The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
182
|
structure length |
182
|
Chain Sequence |
MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRAGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Lyase
|
molecule keywords |
Alr2278 protein
|
publication title |
Insights into BAY 60-2770 Activation and S-Nitrosylation-Dependent Desensitization of Soluble Guanylyl Cyclase via Crystal Structures of Homologous Nostoc H-NOX Domain Complexes.
pubmed doi rcsb |
source organism |
Nostoc sp.
|
total genus |
59
|
structure length |
182
|
sequence length |
182
|
chains with identical sequence |
B
|
ec nomenclature |
ec
4.6.1.2: Guanylate cyclase. |
pdb deposition date | 2012-12-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07700 | HNOB | Haem-NO-binding |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | H-NOX domain | H-NOX domain |
#chains in the Genus database with same CATH superfamily 2O09 A; 5JRX A; 4U9G A; 4IAE A; 4IAM A; 2O0C A; 3TFF A; 3L6J A; 4JQH A; 2O0G A; 3IQB A; 3NVR A; 4U9J A; 3NVU A; 3TF9 A; 4IAH A; 3SJ5 A; 3TFG A; 3TFA A; 3TF0 A; 4U9B A; 4FDK A; 4U99 A; 5JRV A; 1U55 A; 1XBN A; 5JRU A; 3TFE A; 3TF1 A; 2KII A; 2KIL A; 3TFD A; 3EEE A; 4IT2 A; 4U9K A; 1U56 A; 3LAI A; 3LAH A; 3M0B A; 1U4H A; 3TF8 A; #chains in the Genus database with same CATH topology 2O09 A; 5JRX A; 4U9G A; 4IAE A; 4IAM A; 2O0C A; 3TFF A; 3L6J A; 4JQH A; 2O0G A; 3IQB A; 3NVR A; 4U9J A; 3NVU A; 3TF9 A; 4IAH A; 3SJ5 A; 3TFG A; 3TFA A; 3TF0 A; 4U9B A; 4FDK A; 4U99 A; 5JRV A; 1U55 A; 1XBN A; 5JRU A; 3TFE A; 3TF1 A; 2KII A; 2KIL A; 3TFD A; 3EEE A; 4IT2 A; 4U9K A; 1U56 A; 3LAI A; 3LAH A; 3M0B A; 1U4H A; 3TF8 A; #chains in the Genus database with same CATH homology 2O09 A; 5JRX A; 4U9G A; 4IAE A; 4IAM A; 2O0C A; 3TFF A; 3L6J A; 4JQH A; 2O0G A; 3IQB A; 3NVR A; 4U9J A; 3NVU A; 3TF9 A; 4IAH A; 3SJ5 A; 3TFG A; 3TFA A; 3TF0 A; 4U9B A; 4FDK A; 4U99 A; 5JRV A; 1U55 A; 1XBN A; 5JRU A; 3TFE A; 3TF1 A; 2KII A; 2KIL A; 3TFD A; 3EEE A; 4IT2 A; 4U9K A; 1U56 A; 3LAI A; 3LAH A; 3M0B A; 1U4H A; 3TF8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...