2 B;  1HNZ B;  1TGO A;  1W0J G;  1O9H A;  4JI7 B;  4U3F H;  3G6B A;  4B7E A;  3P3P A;  3EHB B;  1XNQ O;  1N34 B;  1SF9 A;  3NR7 A;  4O2A B;  4MT8 A;  2CDY A;  1E1R G;  1SS3 A;  3THO A;  1ZL8 B;  4OPH A;  4DV3 B;  1N33 B;  1VMG A;  3CRQ A;  3VBB A;  3ZRV A;  5LMU O;  1YVW A;  1SQB H;  1OV9 A;  4PA9 A;  3ZRS A;  4NVP A;  2BTQ A;  4Q20 A;  2QA4 V;  1G4Y B;  2YIC A;  3FFQ A;  2CTR A;  3AG3 B;  3SR2 C;  2HJF C;  1SA0 B;  4ZHQ B;  1SQF A;  4DR5 O;  5CA1 A;  3G80 A;  4QPK A;  4TV8 A;  3Q4H B;  4BIU A;  4J7K A;  4X1I A;  4O4J B;  4LC1 A;  3OT7 A;  5DM6 V;  1YXB A;  1DF4 A;  1HP8 A;  2CH7 B;  3LDD A;  2B1G A;  1YF2 A;  3JAS A;  2ZNJ A;  3SGI A;  1RPO A;  4MVQ A;  3W7W A;  1WP8 A;  4I0X B;  3APQ A;  3LSU A;  5K1X A;  4U7N A;  2IJI A;  1AR4 A;  3FKS G;  2P67 A;  4TUY A;  3E35 A;  3JSL A;  2W0X A;  3AG3 C;  3EFF K;  4LF7 O;  2EIN B;  1TVK B;  1SES A;  3OMN B;  4JI1 B;  1N32 B;  2BE3 A;  2GDS A;  1Q6U A;  2WLI A;  2LQT A;  4Z2W A;  4YHH O;  2OIG A;  4O2B B;  2PGG A;  4MW3 A;  1GMG A;  4UCV A;  4AIL C;  4B3M B;  5CBH A;  2KKW A;  5HFL A;  3RVZ A;  3JAT B;  3BRC A;  5IYD O;  5IYZ B;  1K33 A;  1M93 A;  2VS0 A;  3K0D A;  1DK1 A;  3QTC A;  2E5L O;  2QWO B;  1H2G A;  1EM1 A;  5D5P A;  5CA3 A;  3DTU B;  1FD9 A;  1Z2G A;  2EZP A;  4FFK A;  1QR9 A;  1A32 A;  4BR6 A;  4HNA A;  4H44 B;  2UXB B;  5FNV B;  4JF3 A;  1WLE A;  5IYC O;  3BEH A;  2ZDI C;  4BIZ A;  5KMG B;  1EZV H;  2VWK A;  5LOV A;  4CH6 A;  3A2F A;  4R8C A;  4Q6G A;  4HZ3 A;  3QO8 A;  1URF A;  4J42 A;  2ZM6 O;  3BY6 A;  1YI2 V;  3KKY A;  3ZMS A;  1MA1 A;  5LOV B;  2P90 A;  2ZE7 A;  1TVK A;  2XAG A;  4DV7 O;  4RO2 A;  2CGN A;  2DYR B;  3ZN1 A;  4I55 A;  2Q9L A;  3ZIA G;  1BSM A;  2WLJ A;  4MTO A;  5F2V O;  2OCH A;  1XL6 A;  3QO5 A;  2ZCE A;  3JAS B;  4B3T B;  4WFH A;  3E8H A;  3ETQ A;  3JYC A;  1F7Y A;  4LF6 O;  3K5O A;  3ZHT A;  4O4I B;  5KHH A;  1E1Q G;  1QQC A;  4WBN B;  5EYP B;  1FXK B;  4X20 B;  4NR1 A;  3L74 H;  5LHI A;  5EBW C;  1J95 A;  3WG7 C;  3ABL C;  5IWA B;  4JI8 O;  4ZKI A;  3X2Q B;  2JGD B;  5JJJ B;  4LFC B;  4ZI7 A;  3CS5 A;  2ITC C;  2ZIM A;  2XND G;  1K4C C;  4MVU A;  2LFR A;  4PDM A;  2X6B A;  5CB4 A;  4J7Z A;  1Q86 W;  1RP3 B;  4I0X A;  4YXW G;  1AR1 B;  3ABM B;  3WG7 B;  5KAF Z;  4RQE A;  4FLW A;  1MZE A;  1QLE B;  4ZI7 B;  1COW G;  1ENV A;  1EBO A;  1Q3E A;  1FXH A;  5KAI Z;  3CME V;  1IXB A;  1GRJ A;  3AG7 A;  1AJP A;  5L3E A;  2EIM B;  1Z5W A;  2JGU A;  1Y6X A;  3NXS A;  2HVK C;  3J81 N;  2VWJ A;  1ARO P;  4L8J A;  3MDS A;  1Y66 A;  4WFA V;  3UT5 B;  1AI6 A;  1YJN V;  1SKV A;  4LBE C;  1UJW B;  4TV9 B;  2ITD C;  1M1K W;  1K8A W;  4U3J B;  3M7M X;  3E22 B;  3G4S V;  2QM8 A;  3D36 C;  4JAA A;  1I08 A;  2LP7 A;  1HNW B;  2AHZ A;  1U96 A;  3BFR A;  1Q6H A;  1WPB A;  4KP4 A;  3M8A A;  4NTY A;  1IDS A;  4O4H B;  2KSD A;  4I55 B;  2DOS A;  1KU9 A;  3FB6 C;  3SPG A;  2ODM A;  3GWK C;  4DW1 A;  2WLL B;  2B9Z A;  3ML0 A;  1HNZ O;  1V54 C;  4X65 B;  3VQW A;  3CPW U;  3RW0 A;  3F5T A;  1B6Q A;  3A0B Z;  4DW0 A;  2QKC A;  4BW5 A;  2Q8V A;  1W2B U;  2Q7H A;  3FYE B;  2A06 H;  2V4D A;  4F6E A;  3LSS A;  3HKD B;  2L35 A;  1NTZ H;  1FAF A;  2EIK B;  4DXW A;  5LMU B;  4QJF B;  1OCO B;  1XRE A;  4UVA A;  3K06 A;  2Q67 A;  5DN6 G;  3E8G A;  2H94 A;  4B7K A;  2DN9 A;  4IIJ B;  4NXM O;  4DV5 B;  1IVS A;  4JAS A;  3CCR V;  4B3S O;  1EZJ A;  3SYA A;  4DR7 O;  2LW7 A;  4ABM A;  2D2C B;  1TA8 A;  2WLI B;  4I50 A;  1R73 A;  4YY3 B;  4NYK A;  4PD4 F;  2EZO A;  4E2L A;  4RUE A;  3P30 A;  1M4U A;  4FJC C;  4D7S A;  4LH6 A;  4FLZ A;  1VQ9 V;  4JI3 B;  1ORQ C;  3K08 A;  1YIT V;  4JYB A;  2XAF A;  2HHH B;  4UV8 A;  3SJQ C;  1VQ8 V;  4EEQ A;  2JVD A;  4X64 O;  1H2S B;  5KHJ A;  1AP6 A;  1K97 A;  1VQL V;  4JV5 B;  5FPR A;  2M7W A;  1YZB A;  3RYI A;  5L3D A;  1AJN A;  1MSW D;  4K0K O;  1T5E A;  1SET A;  4DK0 A;  4X66 B;  2UU9 B;  2UUB B;  1VF5 B;  3LDC A;  5KHK A;  5L3B A;  1S77 D;  1P49 A;  1NU1 H;  4DR3 B;  4GX2 A;  4O4J A;  4DR2 O;  5IT9 N;  2PI5 A;  1HWY A;  1ZL8 A;  4ZHQ A;  2EJ7 A;  4DR4 B;  1CP9 A;  4O4I A;  3I55 V;  1ZWI C;  3OR7 C;  3ZHV A;  5KUM A;  2IH1 C;  3CCV V;  4X1K A;  5EZY B;  1VQ5 V;  1YCI A;  4CS4 A;  5E79 Z;  2V1D A;  1NH2 B;  2XHB A;  1I94 O;  3U0Z A;  2KG7 B;  1BGY H;  1LUW A;  1SZT A;  3ABL B;  1F4N A;  4NKG B;  3ZN0 A;  4GKK B;  3B2E E;  1H2N A;  1RSO B;  2ETN A;  4RQF A;  4ZOL A;  3ZHQ A;  2LGW A;  2MW2 B;  5GTI Z;  2YI8 A;  3OTF A;  2X7R B;  2ZM6 B;  1NT2 B;  5JQG A;  1B3Q A;  2HVJ C;  4JI6 B;  4X88 A;  1VQ4 V;  1OZ0 A;  1GO3 F;  4JAU A;  4OXS A;  5D5Q A;  1SC5 B;  5JQG B;  3T4Z A;  3RYC B;  3CC4 V;  3RWR D;  4X9Q A;  3F7V C;  3J80 N;  4J11 A;  5B1A C;  4X1Y B;  2PYL A;  5FPO A;  3RYH B;  1QVF U;  2DWD C;  1WB7 A;  1IXM A;  4TV9 A;  1NJI W;  5L3C A;  1XMQ O;  1GN6 A;  3IAY A;  1FJG O;  1I0H A;  3ASN C;  1DF5 A;  4FLY A;  4JTA B;  3HKB A;  3BCC H;  5LBQ A;  2UUC B;  4YJ3 A;  2DQ0 A;  2ZKO A;  3QNE A;  4JI5 O;  1JOY A;  2EIL C;  4DRX B;  1BCC H;  5LP6 C;  2CTW A;  5B66 Z;  4NXN O;  2Q7G A;  2YS8 A;  4O2B A;  4TQF A;  2A7W A;  2EIN C;  1KQS U;  4FM1 A;  5JVD A;  2YXH A;  2Q0A A;  2DYR C;  4KHP O;  1MAB G;  1ZTE A;  4H33 A;  1TAE A;  2Y69 C;  5CB4 B;  3HR0 A;  3O65 A;  3UO3 A;  4DV6 O;  4WFG A;  5LA6 B;  3T1H B;  3L73 H;  2ZXW C;  3ETD A;  4JTD B;  1H8E G;  5CA1 B;  2YIA A;  2WWW A;  3LNN A;  2FL4 A;  1IBK O;  2N05 A;  5ITZ B;  3S3X A;  2LO1 A;  2JRI A;  2BTQ B;  1OCR C;  4BW9 A;  4LH7 A;  4IGG A;  1GN3 A;  1PPJ H;  4MVM A;  3ZHR A;  1L8D A;  1H38 A;  4JI7 O;  5EC1 C;  4KL1 A;  5BR8 B;  1GN2 A;  2W6I G;  3KCX A;  2QKA A;  3JAM N;  4GCZ A;  4I4T B;  3UQ8 A;  5KA6 A;  1H8H G;  4JI0 B;  4EB6 A;  2M6Y A;  4DV3 O;  2YXL A;  1MZF A;  4CBC A;  5B1N A;  3B40 A;  1WN7 A;  2IW5 A;  2WSS G;  4MVO A;  3ZHS A;  3I56 V;  3W7U A;  1AQJ A;  3HKC A;  3JCZ A;  5JH7 A;  3A0R A;  2R9A A;  1Q6I A;  4X65 O;  1BL8 A;  4C7U A;  2WPD G;  4RUF A;  5LXT B;  2E75 B;  3QO7 A;  3B8M A;  4NTX A;  1RM1 B;  1V54 B;  2A0L A;  4ZBM A;  3ZRW A;  1G38 A;  4H37 A;  5LP6 A;  4JI4 O;  2QWQ B;  1MSD A;  4UVC A;  2EIL B;  2YDE A;  1Q7Y W;  5IE9 A;  2Q6A A;  3D3I A;  3QVN A;  4PA3 A;  3OKG A;  4QE9 A;  5KLV H;  5LGU A;  4H13 B;  5LGT A;  2DJV A;  3LSQ A;  3O9O A;  3F7Y C;  4J41 A;  1JFF B;  2ATK C;  4AQY B;  3TXS A;  1K4D C;  2ADM A;  3E89 A;  3W7S A;  3CD6 V;  2Q0O C;  4LNU A;  4JI1 O;  1N32 O;  2NR5 A;  4NXM B;  5EIB D;  4DV5 O;  4PI0 A;  3ZMV A;  1N0J A;  4JI2 B;  5LHG A;  1JQ0 A;  3OE7 G;  2Q69 A;  3CJH B;  1KMI Z;  1FXV A;  3W7X A;  4B3M O;  2IH4 A;  5KHI A;  2PZS A;  3ASO C;  1XQ8 A;  3JSN A;  3OGI B;  1HR0 O;  3K58 A;  1SQG A;  1SQP H;  2XAQ A;  1QHT A;  3ABK B;  1M9N A;  3AG2 C;  2GTA A;  5C8Y B;  2XT9 A;  1VF7 A;  3OW2 U;  4MW8 A;  2CTQ A;  2QKS A;  2VQF O;  3CWB H;  3L71 H;  4X64 B;  1R3J C;  2IH2 A;  3FAV B;  3S3W A;  2AHY A;  3L70 H;  1AVM A;  2QWP B;  3E8F A;  1WAZ A;  4LF8 O;  3IGA C;  4PEL A;  4A5U B;  2H8P C;  2RNB A;  4PDR A;  2UXB O;  1N0N A;  3N2G B;  5B5E Z;  5JJN B;  2HR3 A;  4EKW A;  2UUB O;  3OTO B;  3RVY A;  5BZB A;  4KUM A;  2DMX A;  4HBN A;  5EZY A;  3MD0 A;  4DR2 B;  2YI9 A;  3HKE B;  1YTF D;  1MG1 A;  4JYY A;  4DR4 O;  3X2Q C;  4PDL A;  1XI1 A;  1SA0 A;  4DK1 A;  3E8B A;  1XNR O;  2WAM A;  1DTO A;  2F4V O;  3ZBH A;  2HP8 A;  3SYO A;  1I94 B;  3K9S A;  4GX1 A;  4DR6 O;  1FFX B;  1FXK A;  4X20 A;  4MTG A;  4TSF G;  2AW9 A;  2RQ6 A;  3JD1 A;  3G71 V;  4GKK O;  1GK9 A;  4WFB V;  2Q68 A;  3AK3 A;  2D3O W;  2R9R B;  3OMA B;  1Y74 B;  3JAR B;  2BOB C;  3QF7 A;  2Q4P A;  4LF6 B;  3CP1 A;  3RFR A;  3UCS C;  2QSA A;  4PHZ A;  3DXR A;  5LA6 A;  3T1Y B;  4BAY A;  1EN5 A;  4CC5 A;  4TOI A;  2NP6 A;  4F6R B;  1V55 B;  1IBM O;  1BT8 A;  1ZSP A;  1Q43 A;  3QG5 A;  1H2L A;  5J2U A;  3M99 B;  2EIK C;  2VRZ A;  3CCM V;  3FAV A;  1VQM V;  5DEC A;  4AI8 A;  3K04 A;  3FYI B;  4IHJ B;  2QTS A;  3ETG A;  4JYC A;  4LR3 A;  2P4V A;  5CBG A;  2L6L A;  1YHQ V;  1GH6 A;  1VEW A;  1FJG B;  2C2A A;  3TET A;  4KXR A;  4NB5 A;  2IBZ H;  3HKD A;  3IJ4 A;  1GM9 A;  3CJH A;  3KG2 A;  4JI5 B;  4K35 A;  2ADQ B;  1NKD A;  4W4L A;  3VOU A;  3OEE G;  4R50 A;  3UKM A;  1H2K A;  4X8A A;  1K92 A;  2IH3 C;  3AK1 A;  1K3E A;  5EIB C;  5BY1 A;  2YEV B;  2IH5 A;  3H1J H;  5HFM A;  3WB0 A;  3AG4 B;  5KX5 B;  4DV4 O;  5LHH A;  2PYJ A;  4O4H A;  1RM1 C;  3OMI B;  4PA6 A;  5JCO A;  5IJ0 A;  5JJE B;  2Y69 B;  4HNA B;  4QIW F;  5LYJ A;  3T1H O;  1DGS A;  1WPX A;  4CS2 A;  5C93 A;  5J9P C;  2FB5 A;  3A0H Z;  4R6Z A;  3H1I H;  2EBO A;  3K0G A;  1IBK B;  3FD9 A;  3ABT A;  4I9Q A;  3RYF A;  3JAK A;  4UCO A;  1JR9 A;  4QGP A;  1OCC C;  5IYZ A;  4X1K B;  1KYO F;  5CMU A;  1SQV H;  3SPJ A;  5BR8 O;  4H0L B;  1RPR A;  2IJJ A;  5H6Q A;  1XMO O;  2LFS A;  1XL4 A;  3JAW A;  1K7D A;  3LDE A;  1GTO A;  2OTL V;  4FM0 A;  1IX9 A;  5IJ9 A;  4GX5 A;  3SPH A;  3CC7 V;  4JTC B;  2QEX V;  1LR1 A;  2IU0 A;  5B1O A;  4F6R A;  4J80 A;  4FLT A;  2QJ1 A;  5JH7 B;  5ITZ A;  2PUS A;  3L9D A;  2HKO A;  4MVZ A;  1RFY A;  2ZXW B;  2CH7 A;  3B4S A;  2P06 A;  1AI5 A;  4G2K A;  4B3S B;  1MOF A;  3OGC C;  4DR7 B;  4UCR A;  4EFB A;  3ASN B;  1AR5 A;  1NTM H;  2QDO A;  4UCS A;  2B5U A;  3B8N A;  2GV9 A;  1M90 W;  1P4R A;  4FFB A;  1YDX A;  1XDC A;  1BQ0 A;  3JD3 A;  2HHH O;  2HEP A;  3VQY A;  4DUZ O;  4O2A A;  1NVP B;  4WFE A;  3K9A A;  4JV5 O;  1GM8 A;  4FM2 A;  3SYC A;  1W0K G;  2EIM C;  3HPL C;  3SPC A;  2DQ3 A;  2DWE C;  4UUJ C;  1HW7 A;  4GKJ B;  2DYS C;  4BWA A;  4IL6 Z;  4I7Z B;  1NI8 A;  2HFE C;  1HR0 B;  2UU9 O;  2QGN A;  2Y48 A;  3CE2 A;  1AJQ A;  3JAL A;  3CC2 V;  1FKA O;  3RYH A;  3ABK C;  4OGQ B;  2N04 A;  2VQF B;  5JVD B;  1XIL A;  3P3N A;  1OCR B;  2A79 B;  5A9G A;  1Q90 D;  3ZRW B;  5B1A B;  2R70 A;  5GON A;  4N21 A;  3CEI A;  2QTO A;  2DYS B;  2XAS A;  1YTF B;  5KMG A;  3TGU H;  2OCC B;  4DV0 B;  4OX9 B;  4YJ3 B;  5GTH Z;  2GSM B;  3AG4 C;  1R6N A;  2W0F C;  3K79 A;  1HDJ A;  3G67 A;  4KFM A;  2ZNI A;  4MVS A;  1NR1 A;  3JCU Z;  1F51 A;  3ETE A;  1X59 A;  3U11 A;  1JVM A;  4MTX A;  3MHS C;  4R7C A;  2P6J A;  4G28 B;  3TXQ A;  3CB2 A;  4I4T A;  4JYA B;  2OTJ V;  4JI6 O;  3RYC A;  2EIJ B;  1WNS A;  1IUR A;  1AQI A;  1VIB A;  4HYO A;  3HB3 B;  1P7G A;  1YJ9 V;  2GTS A;  2KG7 A;  3P32 A;  1S76 D;  4QE7 A;  4CH3 A;  1KKC A;  1D5A A;  2YIB A;  3WB1 A;  3JD0 A;  2F43 G;  4QPJ A;  1KP3 A;  3CYO A;  3H1L H;  4UVB A;  4LF5 B;  1YJW V;  3JD2 A;  2FKX A;  5FLX N;  4LF4 O;  2JJ2 G;  1B04 A;  1U97 A;  2JS3 A;  1N36 O;  3LNM B;  3KZI Z;  5LGN A;  3JAL B;  3N2K B;  3OEH G;  1TUB A;  2AZ2 A;  5CA0 B;  1SQX H;  2QWR B;  1S72 V;  1IBM B;  1CEZ A;  1KBH A;  4AHC A;  2UUC O;  1Q5O A;  1XBL A;  2IJH A;  3CX5 F;  1D2D A;  4EB6 B;  2WA4 A;  4TV8 B;  4PA4 A;  2EUL A;  3I5D A;  2JGD A;  1QCE A;  2EX3 A;  2Y0I A;  1QNM A;  1NS1 A;  2ZT9 B;  3CCE V;  1M56 C;  2YSU B;  1WA8 B;  4JAV A;  4YJ2 B;  2Z3Y A;  3BPZ A;  3IFX A;  4LFA O;  1OCZ C;  5EYP A;  3WFV A;  1G8M A;  2RN9 A;  5K1P A;  4DV6 B;  2ARH A;  2HG5 C;  3A8T A;  3AEI A;  4CZZ A;  2Z0A A;  4FMT A;  3OM3 B;  1DLB A;  1UFI A;  5IDJ A;  3RGB A;  4BIO A;  1SER A;  1VQ7 V;  1KB9 F;  2ZQM A;  2E74 B;  1M56 B;  3CRC A;  1KC8 W;  4LF9 O;  2UUA O;  5B1B B;  5E1A C;  3BA9 A;  2XTA A;  5LMN B;  2YC0 A;  4LFB B;  3E2E A;  1D5N A;  1TUB B;  3N2K A;  5KA5 A;  3ZX6 A;  1PNM A;  4DV4 B;  2JEX A;  1ZX3 A;  3TJT A;  2RCV A;  2Y4T A;  4U7O A;  1M5I A;  1L0N H;  5EBM C;  1FS0 G;  1L0L H;  1J5E B;  2W6J G;  3K57 A;  2WLH A;  5GON B;  4DR1 O;  1Y4M A;  1Y67 A;  1O9G A;  4MS2 A;  3OFN G;  1NQT A;  3K5L A;  5H2F Z;  4MTF A;  4JI0 O;  2NP7 A;  2JK5 C;  3OR6 C;  2ZDI A;  4MSW C;  1M57 B;  2OCC C;  1BMF G;  1QLN A;  3TK1 A;  1BS3 A;  1BHB A;  2IBS A;  4UV9 A;  2K9P A;  3ASO B;  1JCH A;  4DUY O;  2ZE5 A;  4FIP C;  1JMK C;  1K5Q A;  2O57 A;  3B77 A;  4DV2 O;  2LW1 A;  3E86 A;  2ZIO A;  1I7F A;  4L87 A;  3K3W A;  1WJZ A;  1XMO B;  2DE0 X;  3D8C A;  4Z1V A;  4JI4 B;  4IT5 A;  3N27 A;  3CRA A;  4U3J A;  4UB6 Z;  2GBO A;  2P5O A;  1V55 C;  1OCZ B;  2QWN B;  3CRR A;  1JJ2 U;  1EN4 A; 
#chains in the Genus database with same CATH homology
 1YDX A;  3OKG A;  1YF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...