The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
147
|
sequence length |
497
|
structure length |
479
|
Chain Sequence |
QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The ErbB4 extracellular region retains a tethered-like conformation in the absence of the tether.
pubmed doi rcsb |
| molecule tags |
Transferase, signaling protein
|
| source organism |
Homo sapiens
|
| molecule keywords |
Receptor tyrosine-protein kinase erbB-4
|
| total genus |
147
|
| structure length |
479
|
| sequence length |
497
|
| ec nomenclature |
ec
2.7.10.1: Receptor protein-tyrosine kinase. |
| pdb deposition date | 2011-10-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00757 | Furin-like | Furin-like cysteine rich region |
| A | PF01030 | Recep_L_domain | Receptor L domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A domain 2 | Hormone Receptor, Insulin-like Growth Factor Receptor 1; Chain A, domain 2 | ||
| Alpha Beta | Alpha-Beta Horseshoe | 24 nucleotide stem-loop, u2 snrnp hairpin iv. U2 a'; Chain A | Receptor L-domain | ||
| Alpha Beta | Alpha-Beta Horseshoe | 24 nucleotide stem-loop, u2 snrnp hairpin iv. U2 a'; Chain A | Receptor L-domain |
#chains in the Genus database with same CATH superfamily 3WLW A; 4BSO A; 1S78 A; 1NQL A; 2A91 A; 3BE1 A; 5J3H E; 3U2P A; 3NJP A; 4BSR C; 3H3B A; 4QXF C; 4BSP A; 1N8Y C; 4C8V A; 4C9U B; 4BSS C; 4KT1 E; 4C9E B; 3U9U E; 4XST E; 4UFR B; 3B2U A; 3N85 A; 4UV7 A; 4XSS E; 4KRL A; 4HRL C; 3QWQ A; 3I2T A; 3WSQ A; 3B2V A; 1MOX A; 2AHX A; 4C9V B; 3P11 A; 4C9A B; 3C09 A; 4LI2 B; 3P0Y A; 4BSU C; 4CDK E; 4LEO C; 2HR7 A; 4OGA E; 4KRP A; 1IVO A; 4KNG M; 4P59 A; 4C8W I; 4C99 B; 4KRO A; 3W11 E; 3LTG A; 3U7U A; 3MZW A; 5SX5 M; 4C9R B; 1M6B A; 1N8Z C; 4HRN C; 5SX4 M; 3LTF A; 4HRM A; 1YY9 A; 1IGR A; 4KRM A; #chains in the Genus database with same CATH topology 3WLW A; 4BSO A; 1S78 A; 1NQL A; 2A91 A; 3BE1 A; 5J3H E; 3U2P A; 3NJP A; 4BSR C; 3H3B A; 4QXF C; 4BSP A; 1N8Y C; 4C8V A; 4C9U B; 4BSS C; 4KT1 E; 4C9E B; 3U9U E; 4XST E; 4UFR B; 3B2U A; 3N85 A; 4UV7 A; 4XSS E; 4KRL A; 4HRL C; 3QWQ A; 3I2T A; 3WSQ A; 3B2V A; 1MOX A; 2AHX A; 4C9V B; 3P11 A; 4C9A B; 3C09 A; 4LI2 B; 3P0Y A; 4BSU C; 4CDK E; 4LEO C; 2HR7 A; 4OGA E; 4KRP A; 1IVO A; 4KNG M; 4P59 A; 4C8W I; 4C99 B; 4KRO A; 3W11 E; 3LTG A; 3U7U A; 3MZW A; 5SX5 M; 4C9R B; 1M6B A; 1N8Z C; 4HRN C; 5SX4 M; 3LTF A; 4HRM A; 1YY9 A; 1IGR A; 4KRM A; #chains in the Genus database with same CATH homology 3WLW A; 4BSO A; 1S78 A; 1NQL A; 2A91 A; 3BE1 A; 5J3H E; 3U2P A; 3NJP A; 4BSR C; 3H3B A; 4QXF C; 4BSP A; 1N8Y C; 4C8V A; 4C9U B; 4BSS C; 4KT1 E; 4C9E B; 3U9U E; 4XST E; 4UFR B; 3B2U A; 3N85 A; 4UV7 A; 4XSS E; 4KRL A; 4HRL C; 3QWQ A; 3I2T A; 3WSQ A; 3B2V A; 1MOX A; 2AHX A; 4C9V B; 3P11 A; 4C9A B; 3C09 A; 4LI2 B; 3P0Y A; 4BSU C; 4CDK E; 4LEO C; 2HR7 A; 4OGA E; 4KRP A; 1IVO A; 4KNG M; 4P59 A; 4C8W I; 4C99 B; 4KRO A; 3W11 E; 3LTG A; 3U7U A; 3MZW A; 5SX5 M; 4C9R B; 1M6B A; 1N8Z C; 4HRN C; 5SX4 M; 3LTF A; 4HRM A; 1YY9 A; 1IGR A; 4KRM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
