The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
SDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structures of Poly(ADP-ribose) Polymerase-1 (PARP-1) Zinc Fingers Bound to DNA: STRUCTURAL AND FUNCTIONAL INSIGHTS INTO DNA-DEPENDENT PARP-1 ACTIVITY.
pubmed doi rcsb |
molecule tags |
Dna binding protein/dna
|
source organism |
Homo sapiens
|
molecule keywords |
Poly [ADP-ribose] polymerase 1
|
total genus |
18
|
structure length |
87
|
sequence length |
87
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature |
ec
2.4.2.30: NAD(+) ADP-ribosyltransferase. |
pdb deposition date | 2010-08-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00645 | zf-PARP | Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | first zn-finger domain of poly(adp-ribose) polymerase-1 | Zinc finger, PARP-type |
#chains in the Genus database with same CATH superfamily 3ODC A; 4OPX A; 3OD8 A; 3ODA A; 1V9X A; 2L31 A; 4OQB A; 4AV1 A; 2DMJ A; 1UW0 A; 2N8A A; 4OQA A; 4DQY A; 3ODE A; 2CS2 A; 2L30 A; #chains in the Genus database with same CATH topology 3ODC A; 4OPX A; 4AV1 A; 2N8A A; 3J7A 3; 4DQY A; 3ODE A; 2L30 A; 3J80 a; 5FLX a; 3JAM a; 5LL6 e; 3ODA A; 1UW0 A; 2CS2 A; 4OQA A; 5IT9 a; 3OD8 A; 4OQB A; 2DMJ A; 1V9X A; 5A2Q a; 3J81 a; 2L31 A; #chains in the Genus database with same CATH homology 3ODC A; 4OPX A; 3OD8 A; 3ODA A; 1V9X A; 2L31 A; 4OQB A; 4AV1 A; 2DMJ A; 1UW0 A; 2N8A A; 4OQA A; 4DQY A; 3ODE A; 2CS2 A; 2L30 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...