The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
132
|
structure length |
128
|
Chain Sequence |
ENPFKEKLLEIMASIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNSLKLDETDEFLMNLFFDNKKMLKKLAENPKYE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
MDA5 cooperatively forms dimers and ATP-sensitive filaments upon binding double-stranded RNA.
pubmed doi rcsb |
| molecule tags |
Antiviral protein, hydrolase
|
| source organism |
Mus musculus
|
| molecule keywords |
Interferon-induced helicase C domain-containing protein 1
|
| total genus |
53
|
| structure length |
128
|
| sequence length |
132
|
| ec nomenclature |
ec
3.6.4.13: RNA helicase. |
| pdb deposition date | 2011-09-12 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | phosphoenolpyruvate carboxylase, domain 3 | phosphoenolpyruvate carboxylase, domain 3 |
#chains in the Genus database with same CATH superfamily 5F9H A; 3TS9 A; 3ZD6 A; 5F98 A; 3ZD7 A; 4BPB A; 5E3H A; 4A36 A; 5F9F A; 4AY2 A; 4A2Q A; 4GL2 A; 4ON9 A; 3TBK A; 4I1S A; 4A2W A; 2YKG A; 4A2P A; #chains in the Genus database with same CATH topology 3TS9 A; 5F9F A; 4AY2 A; 3TBK A; 4BPB A; 4A36 A; 3ZD6 A; 1WP9 A; 4I1S A; 2YKG A; 4A2P A; 3ZD7 A; 5E3H A; 5F9H A; 4A2W A; 5F98 A; 4A2Q A; 4GL2 A; 4ON9 A; #chains in the Genus database with same CATH homology 5F9H A; 3TS9 A; 3ZD6 A; 5F98 A; 3ZD7 A; 4BPB A; 5E3H A; 4A36 A; 5F9F A; 4AY2 A; 4A2Q A; 4GL2 A; 4ON9 A; 3TBK A; 4I1S A; 4A2W A; 2YKG A; 4A2P A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
